diff --git a/languages/lazaruside.es.po b/languages/lazaruside.es.po index 4a73a0f876..744f55fce8 100644 --- a/languages/lazaruside.es.po +++ b/languages/lazaruside.es.po @@ -1,7 +1,7 @@ msgid "" msgstr "" "Last-Translator: Jesus Reyes Aguilar \n" -"PO-Revision-Date: 2009-09-02 16:18-0600\n" +"PO-Revision-Date: 2009-09-03 14:45-0600\n" "Project-Id-Version: lazaruside\n" "Language-Team: \n" "Content-Type: text/plain; charset=UTF-8\n" @@ -15,7 +15,7 @@ msgstr "Restablecer todas las llamadas" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" -msgstr "Restablecer todos los ajustes del gutter" +msgstr "Restablecer todos los ajustes del Panel Fijo" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" @@ -32,11 +32,11 @@ msgstr "General" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on Mouse down" -msgstr "Normal. Todas las acciones (breakpoint, plegado) al presionar el botón del Mouse" +msgstr "Normal. Todas las acciones (breakpoint, plegado) al hacer clic" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move" -msgstr "Extendido. Acciones (breakpoint, fold) al soltar el botón del Mouse. Seleccion al presionar el botón del Mouse y Mover" +msgstr "Extendido. Acciones (breakpoint, fold) al soltar el ratón. Selección hacer clic y mover" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" @@ -118,7 +118,7 @@ msgstr "Resaltado de paréntesis" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtree msgid "Code folding tree" -msgstr "Estructura de plegado de código" +msgstr "Plegado de código" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" @@ -156,7 +156,7 @@ msgstr "Edición Sincronizada" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" -msgstr "Edicion de Plantilla" +msgstr "Edición de Plantilla" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" @@ -243,7 +243,7 @@ msgstr "Punto de interrupción desconocido" #: lazarusidestrconsts.dlgaddhiattrwordgroup msgid "Word-Brackets" -msgstr "Paréntesis de palabras" +msgstr "Palabra Inicial-Final" #: lazarusidestrconsts.dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" @@ -284,7 +284,7 @@ msgstr "Configuraciones de la aplicación" #: lazarusidestrconsts.dlgassemblerdefault msgctxt "lazarusidestrconsts.dlgassemblerdefault" msgid "Default" -msgstr "Por defecto" +msgstr "Predeterminado" #: lazarusidestrconsts.dlgassertcode msgid "Include Assertion Code" @@ -716,7 +716,6 @@ msgid "Show Errors" msgstr "Mostrar errores" #: lazarusidestrconsts.dlgcoshowoptions -#, fuzzy #| msgid "Show Options" msgid "&Show Options" msgstr "Mostrar Opciones" @@ -783,11 +782,11 @@ msgstr "Tipo de depurador y ruta" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" -msgstr "Fuente por defecto del editor" +msgstr "Fuente predeterminada del editor" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" -msgstr "Valor por defecto" +msgstr "Valor predeterminado" #: lazarusidestrconsts.dlgdelphi2ext msgid "Delphi 2 Extensions" @@ -974,7 +973,7 @@ msgstr "Completado de identificador" #: lazarusidestrconsts.dlgedinvert msgid "Invert" -msgstr "" +msgstr "Invertir" #: lazarusidestrconsts.dlgedital msgid "Italic" @@ -995,19 +994,19 @@ msgstr "Opciones del editor" #: lazarusidestrconsts.dlgedmisc msgid "Misc" -msgstr "" +msgstr "Miscelánea" #: lazarusidestrconsts.dlgednoerr msgid "No errors in key mapping found." -msgstr "No se encontraron errores en accesos rápidos" +msgstr "No hay errores en los atajos de teclado" #: lazarusidestrconsts.dlgedoff msgid "Off" -msgstr "" +msgstr "No Usar" #: lazarusidestrconsts.dlgedon msgid "On" -msgstr "" +msgstr "Usar" #: lazarusidestrconsts.dlgedunder msgid "Underline" @@ -1015,15 +1014,15 @@ msgstr "Subrayado" #: lazarusidestrconsts.dlgedusedefcolor msgid "Use default color" -msgstr "Usar color por defecto" +msgstr "Usar color predeterminado" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" -msgstr "" +msgstr "Atributos del Elemento" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" -msgstr "" +msgstr "Saltar al end más cercano con la tecla END" #: lazarusidestrconsts.dlgentirescope msgid "&Entire Scope" @@ -1088,11 +1087,11 @@ msgstr "Tipo" #: lazarusidestrconsts.dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" -msgstr "" +msgstr "Enfocar ventana de mensajes después de compilar" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra char spacing" -msgstr "" +msgstr "Espaciado extra entre letras" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" @@ -1100,7 +1099,7 @@ msgstr "Espaciando línea extra" #: lazarusidestrconsts.dlgextsymb msgid "Use external gdb debug symbols file" -msgstr "" +msgstr "Usar archivo externo de símbolos de depuración para gdb" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" @@ -1113,43 +1112,43 @@ msgstr "Buscar texto desde cursor" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" msgid "Var/Type (local)" -msgstr "" +msgstr "Var/Type (local)" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" -msgstr "" +msgstr "Asm" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" -msgstr "" +msgstr "Begin/End (anidados)" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" -msgstr "" +msgstr "Case" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" -msgstr "" +msgstr "Class/Object" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" -msgstr "" +msgstr "public/private" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" -msgstr "" +msgstr "Except/Finally" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" -msgstr "" +msgstr "{$IfDef}" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" -msgstr "" +msgstr "Comentarios anidados" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" -msgstr "" +msgstr "Begin/End (procedure)" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" @@ -1163,15 +1162,15 @@ msgstr "Programa" #: lazarusidestrconsts.dlgfoldpasrecord msgid "Record" -msgstr "" +msgstr "Record" #: lazarusidestrconsts.dlgfoldpasrepeat msgid "Repeat" -msgstr "" +msgstr "Repeat" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" -msgstr "" +msgstr "Try" #: lazarusidestrconsts.dlgfoldpasunit msgctxt "lazarusidestrconsts.dlgfoldpasunit" @@ -1180,11 +1179,11 @@ msgstr "Unidad" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" -msgstr "" +msgstr "Sección Unit" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" -msgstr "" +msgstr "{%Region}" #: lazarusidestrconsts.dlgfoldpasuses msgctxt "lazarusidestrconsts.dlgfoldpasuses" @@ -1193,7 +1192,7 @@ msgstr "Uses" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" -msgstr "" +msgstr "Var/Type (global)" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" @@ -1217,7 +1216,7 @@ msgstr "Directorio de las fuentes de FPC" #: lazarusidestrconsts.dlgframecolor msgid "Frame color" -msgstr "" +msgstr "Color del Marco" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" @@ -1234,7 +1233,7 @@ msgstr "Opciones" #: lazarusidestrconsts.dlggeneratedwarf msgid "Generate dwarf debug information" -msgstr "" +msgstr "Generar información de depuración tipo dwarf" #: lazarusidestrconsts.dlggetposition msgid "Get position" @@ -1246,15 +1245,15 @@ msgstr "&Global" #: lazarusidestrconsts.dlgglyphshowalways msgid "Show Always" -msgstr "" +msgstr "Siempre mostrar" #: lazarusidestrconsts.dlgglyphshownever msgid "Show Never" -msgstr "" +msgstr "Nunca Mostrar" #: lazarusidestrconsts.dlgglyphshowsystem msgid "Use System Defaults" -msgstr "" +msgstr "Usar opciones predeterminadas del sistema" #: lazarusidestrconsts.dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" @@ -1291,19 +1290,19 @@ msgstr "Tamaño de paso vertical de la rejilla" #: lazarusidestrconsts.dlggroupcodeexplorer msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" msgid "Code Explorer" -msgstr "" +msgstr "Explorador de Código" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" -msgstr "" +msgstr "Codetools" #: lazarusidestrconsts.dlggroupdebugger msgid "Debugger" -msgstr "" +msgstr "Depurador" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" -msgstr "" +msgstr "Editor" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" @@ -1326,7 +1325,7 @@ msgstr "Mostrar líneas guía" #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" -msgstr "" +msgstr "Panel Fijo" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" @@ -1334,11 +1333,11 @@ msgstr "Color del canal" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" -msgstr "" +msgstr "Color del borde del Panel Fijo" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" -msgstr "" +msgstr "Indice del separador del panel fijo" #: lazarusidestrconsts.dlggutterwidth msgid "Gutter width" @@ -1362,23 +1361,23 @@ msgstr "Esconder ventanas del IDE al ejecutar" #: lazarusidestrconsts.dlghidemessagesicons msgid "Hide Messages Icons" -msgstr "" +msgstr "Ocultar iconos en ventana de mensajes" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" -msgstr "" +msgstr "Color de Realce" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" -msgstr "" +msgstr "Color Resaltado de fuente" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Cursor" -msgstr "" +msgstr "A la izquierda del cursor" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Cursor" -msgstr "" +msgstr "A la derecha del cursor" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" @@ -1407,7 +1406,7 @@ msgstr "Política de Identificador" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" -msgstr "" +msgstr "Opciones del IDE" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" @@ -1423,7 +1422,7 @@ msgstr "Sangrar código a" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Indent and Tabs:" -msgstr "" +msgstr "Sangrado y Tabulación" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" @@ -1451,11 +1450,11 @@ msgstr "Saltando (por ejemplo, Saltando métodos)" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep cursor X position" -msgstr "" +msgstr "Mantener posición X del cursor" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" -msgstr "Accesos rápidos" +msgstr "Atajos de teclado" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" @@ -1484,7 +1483,7 @@ msgstr "Último (es decir al final del código)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" -msgstr "Directorio de Lazarus (por defecto para todos los proyectos)" +msgstr "Directorio de Lazarus (predeterminado para todos los proyectos)" #: lazarusidestrconsts.dlgleftpos msgid "Left:" @@ -1500,7 +1499,7 @@ msgstr "Nivel 1 (rápido y amigable con el depurador)" #: lazarusidestrconsts.dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" -msgstr "" +msgstr "Nivel 2 (Nivel 1 + optimizaciones rápidas)" #: lazarusidestrconsts.dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" @@ -1540,7 +1539,7 @@ msgstr "Ver formularios del proyecto" #: lazarusidestrconsts.dlgmainviewframes msgid "View project frames" -msgstr "" +msgstr "Mostrar Frames del proyecto" #: lazarusidestrconsts.dlgmainviewunits msgid "View project units" @@ -1560,23 +1559,23 @@ msgstr "Color de marca" #: lazarusidestrconsts.dlgmarkupgroup msgid "Word under Caret Highlight" -msgstr "" +msgstr "Resaltado de la palabra bajo el Cursor de Texto" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Match word boundaries for words up to this length:" -msgstr "" +msgstr "Coincidir límites de palabra para palabras de hasta esta longitud:" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore Keywords" -msgstr "" +msgstr "Ignorar Plabras Clave" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable Timer for Markup Current Word" -msgstr "" +msgstr "Deshabilitar Temporizador para Señalización de Palabra Actual" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim Spaces (when highlighting current selection)" -msgstr "" +msgstr "Recortar Espacios (Cuando se realce la selección actual)" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" @@ -1609,38 +1608,38 @@ msgstr "Mezclar métodos y propiedades" #: lazarusidestrconsts.dlgmousefoldbutton msgctxt "lazarusidestrconsts.dlgmousefoldbutton" msgid "Button" -msgstr "" +msgstr "Botón" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft" msgid "Left" -msgstr "Izquierda" +msgstr "Izquierdo" #: lazarusidestrconsts.dlgmousefoldbuttonmiddle msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle" msgid "Middle" -msgstr "" +msgstr "Medio" #: lazarusidestrconsts.dlgmousefoldbuttonright msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright" msgid "Right" -msgstr "Derecha" +msgstr "Derecho" #: lazarusidestrconsts.dlgmousefoldcolfoldall msgid "Fold All (Some Colapsed)" -msgstr "" +msgstr "Plegar Todo (Algunos colapsados)" #: lazarusidestrconsts.dlgmousefoldcolfoldone msgid "Fold One (Some Colapsed)" -msgstr "" +msgstr "Plegar Uno (Algunos colapsados)" #: lazarusidestrconsts.dlgmousefoldcolunfoldall msgid "Unfold All (Some Colapsed)" -msgstr "" +msgstr "Desplegar Todo (Algunos Colapsados)" #: lazarusidestrconsts.dlgmousefoldcolunfoldone msgid "Unfold One (Some Colapsed)" -msgstr "" +msgstr "Desplegar Uno (Algunos colapsados)" #: lazarusidestrconsts.dlgmousefoldenabled msgctxt "lazarusidestrconsts.dlgmousefoldenabled" @@ -1649,19 +1648,19 @@ msgstr "Activo" #: lazarusidestrconsts.dlgmousefoldexpfoldall msgid "Fold All (All Expanded)" -msgstr "" +msgstr "Plegar Todo (Todos expandidos)" #: lazarusidestrconsts.dlgmousefoldexpfoldone msgid "Fold One (All Expanded)" -msgstr "" +msgstr "Plegar Uno (Todos expandidos)" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" -msgstr "" +msgstr "Ajuste 1" #: lazarusidestrconsts.dlgmousefoldgroup2 msgid "Setting 2" -msgstr "" +msgstr "Ajuste 2" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt" @@ -1680,23 +1679,23 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" -msgstr "" +msgstr "Ratón:" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" -msgstr "" +msgstr "Simple" #: lazarusidestrconsts.dlgmouseoptbtn2 msgid "Double" -msgstr "" +msgstr "Doble" #: lazarusidestrconsts.dlgmouseoptbtn3 msgid "Triple" -msgstr "" +msgstr "Triple" #: lazarusidestrconsts.dlgmouseoptbtn4 msgid "Quad" -msgstr "" +msgstr "Cuádruple" #: lazarusidestrconsts.dlgmouseoptbtnadd msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd" @@ -1705,7 +1704,7 @@ msgstr "Añadir" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" -msgstr "" +msgstr "Cualquiera" #: lazarusidestrconsts.dlgmouseoptbtncancel msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel" @@ -1725,33 +1724,33 @@ msgstr "Abajo" #: lazarusidestrconsts.dlgmouseoptbtnexport msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport" msgid "Export" -msgstr "" +msgstr "Exportar" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgid "Extra 1" -msgstr "" +msgstr "Extra 1" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgid "Extra 2" -msgstr "" +msgstr "Extra 2" #: lazarusidestrconsts.dlgmouseoptbtnimport msgid "Import" -msgstr "" +msgstr "Importar" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" -msgstr "Izquierda" +msgstr "Izquierdo" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" -msgstr "" +msgstr "Medio" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" -msgstr "" +msgstr "Convertir en Ultimo Recurso" #: lazarusidestrconsts.dlgmouseoptbtnok msgctxt "lazarusidestrconsts.dlgmouseoptbtnok" @@ -1761,7 +1760,7 @@ msgstr "Aceptar" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" -msgstr "Derecha" +msgstr "Derecho" #: lazarusidestrconsts.dlgmouseoptbtnudp msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp" @@ -1775,15 +1774,15 @@ msgstr "Arriba" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" -msgstr "" +msgstr "Capturar" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" -msgstr "" +msgstr "Mover Cursor de Texto (extra)" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" -msgstr "" +msgstr "Actuar al soltar el Botón del Ratón" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" @@ -1793,19 +1792,19 @@ msgstr "Acción" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" -msgstr "" +msgstr "Clic" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" -msgstr "" +msgstr "Editar Ratón" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" -msgstr "" +msgstr "Elemento Duplicada" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" -msgstr "" +msgstr "Este elemento entra en conflicto con un elemento existente" #: lazarusidestrconsts.dlgmouseoptheadalt msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" @@ -1815,20 +1814,20 @@ msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" -msgstr "" +msgstr "Botón" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" -msgstr "" +msgstr "Cursor de Texto" #: lazarusidestrconsts.dlgmouseoptheadcontext msgid "Context" -msgstr "" +msgstr "Contexto" #: lazarusidestrconsts.dlgmouseoptheadcount msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" msgid "Click" -msgstr "" +msgstr "Clic" #: lazarusidestrconsts.dlgmouseoptheadctrl msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" @@ -1842,11 +1841,11 @@ msgstr "Acción" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" -msgstr "" +msgstr "Arriba/Abajo" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" -msgstr "" +msgstr "Opción" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" @@ -1866,15 +1865,15 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" -msgstr "" +msgstr "Ratón" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" -msgstr "" +msgstr "Avanzado" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" -msgstr "" +msgstr "Comando-IDE" #: lazarusidestrconsts.dlgmouseoptmodalt msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" @@ -1888,16 +1887,16 @@ msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" -msgstr "" +msgstr "N" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" -msgstr "" +msgstr "-" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" -msgstr "" +msgstr "S" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" @@ -1907,28 +1906,28 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" -msgstr "" +msgstr "S" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" msgid "Gutter" -msgstr "" +msgstr "Panel Fijo" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" -msgstr "" +msgstr "Plegado de Código" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" -msgstr "" +msgstr "Colapsado [+]" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" -msgstr "" +msgstr "Expandido [-]" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" -msgstr "" +msgstr "Números de Línea" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" @@ -1942,15 +1941,15 @@ msgstr "Selección" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" -msgstr "" +msgstr "Otras acciones que usan el mismo botón" #: lazarusidestrconsts.dlgmouseoptotheracthint msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..." -msgstr "" +msgstr "Estos se pueden ejecutar dependiendo de las teclas modificadoras, Ajustes Predeterminados, Simple/Doble, Arriba/Abajo ..." #: lazarusidestrconsts.dlgmouseoptotheracttoggle msgid "Filter Mod-Keys" -msgstr "" +msgstr "Filtrar Teclas-Modificadoras" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" @@ -1960,7 +1959,7 @@ msgstr "Prioridad" #: lazarusidestrconsts.dlgmsgs msgctxt "lazarusidestrconsts.dlgmsgs" msgid "Messages" -msgstr "" +msgstr "Mensajes" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" @@ -1978,7 +1977,7 @@ msgstr "no renombrar automáticamente" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" -msgstr "" +msgstr "Sin Realce" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" @@ -1991,7 +1990,7 @@ msgstr "No separar línea delante de:" #: lazarusidestrconsts.dlgobjinsp msgctxt "lazarusidestrconsts.dlgobjinsp" msgid "Object Inspector" -msgstr "" +msgstr "Inspector de Objetos" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height" @@ -2013,11 +2012,11 @@ msgstr "Configuración Rápida" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" -msgstr "" +msgstr "Usar Ajustes pretederminados de Delphi" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" -msgstr "" +msgstr "Usar ajustes predeterminados de Lazarus" #: lazarusidestrconsts.dlgoptimiz msgid "Optimizations:" @@ -2029,11 +2028,11 @@ msgstr "Otros archivos de unidad (-Fu) (Separados por un punto y coma):" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite Block" -msgstr "" +msgstr "Sobreescribir Bloque" #: lazarusidestrconsts.dlgpackagegraph msgid "Package Graph" -msgstr "" +msgstr "Gráfico de paquetes" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" @@ -2041,7 +2040,7 @@ msgstr "Sugerencias para la paleta de componentes" #: lazarusidestrconsts.dlgpasext msgid "Default pascal extension" -msgstr "Extensión Pascal por defecto" +msgstr "Extensión Pascal predeterminada" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" @@ -2049,15 +2048,15 @@ msgstr "Pasar opciones al enlazador (espacio como delimitador)" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent Block" -msgstr "" +msgstr "Bloque Persistente" #: lazarusidestrconsts.dlgpersistentcursor msgid "Persistent cursor" -msgstr "" +msgstr "Cursor Persistente" #: lazarusidestrconsts.dlgpldpackagegroup msgid "Package group" -msgstr "" +msgstr "Grupo del Paquete" #: lazarusidestrconsts.dlgpoapplication msgid "Application" @@ -2065,7 +2064,7 @@ msgstr "Aplicación" #: lazarusidestrconsts.dlgpoclearicon msgid "Clear Icon" -msgstr "" +msgstr "Remover Icono" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" @@ -2081,20 +2080,20 @@ msgstr "Internacionalización" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" -msgstr "" +msgstr "Icono:" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" -msgstr "" +msgstr "(size: %d:%d, bpp: %d)" #: lazarusidestrconsts.dlgpoicondescnone msgctxt "lazarusidestrconsts.dlgpoicondescnone" msgid "(none)" -msgstr "" +msgstr "(ninguno)" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" -msgstr "" +msgstr "Cargar Icono" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" @@ -2107,7 +2106,7 @@ msgstr "Configuraciones de Salida" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" -msgstr "" +msgstr "Guardar Icono" #: lazarusidestrconsts.dlgposavesession msgid "Session" @@ -2159,7 +2158,7 @@ msgstr "Mostrar espaciado del borde" #: lazarusidestrconsts.dlgqshowcompiledialog msgid "Show compile dialog" -msgstr "" +msgstr "Mostrar diálogo de compilación" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" @@ -2250,7 +2249,7 @@ msgstr "Usar reemplazos" #: lazarusidestrconsts.dlgrunovalue msgctxt "lazarusidestrconsts.dlgrunovalue" msgid "Value" -msgstr "" +msgstr "Valor" #: lazarusidestrconsts.dlgrunovariable msgid "Variable" @@ -2266,7 +2265,7 @@ msgstr "Guardar configuraciones del escritorio a un archivo" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" -msgstr "" +msgstr "Línea guardada" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" @@ -2286,7 +2285,7 @@ msgstr "Desplazar una menos" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling:" -msgstr "" +msgstr "Desplazamiento:" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" @@ -2300,7 +2299,7 @@ msgstr "Desplazar después de fin de línea" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." -msgstr "" +msgstr "Directorui de busqueda \"%s\" no hallado." #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." @@ -2320,11 +2319,11 @@ msgstr "Texto &Seleccionado" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" -msgstr "Seleccionar todos los elementos por defecto" +msgstr "Asignar predeterminado en todos los elementos" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" -msgstr "Seleccionar elemento por defecto" +msgstr "Asignar predeterminado al elemento" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" @@ -2345,7 +2344,7 @@ msgstr "Mostrar opciones del compilador" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" -msgstr "" +msgstr "Mostrar números de línea" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" @@ -2422,7 +2421,7 @@ msgstr "Mostrar advertencias" #: lazarusidestrconsts.dlgskipforwarddeclarations msgid "Skip forward declarations" -msgstr "" +msgstr "Saltarse declararciones forward" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" @@ -2451,12 +2450,12 @@ msgstr "Espacio" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" -msgstr "Sugerencias para los accesos rápidos principales (abrir, guardar, ...)" +msgstr "Sugerencias para los botones principales (abrir, guardar, ...)" #: lazarusidestrconsts.dlgsrcedit msgctxt "lazarusidestrconsts.dlgsrcedit" msgid "Source Editor" -msgstr "" +msgstr "Editor de código" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" @@ -2472,7 +2471,7 @@ msgstr "Parar después de número de errores:" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" -msgstr "" +msgstr "SubPropiedades" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" @@ -2489,16 +2488,16 @@ msgstr "Tabuladores a espacios" #: lazarusidestrconsts.dlgtabwidths msgctxt "lazarusidestrconsts.dlgtabwidths" msgid "Tab widths" -msgstr "" +msgstr "Ancho del Tabulador" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" -msgstr "" +msgstr "Familia CPU deseada" #: lazarusidestrconsts.dlgtargetos msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" -msgstr "" +msgstr "SO deseado" #: lazarusidestrconsts.dlgtargetplatform msgid "Target Platform:" @@ -2506,7 +2505,7 @@ msgstr "Plataforma objetivo:" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" -msgstr "" +msgstr "Procesador deseado" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" @@ -2530,7 +2529,7 @@ msgstr "Evaluación de expresión de información de Herramienta" #: lazarusidestrconsts.dlgtooltiptools msgid "Tooltip symbol Tools" -msgstr "Herramientas de Símbolo de información de Herramienta" +msgstr "Pistas de información para símbolos" #: lazarusidestrconsts.dlgtoppos msgid "Top:" @@ -2542,23 +2541,23 @@ msgstr "Nombre de archivo de la plantilla" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim Spaces Style" -msgstr "" +msgstr "Estilo de Recorte de Espacios" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" -msgstr "" +msgstr "Cursor de Texto o Editar" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" -msgstr "" +msgstr "Linea Editada" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" -msgstr "" +msgstr "Abandonar línea" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" -msgstr "" +msgstr "Solamente posición" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" @@ -2574,7 +2573,7 @@ msgstr "Deshacer después de guardar" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo:" -msgstr "" +msgstr "Des Hacer/ Re Hacer" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" @@ -2583,7 +2582,7 @@ msgstr "Límite para deshacer" #: lazarusidestrconsts.dlgunitdepbrowse msgctxt "lazarusidestrconsts.dlgunitdepbrowse" msgid "Open" -msgstr "" +msgstr "Abrir" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" @@ -2599,7 +2598,7 @@ msgstr "Directorio de salidad de la unidad (-FU):" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" -msgstr "" +msgstr "Linea sin guardar" #: lazarusidestrconsts.dlgupword msgctxt "lazarusidestrconsts.dlgupword" @@ -2612,11 +2611,11 @@ msgstr "Ocultar código selectivamente" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional Compiler Config File" -msgstr "" +msgstr "Usar archivo de configuración de compilador adicional" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider drawing" -msgstr "" +msgstr "Dibujado de Divisor" #: lazarusidestrconsts.dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" @@ -2628,7 +2627,7 @@ msgstr "Usar al lanzar aplicación" #: lazarusidestrconsts.dlgusemsgfile msgid "Use messages file" -msgstr "" +msgstr "Usar archivo de mensajes" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" @@ -2776,11 +2775,11 @@ msgstr "Orden de tabulación..." #: lazarusidestrconsts.fdmzorder msgid "Z-order" -msgstr "" +msgstr "Orden-Z" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" -msgstr "" +msgstr "En ambos Lados" #: lazarusidestrconsts.lisa2paddfile msgid "Add File" @@ -2825,7 +2824,7 @@ msgstr "Tipo del ancestro" #: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" -msgstr "" +msgstr "Una unidad pascal debe tener la extensión .pp o .pas" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" @@ -2833,7 +2832,7 @@ msgstr "Dependencias rotas" #: lazarusidestrconsts.lisa2pchooseanexistingfile msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" @@ -2985,22 +2984,22 @@ msgstr "El archivo %s%s%s es parte del proyecto actual.%sEs una mala idea compar #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." -msgstr "El nombre de archivo %s%s%s es ambiguo porque el paquete no tiene todavía un directorio por defecto.%sPor favor, especifique un nombre de archivo con una ruta completa." +msgstr "El nombre de archivo %s%s%s es ambiguo porque el paquete no tiene todavía un directorio predeterminado.%sPor favor, especifique un nombre de archivo con una ruta completa." #: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "" +msgstr "El número máximo de versión %s%s%s no es válido.%sPor Por favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." -msgstr "" +msgstr "El número máximo de versión es menor que la versión mínima." #: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "" +msgstr "El número de versión mínimo %s%s%s no es válido.%sPor favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." @@ -3060,7 +3059,7 @@ msgstr "Escanear Unidad para Nombre de Unidad y proccedimiento de registro" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" -msgstr "" +msgstr "¿Abandonar cambios?" #: lazarusidestrconsts.lisabcreationfailed msgid "Error occured during Application Bundle creation: " @@ -3084,7 +3083,7 @@ msgstr "Abortar toda la carga" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" -msgstr "" +msgstr "Documentación:" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" @@ -3100,7 +3099,7 @@ msgstr "No puedo encontrar la lista de Colaboradores" #: lazarusidestrconsts.lisaboutofficial msgid "Official:" -msgstr "" +msgstr "Oficial:" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." @@ -3112,11 +3111,11 @@ msgstr "Reconocimientos" #: lazarusidestrconsts.lisaction msgid "Action:" -msgstr "" +msgstr "Acción:" #: lazarusidestrconsts.lisactions msgid "Actions:" -msgstr "" +msgstr "Acciones:" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" @@ -3124,15 +3123,15 @@ msgstr "Activa sintaxis de expresión regular para texto y reemplazo (parecido a #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" -msgstr "" +msgstr "Filtro activo:" #: lazarusidestrconsts.lisadddirectory msgid "Add directory" -msgstr "" +msgstr "Añadir directorio" #: lazarusidestrconsts.lisaddfilesofdirectory msgid "Add files of directory" -msgstr "" +msgstr "Añadir archivos del directorio" #: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" @@ -3140,11 +3139,11 @@ msgstr "Opciones adicionales del compilador heredadas de los paquetes" #: lazarusidestrconsts.lisadditionalinformation msgid "Additional Information" -msgstr "" +msgstr "Información adicional" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" -msgstr "" +msgstr "Añadir conjunto nuevo" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" @@ -3156,7 +3155,7 @@ msgstr "¿Añadir a la ruta de búsqueda de unidad?" #: lazarusidestrconsts.lisaddvalue msgid "Add value:" -msgstr "" +msgstr "Añadir valor:" #: lazarusidestrconsts.lisaf2paddfiletoapackage msgid "Add file to a package" @@ -3201,7 +3200,7 @@ msgstr "Mostrar Todo" #: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage" msgid "The file %s%s%s%sis already in the package %s." -msgstr "" +msgstr "El archivo %s%s%s%sya esta en el paquete %s." #: lazarusidestrconsts.lisaf2pthepackageisreadonly msgid "The package %s is read only." @@ -3229,11 +3228,11 @@ msgstr "Todos los Archivos" #: lazarusidestrconsts.lisallinheritedoptions msgid "All inherited options" -msgstr "" +msgstr "Todas la opciones heredadas" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" -msgstr "" +msgstr "Permitir Llamadas de Función" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" @@ -3241,19 +3240,19 @@ msgstr "Permitir búsqueda para múltiples líneas" #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened msgid "All your modifications to %s%s%s%swill be lost and the file reopened." -msgstr "" +msgstr "Todas sus modificaciones a %s%s%s%sse perderan y el archivo será re abierto." #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" -msgstr "" +msgstr "Tecla alternativa" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" -msgstr "" +msgstr "Tecla alternativa (o secuencía de 2 teclas)" #: lazarusidestrconsts.lisalways msgid "Always" -msgstr "" +msgstr "Siempre" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" @@ -3281,7 +3280,7 @@ msgstr "Editor de anclaje - ningún control seleccionado" #: lazarusidestrconsts.lisanchorenabledhint msgid "Enabled = Include %s in Anchors" -msgstr "" +msgstr "Habilitado = Incluir %s en Anclaje" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" @@ -3309,7 +3308,7 @@ msgstr "¡Ocurrió un error en el último inicio mientras se cargaba %s!%s%s¿Ca #: lazarusidestrconsts.lisappendshortdescriptiontolongdescription msgid "Append short description to long description" -msgstr "" +msgstr "Adicionar la descripción pequeña a la descripción larga" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." @@ -3317,11 +3316,11 @@ msgstr "Aplicación%sUn programa gráfico lcl/freepascal. El archivo de programa #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" -msgstr "" +msgstr "Nombre de clase de la &aplicación" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "apply build flags (-B) to dependencies too" -msgstr "" +msgstr "Aplicar también las opciones de Construcción (-B) a las dependencias" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." @@ -3337,23 +3336,23 @@ msgstr "Preguntar antes de reemplazar cada coincidencia" #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" -msgstr "" +msgstr "Completar Automáticamente: activado" #: lazarusidestrconsts.lisautocompletionon msgid "Auto completion: on" -msgstr "" +msgstr "Completar Automáticamente: desactivado" #: lazarusidestrconsts.lisautocontinue msgid "Auto Continue" -msgstr "" +msgstr "Continuación Automática" #: lazarusidestrconsts.lisautocontinueafter msgid "Auto continue after:" -msgstr "" +msgstr "Continuación Automática despues de:" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" -msgstr "" +msgstr "Invocar automáticamente despues del punto" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" @@ -3369,7 +3368,7 @@ msgstr "fin de palabra" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" -msgstr "" +msgstr "No agregar carácter" #: lazarusidestrconsts.lisautomaticfeatures msgid "Automatic features" @@ -3377,7 +3376,7 @@ msgstr "Características automáticas" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" -msgstr "" +msgstr "Mostrar Automáticamente" #: lazarusidestrconsts.lisavailablepackages msgid "Available packages" @@ -3397,7 +3396,7 @@ msgstr "empieza" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" -msgstr "" +msgstr "Detras de los relacionados" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always Build before Run" @@ -3433,7 +3432,7 @@ msgstr "Directorio de trabajo (Deje en blanco para usar la ruta de archivo)" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" -msgstr "" +msgstr "Poner en negritas valores no predeterminados" #: lazarusidestrconsts.lisborderspace msgid "BorderSpace" @@ -3441,7 +3440,7 @@ msgstr "Espacio de borde" #: lazarusidestrconsts.lisbottom msgid "Bottom" -msgstr "" +msgstr "Abajo" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." @@ -3466,11 +3465,11 @@ msgstr "Igualar espaciado inferior" #: lazarusidestrconsts.lisbreak msgctxt "lazarusidestrconsts.lisbreak" msgid "Break" -msgstr "" +msgstr "Interrumpir" #: lazarusidestrconsts.lisbreakpointproperties msgid "Breakpoint Properties" -msgstr "" +msgstr "Propiedadas del punto de interrupción" #: lazarusidestrconsts.lisbrowseforcompiler msgid "Browse for Compiler (%s)" @@ -3479,7 +3478,7 @@ msgstr "Explorar por el compilador (%s)" #: lazarusidestrconsts.lisbtnbreak msgctxt "lazarusidestrconsts.lisbtnbreak" msgid "Break" -msgstr "" +msgstr "Interrumpir" #: lazarusidestrconsts.lisbtncontinue msgctxt "lazarusidestrconsts.lisbtncontinue" @@ -3488,19 +3487,19 @@ msgstr "Continuar" #: lazarusidestrconsts.lisbtnfind msgid "&Find" -msgstr "" +msgstr "&Buscar" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" -msgstr "" +msgstr "&Reemplazar" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "build all files of project/package/IDE" -msgstr "" +msgstr "Construir todos los archivos del proyecto/Paquete/IDE" #: lazarusidestrconsts.lisbuildidewithpackages msgid "build IDE with packages" -msgstr "" +msgstr "Construir IDE con paquetes" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" @@ -3649,7 +3648,7 @@ msgstr "ruta relativa de unidad encontrada en fpc cfg: %s" #: lazarusidestrconsts.lisccoseveralcompilers msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" -msgstr "" +msgstr "Hay varios compiladores Free Pascal en su PATH.%s%s%sQuizas ¿Ha olvidado borrar un compilador anterior?" #: lazarusidestrconsts.lisccoskip msgid "Skip" @@ -3701,7 +3700,7 @@ msgstr "Categorías" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" -msgstr "" +msgstr "Complejidad" #: lazarusidestrconsts.lisceconstants msgid "Constants" @@ -3709,19 +3708,19 @@ msgstr "Constantes" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" -msgstr "" +msgstr "Bloques Vacios" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" -msgstr "" +msgstr "Secciones vacias en clases" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" -msgstr "" +msgstr "Elementos Vacios" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" -msgstr "" +msgstr "Procedimientos Vacios" #: lazarusidestrconsts.liscefilter msgid "(Filter)" @@ -3733,31 +3732,31 @@ msgstr "Seguir al cursor" #: lazarusidestrconsts.liscein msgid "%s in %s" -msgstr "" +msgstr "%s en %s" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" -msgstr "" +msgstr "Es un control principal" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treating as \"many\"" -msgstr "" +msgstr "Total de parámetros para ser contados como \"Muchos\"" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" -msgstr "" +msgstr "Procedimientos grandes" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" -msgstr "" +msgstr "Total de líneas para ser contadas como \"grande\"" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" -msgstr "" +msgstr "Muchos procedimientos anidados" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" -msgstr "" +msgstr "Muchos parametros" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" @@ -3769,7 +3768,7 @@ msgstr "Mostrar nodos fuente" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treating as \"many\"" -msgstr "" +msgstr "Total de procedimientos anidados contados como \"Muchos\"" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" @@ -3794,7 +3793,7 @@ msgstr "Modo preferido de exhibición" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" -msgstr "" +msgstr "Categoría" #: lazarusidestrconsts.lisceomodesource msgid "Source" @@ -3840,20 +3839,20 @@ msgstr "Propiedades" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" -msgstr "" +msgstr "Propiedades Published sin calificador default" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observerations about" -msgstr "" +msgstr "Mostrar observaciones a cerca de" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" -msgstr "" +msgstr "Estilo" #: lazarusidestrconsts.liscetodos msgid "ToDos" -msgstr "" +msgstr "Lista por hacer" #: lazarusidestrconsts.liscetypes msgid "Types" @@ -3861,15 +3860,15 @@ msgstr "Tipos" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" -msgstr "" +msgstr "constantes sin nombre" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" -msgstr "" +msgstr "Miembros no ordenados" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" -msgstr "" +msgstr "Visibilidad desordenada" #: lazarusidestrconsts.lisceuses msgctxt "lazarusidestrconsts.lisceuses" @@ -3882,7 +3881,7 @@ msgstr "Variables" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" -msgstr "" +msgstr "Sangrado erróneo" #: lazarusidestrconsts.lischangeclass msgid "Change Class" @@ -3890,11 +3889,11 @@ msgstr "Cambiar Clase" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" -msgstr "" +msgstr "Cambiar codificación" #: lazarusidestrconsts.lischangefile msgid "Change file" -msgstr "" +msgstr "Modificar archivo" #: lazarusidestrconsts.lischangeparent #, fuzzy @@ -3904,7 +3903,7 @@ msgstr "Cambiar padre ..." #: lazarusidestrconsts.lischaracter msgid "Character" -msgstr "" +msgstr "Carácter" #: lazarusidestrconsts.lischaractermap msgid "Character Map" @@ -3916,11 +3915,11 @@ msgstr "Comprobar cambios en el disco cuando se carga" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "check if the next token in source is an end and if not returns lineend + end; + lineend" -msgstr "" +msgstr "Verificar si el siguiente elemento en el fuente esta al final y si no regresa findelínea + end; + findelínea" #: lazarusidestrconsts.lischeckoptions msgid "Check options" -msgstr "" +msgstr "Usar función CheckOptions" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" @@ -3928,11 +3927,11 @@ msgstr "Escoja un nombre distinto" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" -msgstr "" +msgstr "Seleccione un enlace FPCDoc" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." -msgstr "" +msgstr "Seleccione una tecla ..." #: lazarusidestrconsts.lischoosecompilerpath msgid "Choose compiler filename (%s)" @@ -3944,11 +3943,11 @@ msgstr "Escoja nombre del archivo del depurador" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" -msgstr "" +msgstr "Seleccione un paquete Delphi (*.dpk)" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" -msgstr "" +msgstr "Seleccione un proyecto Delphi (*.dpr)" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" @@ -3984,7 +3983,7 @@ msgstr "Elija uno de estos elementos para crear un nuevo Proyecto" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" -msgstr "" +msgstr "Seleccione uno de esos elementos para heredar de el" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" @@ -3996,19 +3995,19 @@ msgstr "Elija estructura para encerrar la selección" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" -msgstr "" +msgstr "Seleccione el directorio para pruebas" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" -msgstr "" +msgstr "Terminado de Clases" #: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." -msgstr "" +msgstr "La clase entra en conflicto con el archivo .lfm:%sLa unidad %s%susa la unidad %s%sla cual contiene la clase %s,%spero el archivo .lfm ya contiene otra clase.%sSolo puede haber una clase de diseño por unidad.%sPor favor mueva %s a otra unidad." #: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked msgid "Classes and properties exist. Values were not checked." -msgstr "" +msgstr "Las clases y propiedades ya existen. Los valores no fueron verificados." #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." @@ -4020,7 +4019,7 @@ msgstr "Clase no encontrada" #: lazarusidestrconsts.lisclassofmethodnotfound msgid "Class %s%s%s of method %s%s%s not found." -msgstr "" +msgstr "La clase %s%s%s del método %s%s%s no fue encontrada." #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" @@ -4056,7 +4055,7 @@ msgstr "¿Limpiar ruta de la unidad?" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" -msgstr "" +msgstr "¿Limpiar Directorio?" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" @@ -4077,7 +4076,7 @@ msgstr "Parámetros" #: lazarusidestrconsts.liscmplstcomponents msgctxt "lazarusidestrconsts.liscmplstcomponents" msgid "Components" -msgstr "" +msgstr "Componentes" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" @@ -4102,7 +4101,7 @@ msgstr "Llamar en:" #: lazarusidestrconsts.liscocallonbuild msgctxt "lazarusidestrconsts.liscocallonbuild" msgid "Build" -msgstr "" +msgstr "Construir" #: lazarusidestrconsts.liscocalloncompile msgctxt "lazarusidestrconsts.liscocalloncompile" @@ -4112,7 +4111,7 @@ msgstr "Compilar" #: lazarusidestrconsts.liscocallonrun msgctxt "lazarusidestrconsts.liscocallonrun" msgid "Run" -msgstr "" +msgstr "Ejecutar" #: lazarusidestrconsts.liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." @@ -4130,15 +4129,15 @@ msgstr "Navegador de código" #: lazarusidestrconsts.liscodeexplorer msgctxt "lazarusidestrconsts.liscodeexplorer" msgid "Code Explorer" -msgstr "" +msgstr "Explorador de código" #: lazarusidestrconsts.liscodefault msgid "default (%s)" -msgstr "por defecto (%s)" +msgstr "predeterminado (%s)" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" -msgstr "" +msgstr "Opciones de generación de código" #: lazarusidestrconsts.liscodehelpaddlinkbutton msgid "Add link" @@ -4151,7 +4150,7 @@ msgstr "Añadir ruta" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" -msgstr "" +msgstr "Explorar" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" @@ -4172,12 +4171,12 @@ msgstr "Quitar ruta" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" -msgstr "" +msgstr "Descripción" #: lazarusidestrconsts.liscodehelperrorstag msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" -msgstr "" +msgstr "Errores" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" @@ -4185,7 +4184,7 @@ msgstr "Ejemplo" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" -msgstr "" +msgstr "Insertar etiqueta de formateo en negritas" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" @@ -4227,11 +4226,11 @@ msgstr "Editor FPDoc" #: lazarusidestrconsts.liscodehelpnodocumentation msgctxt "lazarusidestrconsts.liscodehelpnodocumentation" msgid "(none)" -msgstr "" +msgstr "(ninguno)" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" -msgstr "" +msgstr "(no se encontró descripción heredada)" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" @@ -4240,17 +4239,17 @@ msgstr "" #: lazarusidestrconsts.liscodehelppathsgroupbox msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox" msgid "FPDoc files path" -msgstr "" +msgstr "Ruta de archivos FPDoc" #: lazarusidestrconsts.liscodehelpreplacebutton msgctxt "lazarusidestrconsts.liscodehelpreplacebutton" msgid "Replace" -msgstr "" +msgstr "Reemplazar" #: lazarusidestrconsts.liscodehelpsavebutton msgctxt "lazarusidestrconsts.liscodehelpsavebutton" msgid "Save" -msgstr "" +msgstr "Guardar" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" @@ -4266,30 +4265,30 @@ msgstr "Corta" #: lazarusidestrconsts.liscodehelpshowemptymethods msgid "Show empty methods" -msgstr "" +msgstr "Mostrar métodos vacios" #: lazarusidestrconsts.liscodehelpshowunusedunits msgid "Show unused units" -msgstr "" +msgstr "Mostrar Unidades no usadas" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" -msgstr "" +msgstr "Ignorar constantes en las siguientes funciones" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" -msgstr "" +msgstr "Buscar constantes char sin nombre" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" -msgstr "" +msgstr "Observador de código" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" -msgstr "" +msgstr "Ignorar las siguientes constantes sin nombre" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" @@ -4628,7 +4627,7 @@ msgstr "El nodo previo no puede contener nodos hijo." #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" -msgstr "" +msgstr "Directorio del proyecto" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 msgid "%s project directory" @@ -4636,7 +4635,7 @@ msgstr "%s directorio de proyecto" #: lazarusidestrconsts.liscodetoolsdefsprojectspecific msgid "%s, project specific" -msgstr "" +msgstr "%s, específico del proyecto" #: lazarusidestrconsts.liscodetoolsdefsreaderror msgid "Read error" @@ -4652,7 +4651,7 @@ msgstr "Seleccionar Nodo:" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." -msgstr "" +msgstr "El directorio de fuentes SVN de Free PAscal. No requerido. Esto mejorará la depuración y la posibilidad de encontrar declaraciónes." #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." @@ -4692,7 +4691,7 @@ msgstr "Indefinir Recurso" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" -msgstr "" +msgstr "Valor como Rutas de Archivo" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" @@ -4712,7 +4711,7 @@ msgstr "En" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" -msgstr "" +msgstr "Paréntesis" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" @@ -4808,11 +4807,11 @@ msgstr "Parámetros de la línea de comandos del programa" #: lazarusidestrconsts.liscomments msgid "Comments:" -msgstr "" +msgstr "Comentarios:" #: lazarusidestrconsts.liscompany msgid "Company:" -msgstr "" +msgstr "Compañia:" #: lazarusidestrconsts.liscompileidewithoutlinking msgid "Compile IDE (without linking)" @@ -4840,7 +4839,7 @@ msgstr "Sugerencia: puede establecer la ruta del compilador en Entorno->Opciones #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" -msgstr "NOTA: No se ha encontrado el archivo de configuración de las CodeTools - usando valores por defecto" +msgstr "NOTA: No se ha encontrado el archivo de configuración de las CodeTools - usando valores predeterminados" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " @@ -4887,7 +4886,7 @@ msgstr "Probar" #: lazarusidestrconsts.liscondition msgid "Condition" -msgstr "" +msgstr "Condición" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" @@ -4899,7 +4898,7 @@ msgstr "Configurar Construcción %s" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" -msgstr "" +msgstr "Configurar %sConstruir Lazarus%s" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" @@ -4907,7 +4906,7 @@ msgstr "Confirmar cambios" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" -msgstr "" +msgstr "Confirmar eliminación" #: lazarusidestrconsts.lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" @@ -4923,7 +4922,7 @@ msgstr "Aplicación de consola" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" -msgstr "" +msgstr "Código de Constructor" #: lazarusidestrconsts.liscontains msgid "contains" @@ -4952,23 +4951,23 @@ msgstr "Error de conversión" #: lazarusidestrconsts.lisconvert msgid "Convert" -msgstr "" +msgstr "Convertir" #: lazarusidestrconsts.lisconvertencoding msgid "Convert encoding" -msgstr "" +msgstr "Convertir codificación de página" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" -msgstr "" +msgstr "Convertir codificación de página de proyectos/paquetes" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" -msgstr "" +msgstr "Convertir proyecto o paquete" #: lazarusidestrconsts.liscopyall msgid "Copy All" -msgstr "" +msgstr "Copiar Todo" #: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" @@ -4980,11 +4979,11 @@ msgstr "Copiar todos los mensajes al portapapeles" #: lazarusidestrconsts.liscopyalloutputclipboard msgid "Copy all output to clipboard" -msgstr "" +msgstr "Copiar toda la salida al portapapeles" #: lazarusidestrconsts.liscopydescription msgid "Copy description to clipboard" -msgstr "" +msgstr "Copiar descripción al portapapeles" #: lazarusidestrconsts.liscopyerror msgid "Copy Error" @@ -4996,7 +4995,7 @@ msgstr "Copiar error" #: lazarusidestrconsts.liscopyidentifier msgid "Copy %s%s%s to clipboard" -msgstr "" +msgstr "Copiar %s%s%s al portapapeles" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." @@ -5028,27 +5027,27 @@ msgstr "Opciones específicas del SO objetivo" #: lazarusidestrconsts.liscouldnotadditomainsource msgid "Could not add %s{$I %s%s} to main source!" -msgstr "" +msgstr "¡No se pudo añadir %s{$I %s%s} al código principal!" #: lazarusidestrconsts.liscouldnotaddrtomainsource msgid "Could not add %s{$R %s%s} to main source!" -msgstr "" +msgstr "¡No se pudo añadir %s{$R %s%s} al código principal!" #: lazarusidestrconsts.liscouldnotaddtomainsource msgid "Could not add %s%s%s to main source!" -msgstr "" +msgstr "¡No se pudo añadir %s%s%s al código principal!" #: lazarusidestrconsts.liscouldnotremovefrommainsource msgid "Could not remove %s%s%s from main source!" -msgstr "" +msgstr "¡No se pudo eliminar %s%s%s del código principal!" #: lazarusidestrconsts.liscouldnotremoveifrommainsource msgid "Could not remove %s{$I %s%s} from main source!" -msgstr "" +msgstr "¡No se pudo eliminar %s{$I %s%s} del código principal!" #: lazarusidestrconsts.liscouldnotremoverfrommainsource msgid "Could not remove %s{$R %s%s} from main source!" -msgstr "" +msgstr "¡No se pudo eliminar %s{$R %s%s} del código principal!" #: lazarusidestrconsts.liscovarious msgid "%s (various)" @@ -5072,19 +5071,19 @@ msgstr "¡Cree un proyecto primero!" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" -msgstr "" +msgstr "¿Crear directorio?" #: lazarusidestrconsts.liscreatefunction msgid "Create function" -msgstr "" +msgstr "Crear función" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" -msgstr "" +msgstr "Crear nodo de Ayuda" #: lazarusidestrconsts.liscreateit msgid "Create it" -msgstr "" +msgstr "Crearlo" #: lazarusidestrconsts.liscreatenewproject msgid "Create new project" @@ -5140,7 +5139,7 @@ msgstr "Seleccionar código de macro" #: lazarusidestrconsts.liscurrent msgid "Current" -msgstr "" +msgstr "Actual" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" @@ -5168,7 +5167,7 @@ msgstr "Programa personalizado%sUn programa freepascal." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" -msgstr "" +msgstr "Módulo de Datos" #: lazarusidestrconsts.lisdate msgid "Date" @@ -5204,7 +5203,7 @@ msgstr "%s (depurando ...)" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" -msgstr "" +msgstr "Agregar Excepción" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" @@ -5228,11 +5227,11 @@ msgstr "Opciones específicas del depurador (depende del tipo de depurador)" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" -msgstr "" +msgstr "Nombre de Excepción duplicado" #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" -msgstr "" +msgstr "Introducr el nombre de la Excepción" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgid "Event Log" @@ -5273,7 +5272,7 @@ msgstr "Limitar contador de líneas a" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" -msgstr "" +msgstr "Módulo" #: lazarusidestrconsts.lisdebugoptionsfrmname msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" @@ -5282,7 +5281,7 @@ msgstr "Nombre" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Lazarus Exceptions" -msgstr "" +msgstr "Notificar en excepciones de Lazarus" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" @@ -5335,31 +5334,31 @@ msgstr "No se ha podido cargar el archivo %s%s%s." #: lazarusidestrconsts.lisdecimal msgid "Decimal" -msgstr "" +msgstr "Decimal" #: lazarusidestrconsts.lisdefaultvalue msgid "Default value" -msgstr "" +msgstr "Valor predeterminado" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" -msgstr "" +msgstr "&Eliminar todo" #: lazarusidestrconsts.lisdeleteallbreakpoints msgid "Delete all breakpoints?" -msgstr "" +msgstr "¿Eliminar todos los puntos de interrupción?" #: lazarusidestrconsts.lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" -msgstr "" +msgstr "¿Eliminar todos los puntos de interrupción en el archivo %s%s%s?" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" -msgstr "" +msgstr "Eliminar Todo en el mismo fuente" #: lazarusidestrconsts.lisdeleteallselectedbreakpoints msgid "Delete all selected breakpoints?" -msgstr "" +msgstr "¿Eliminar todos los puntos de interrupción seleccionados?" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" @@ -5371,15 +5370,15 @@ msgstr "¿Borrar archivo ambiguo?" #: lazarusidestrconsts.lisdeletebreakpoint msgid "Delete Breakpoint" -msgstr "" +msgstr "Eliminar Punto de Interrupción" #: lazarusidestrconsts.lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" -msgstr "" +msgstr "¿Eliminar punto de interrupción en%s\"%s\" línea %d?" #: lazarusidestrconsts.lisdeletebuildmode msgid "Delete build mode %s%s%s?" -msgstr "" +msgstr "¿Eliminar mode de construcción %s%s%s?" #: lazarusidestrconsts.lisdeletefilefailed msgid "Delete file failed" @@ -5391,15 +5390,15 @@ msgstr "¿Borrar archivo viejo: %s%s%s?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" -msgstr "" +msgstr "¿Eliminar archivo anterior?" #: lazarusidestrconsts.lisdeleteselectedfiles msgid "Delete selected files" -msgstr "" +msgstr "Eliminar los archivos seleccionados" #: lazarusidestrconsts.lisdeletevalue msgid "Delete value %s%s%s" -msgstr "" +msgstr "Eliminar valor %s%s%s" #: lazarusidestrconsts.lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." @@ -5407,7 +5406,7 @@ msgstr "Falló el borrado del archivo %s%s%s" #: lazarusidestrconsts.lisdelphi msgid "Delphi" -msgstr "" +msgstr "Delphi" #: lazarusidestrconsts.lisdelphiproject msgid "Delphi project" @@ -5427,7 +5426,7 @@ msgstr "El directorio destino %s%s%s es inválido.%sPor favor escoja una ruta co #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" -msgstr "" +msgstr "Código del Destructor" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" @@ -5475,7 +5474,7 @@ msgstr "Texto2" #: lazarusidestrconsts.lisdigits msgid "Digits:" -msgstr "" +msgstr "Dígitos:" #: lazarusidestrconsts.lisdirectives msgid "Directives" @@ -5483,19 +5482,19 @@ msgstr "Directivas" #: lazarusidestrconsts.lisdisableallinsamesource msgid "Disable All in same source" -msgstr "" +msgstr "Deshabilitar todo en el mismo fuente" #: lazarusidestrconsts.lisdisablebreakpoint msgid "Disable Breakpoint" -msgstr "" +msgstr "Deshabilitar Punto de Interrupción" #: lazarusidestrconsts.lisdisabled msgid "Disabled" -msgstr "" +msgstr "Deshabilitado" #: lazarusidestrconsts.lisdisablegroup msgid "Disable Group" -msgstr "" +msgstr "Deshabilitar Grupo" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" @@ -5535,7 +5534,7 @@ msgstr "Editor de Documentación" #: lazarusidestrconsts.lisdoesnotexists msgid "%s does not exists: %s" -msgstr "" +msgstr "%s no existe: %s" #: lazarusidestrconsts.lisdonotclosetheide msgid "Do not close the IDE" @@ -5547,7 +5546,7 @@ msgstr "No cerrar el proyecto" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "do not compile dependencies" -msgstr "" +msgstr "no compilar dependencias" #: lazarusidestrconsts.lisdonotshowsplashscreen msgid "Do not show splash screen" @@ -5555,7 +5554,7 @@ msgstr "No mostrar la pantalla de inicio" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" -msgstr "" +msgstr "Dibujar lineas de cuadrícula" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" @@ -5591,7 +5590,7 @@ msgstr "Seleccionar componente padre" #: lazarusidestrconsts.lisduplicatefoundofvalue msgid "Duplicate found of value %s%s%s." -msgstr "" +msgstr "Se encontró duplicado del valor %s%s%s." #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" @@ -5599,7 +5598,7 @@ msgstr "Nombre duplicado: Un componente llamado %s%s%s ya existe en el component #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" -msgstr "" +msgstr "Editar ayuda contextual" #: lazarusidestrconsts.lisedoptschoosescheme msgid "Choose Scheme" @@ -5643,7 +5642,7 @@ msgstr "establecer modo FPC a DELPHI" #: lazarusidestrconsts.lisedtdefsetfpcmodetofpc msgid "set FPC mode to FPC" -msgstr "" +msgstr "Cambiar modo FPC a FPC" #: lazarusidestrconsts.lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" @@ -5651,7 +5650,7 @@ msgstr "establecer modo FPC a GPC" #: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas msgid "set FPC mode to MacPas" -msgstr "" +msgstr "Cambiar modo FPC a MacPas" #: lazarusidestrconsts.lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" @@ -5738,47 +5737,47 @@ msgstr "Directorio de Trabajo:" #: lazarusidestrconsts.lisemdall msgid "All" -msgstr "" +msgstr "Todo" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" -msgstr "" +msgstr "Métodos Vacios" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" -msgstr "" +msgstr "Métodos vacios encontrados:" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" -msgstr "" +msgstr "Solo published" #: lazarusidestrconsts.lisemdpublic msgid "Public" -msgstr "" +msgstr "Public" #: lazarusidestrconsts.lisemdpublished msgid "Published" -msgstr "" +msgstr "Published" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" -msgstr "" +msgstr "Eliminar metodos" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" -msgstr "" +msgstr "Buscar en esas secciones de clase:" #: lazarusidestrconsts.lisenableall msgid "&Enable All" -msgstr "" +msgstr "&Habilitar Todo" #: lazarusidestrconsts.lisenableallinsamesource msgid "Enable All in same source" -msgstr "" +msgstr "Habilitar todo en el mismo fuente" #: lazarusidestrconsts.lisenablebreakpoint msgid "Enable Breakpoint" -msgstr "" +msgstr "Habilitar Punto de Interrupción" #: lazarusidestrconsts.lisenabled msgctxt "lazarusidestrconsts.lisenabled" @@ -5787,7 +5786,7 @@ msgstr "Activo" #: lazarusidestrconsts.lisenablegroup msgid "Enable Group" -msgstr "" +msgstr "Habilitar Grupo" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" @@ -5800,17 +5799,17 @@ msgstr "Encerrar" #: lazarusidestrconsts.lisencloseselection msgctxt "lazarusidestrconsts.lisencloseselection" msgid "Enclose Selection" -msgstr "" +msgstr "Delimitar Selección" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." -msgstr "" +msgstr "La codificación de página del archivo %s%s%s%sen disco es %s. La nueva codificación es %s." #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2 msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." -msgstr "" +msgstr "La codificación de página del archivo %s%s%s%sen disco es %s. La nueva codificación es %s." #: lazarusidestrconsts.lisentertransla msgid "Enter translation language" @@ -5822,7 +5821,7 @@ msgstr "Doble clic en mensajes salta (de otro modo: clic simple)" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" -msgstr "" +msgstr "Variable de Entorno, nombre como parámetro" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" @@ -5935,7 +5934,7 @@ msgstr "Error al mover componente %s:%s" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" -msgstr "" +msgstr "Error al abrir componente" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." @@ -5947,11 +5946,11 @@ msgstr "Error al leer lista de paquetes del archivo%s%s%s%s" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" -msgstr "" +msgstr "Error al leer XML" #: lazarusidestrconsts.liserrorreadingxmlfile msgid "Error reading xml file %s%s%s%s%s" -msgstr "" +msgstr "Error al leer el archivo xml %s%s%s%s%s" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" @@ -5972,19 +5971,19 @@ msgstr "Error al escribir lista de paquetes al archivo%s%s%s%s" #: lazarusidestrconsts.liseteditcustomscanners msgid "Edit custom scanners (%s)" -msgstr "" +msgstr "Editar escaneadores personalizados (%s)" #: lazarusidestrconsts.lisevalexpression msgid "Eval expression" -msgstr "" +msgstr "Evaluar expresión" #: lazarusidestrconsts.lisevaluate msgid "E&valuate" -msgstr "" +msgstr "E&valuar" #: lazarusidestrconsts.liseverynthlinenumber msgid "Every n-th line number:" -msgstr "" +msgstr "Cada n-ésimo número de línea:" #: lazarusidestrconsts.lisexamples msgid "Examples" @@ -5992,11 +5991,11 @@ msgstr "Ejemplos" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" -msgstr "" +msgstr "Ejemplos:%sIdentificador%sTMyEnum.Enum%sNombreUnidad.Identificador%s#NombrePaquete.NombreUnidad.Identificador" #: lazarusidestrconsts.lisexceptiondialog msgid "Debugger Exception Notification" -msgstr "" +msgstr "Notificación de Excepciones del Depurador" #: lazarusidestrconsts.lisexcludefilter msgid "Exclude Filter" @@ -6004,7 +6003,7 @@ msgstr "Excluir filtro" #: lazarusidestrconsts.lisexcludefilter2 msgid "Exclude filter" -msgstr "" +msgstr "Filtro de excluir" #: lazarusidestrconsts.lisexecutingcommandafter msgid "Executing command after" @@ -6060,7 +6059,7 @@ msgstr "Exportar lista" #: lazarusidestrconsts.lisexpression msgid "Expression:" -msgstr "" +msgstr "Expresión:" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" @@ -6073,7 +6072,7 @@ msgstr "Extraer" #: lazarusidestrconsts.lisextractprocedure msgctxt "lazarusidestrconsts.lisextractprocedure" msgid "Extract Procedure" -msgstr "" +msgstr "Extraer Procedimiento" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External tools" @@ -6107,7 +6106,7 @@ msgstr "Hay un máximo de %s herramientas" #: lazarusidestrconsts.lisexttooltitlecompleted msgid "\"%s\" completed" -msgstr "" +msgstr "\"%s\" completado" #: lazarusidestrconsts.lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" @@ -6115,7 +6114,7 @@ msgstr "No se ha podido ejecutar la herramienta %s%s%s:%s%s" #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" -msgstr "" +msgstr "Ha fallado La carga del estado de plegado de código" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" @@ -6137,15 +6136,15 @@ msgstr "El archivo %s%s%s%s no parece ser un archivo de texto.¿Abrirlo de todas #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" -msgstr "" +msgstr "Extensión de archivo de programas" #: lazarusidestrconsts.lisfilefilter msgid "File filter" -msgstr "" +msgstr "Filtro de archivos" #: lazarusidestrconsts.lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" -msgstr "" +msgstr "El archivo %s%s%s ha cambiado. ¿Guardar?" #: lazarusidestrconsts.lisfileisnotwritable msgid "File is not writable" @@ -6165,7 +6164,7 @@ msgstr "Error en el enlace al archivo" #: lazarusidestrconsts.lisfilenameaddress msgid "Filename/Address" -msgstr "" +msgstr "Nombre de archivo/Dirección" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" @@ -6189,15 +6188,15 @@ msgstr "El archivo no es de texto" #: lazarusidestrconsts.lisfilesettings msgid "File Settings ..." -msgstr "" +msgstr "Ajustes de archivo ..." #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" -msgstr "" +msgstr "Archivos con codificación ASCII o UTF-8" #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" -msgstr "" +msgstr "Archivos sin codificación ASCII o UTF-8" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." @@ -6209,11 +6208,11 @@ msgstr "Filtro" #: lazarusidestrconsts.lisfilter2 msgid "(filter)" -msgstr "" +msgstr "(filtro)" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" -msgstr "" +msgstr "Conjuntos de filtros" #: lazarusidestrconsts.lisfindfilecasesensitive msgid "&Case sensitive" @@ -6249,7 +6248,7 @@ msgstr "buscar todos los archivos del &proyecto" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "search all &open files" -msgstr "" +msgstr "Buscar en t%odos los archivos abiertos" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "search in &directories" @@ -6269,11 +6268,11 @@ msgstr "Sólo &Palabras completas" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" -msgstr "" +msgstr "Buscar combinación de teclas" #: lazarusidestrconsts.lisfirst msgid "First" -msgstr "" +msgstr "Primero" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" @@ -6281,7 +6280,7 @@ msgstr "Corregir fichero LFM" #: lazarusidestrconsts.lisfloatingpoin msgid "Floating Point" -msgstr "" +msgstr "Punto Flotante" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" @@ -6289,7 +6288,7 @@ msgstr "Forzar renombrado" #: lazarusidestrconsts.lisform msgid "Form" -msgstr "" +msgstr "Formulario" #: lazarusidestrconsts.lisformaterror msgid "Format error" @@ -6314,11 +6313,11 @@ msgstr "Error del directorio de las fuentes de FPC" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " -msgstr "" +msgstr "Versión FPC:" #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" -msgstr "" +msgstr "Versión FPC (ej. 2.2.2)" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" @@ -6331,7 +6330,7 @@ msgstr "Buscar paleta del componente" #: lazarusidestrconsts.lisframe msgid "Frame" -msgstr "" +msgstr "Frame" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" @@ -6339,7 +6338,7 @@ msgstr "&Buscar hacia atrás" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" -msgstr "" +msgstr "Free Pascal" #: lazarusidestrconsts.lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" @@ -6423,27 +6422,27 @@ msgstr "Buscar dónde" #: lazarusidestrconsts.lisfunction msgid "Function" -msgstr "" +msgstr "Función" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition msgid "get word at current cursor position" -msgstr "" +msgstr "Obtener la palabra actual en la posición del cursor" #: lazarusidestrconsts.lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" +msgstr "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." #: lazarusidestrconsts.lisgroup msgid "Group" -msgstr "" +msgstr "Grupo" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" -msgstr "" +msgstr "Crecer hacia el más largo" #: lazarusidestrconsts.lishashelp msgid "Has Help" -msgstr "" +msgstr "Tiene Ayuda" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" @@ -6451,7 +6450,7 @@ msgstr "Comentario de cabecera para la clase" #: lazarusidestrconsts.lishelpentries msgid "Help entries" -msgstr "" +msgstr "Elementos de Ayuda" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" @@ -6459,7 +6458,7 @@ msgstr "Selector de ayuda" #: lazarusidestrconsts.lishexadecimal msgid "Hexadecimal" -msgstr "" +msgstr "Hexadecimal" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage msgid "Help for FreePascal Compiler message" @@ -6477,17 +6476,17 @@ msgstr "Abrir" #: lazarusidestrconsts.lishintpause msgctxt "lazarusidestrconsts.lishintpause" msgid "Pause" -msgstr "" +msgstr "Pausa" #: lazarusidestrconsts.lishintrun msgctxt "lazarusidestrconsts.lishintrun" msgid "Run" -msgstr "" +msgstr "Ejecutar" #: lazarusidestrconsts.lishintsave msgctxt "lazarusidestrconsts.lishintsave" msgid "Save" -msgstr "" +msgstr "Guardar" #: lazarusidestrconsts.lishintsaveall msgid "Save all" @@ -6528,7 +6527,7 @@ msgstr "Ver Unidades" #: lazarusidestrconsts.lishitcount msgid "Hitcount" -msgstr "" +msgstr "Contador" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" @@ -6564,7 +6563,7 @@ msgstr "Interface del IDE" #: lazarusidestrconsts.lisidentifier msgid "identifier" -msgstr "" +msgstr "identificador" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." @@ -6645,7 +6644,7 @@ msgstr "Ignorar binarios" #: lazarusidestrconsts.lisignoreexceptiontype msgid "Ignore this exception type" -msgstr "" +msgstr "Ignorar este tipo de excepción" #: lazarusidestrconsts.lisignoremissingfile msgid "Ignore missing file" @@ -6673,36 +6672,36 @@ msgstr "Rutas de archivos include" #: lazarusidestrconsts.lisindex msgid "Index" -msgstr "" +msgstr "Indice" #: lazarusidestrconsts.lisinfobuildabort msgid "Aborted..." -msgstr "" +msgstr "Abortado..." #: lazarusidestrconsts.lisinfobuildbuild msgctxt "lazarusidestrconsts.lisinfobuildbuild" msgid "Build" -msgstr "" +msgstr "Reconstruir" #: lazarusidestrconsts.lisinfobuildcaption msgid "Compile Project" -msgstr "" +msgstr "Compilar Proyecto" #: lazarusidestrconsts.lisinfobuildcomplile msgid "Compiling..." -msgstr "" +msgstr "Compilando..." #: lazarusidestrconsts.lisinfobuilderror msgid "Error..." -msgstr "" +msgstr "Error..." #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" -msgstr "" +msgstr "Errores:" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" -msgstr "" +msgstr "Hints:" #: lazarusidestrconsts.lisinfobuildlines msgctxt "lazarusidestrconsts.lisinfobuildlines" @@ -6716,15 +6715,15 @@ msgstr "Abortar" #: lazarusidestrconsts.lisinfobuildnote msgid "Notes:" -msgstr "" +msgstr "Notas:" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success..." -msgstr "" +msgstr "Exito..." #: lazarusidestrconsts.lisinfobuildwarning msgid "Warnings:" -msgstr "" +msgstr "Advertencias:" #: lazarusidestrconsts.lisinformationaboutunit msgid "Information about %s" @@ -6732,79 +6731,79 @@ msgstr "Información acerca de %s" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" -msgstr "" +msgstr "En frente de los relacionados" #: lazarusidestrconsts.lisinheritedcomponent msgid "Inherited Component" -msgstr "" +msgstr "Componente heredado" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" -msgstr "" +msgstr "Elemento heredado" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" -msgstr "" +msgstr "Para crear una copia limpia del proyecto/paquete, todos los archivos en el siguiente directorio seran borrados y todo su contenido se habrá perdido.%s%s¿Borrar todos los archivos en %s%s%s?" #: lazarusidestrconsts.lisinsertdate msgid "insert date" -msgstr "" +msgstr "insertar fecha" #: lazarusidestrconsts.lisinsertdateandtime msgid "insert date and time" -msgstr "" +msgstr "insertar fecha y hora" #: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring msgid "Insert date and time. Optional: format string" -msgstr "" +msgstr "Insertar fecha y hora. Opcional: cadena de formato" #: lazarusidestrconsts.lisinsertdateoptionalformatstring msgid "Insert date. Optional: format string" -msgstr "" +msgstr "Insertar fecha. Opcional: cadena de formato" #: lazarusidestrconsts.lisinsertendifneeded msgid "insert end if needed" -msgstr "" +msgstr "insertar end si es necesario" #: lazarusidestrconsts.lisinsertnameofcurrentprocedure msgid "Insert name of current procedure" -msgstr "" +msgstr "Insertar nombre del procedimiento actual" #: lazarusidestrconsts.lisinsertprintshorttag msgid "Insert PrintShort tag" -msgstr "" +msgstr "Insertar etiqueta de ImpresionCorta" #: lazarusidestrconsts.lisinsertprocedurehead msgid "insert procedure head" -msgstr "" +msgstr "Insertar encabezado de procedimiento" #: lazarusidestrconsts.lisinsertprocedurename msgid "insert procedure name" -msgstr "" +msgstr "Insertar nombre de procedimiento" #: lazarusidestrconsts.lisinserttime msgid "insert time" -msgstr "" +msgstr "insertar hora" #: lazarusidestrconsts.lisinserttimeoptionalformatstring msgid "Insert time. Optional: format string" -msgstr "" +msgstr "Inserta hora. Opcional: cadena de formato" #: lazarusidestrconsts.lisinspect msgid "&Inspect" -msgstr "" +msgstr "&Inspeccionar" #: lazarusidestrconsts.lisinspectdata msgid "Data" -msgstr "" +msgstr "Datos" #: lazarusidestrconsts.lisinspectdialog msgid "Debug Inspector" -msgstr "" +msgstr "Inspector de depuración" #: lazarusidestrconsts.lisinspectmethods msgid "Methods" -msgstr "" +msgstr "Métodos" #: lazarusidestrconsts.lisinspectproperties msgctxt "lazarusidestrconsts.lisinspectproperties" @@ -6825,15 +6824,15 @@ msgstr "Instalar selección" #: lazarusidestrconsts.lisinternalname msgid "Internal Name:" -msgstr "" +msgstr "Nombre Interno:" #: lazarusidestrconsts.lisinvalidbuildmodethebuildmodemustbeapascalidentifie msgid "Invalid build mode %s%s%s. The build mode must be a pascal identifier." -msgstr "" +msgstr "Modo de construcción inválido %s%s%s. El modo de construcción debe ser un identificador de pascal." #: lazarusidestrconsts.lisinvalidcircle msgid "Invalid circle" -msgstr "" +msgstr "círculo inválido" #: lazarusidestrconsts.lisinvalidcommand msgid "Invalid command" @@ -6841,7 +6840,7 @@ msgstr "Comando inválido" #: lazarusidestrconsts.lisinvalidcompilerfilename msgid "Invalid Compiler Filename" -msgstr "" +msgstr "Nombre de compilador inválido" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" @@ -6853,7 +6852,7 @@ msgstr "Directorio destino inválido" #: lazarusidestrconsts.lisinvalidexpression msgid "Invalid expression:%s%s%s%s" -msgstr "" +msgstr "Expresión inválida:%s%s%s%s" #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." @@ -6861,7 +6860,7 @@ msgstr "Expresión inválida.%Sugerencia: La función Resourcestring de Make esp #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" -msgstr "" +msgstr "Filtro inválido" #: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" @@ -6873,11 +6872,11 @@ msgstr "Selección múltiple inválida" #: lazarusidestrconsts.lisinvalidoff msgid "Invalid (Off)" -msgstr "" +msgstr "Inválido (Desactivado)" #: lazarusidestrconsts.lisinvalidon msgid "Invalid (On)" -msgstr "" +msgstr "Inválido (Activado)" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" @@ -6897,7 +6896,7 @@ msgstr "Nombre de archivo de proyecto inválido" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" -msgstr "" +msgstr "Directorio de publcación inválido" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" @@ -6913,7 +6912,7 @@ msgstr "%s%s%s es un nombre de proyecto inválido.%sPor favor escoja otro (e.j. #: lazarusidestrconsts.lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." -msgstr "" +msgstr "%s es un %s.%sEsta dependencia circular no es permitida." #: lazarusidestrconsts.lisjitform msgid "JIT Form" @@ -6941,7 +6940,7 @@ msgstr "Comandos del Inspector de Objetos" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" -msgstr "" +msgstr "Tecla (o 2 teclas en secuencia)" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" @@ -6965,7 +6964,7 @@ msgstr "Construir proyecto/programa" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" -msgstr "" +msgstr "Seleccionar esquema de teclas" #: lazarusidestrconsts.liskmclassic msgid "Classic" @@ -6981,7 +6980,7 @@ msgstr "Cerrar proyecto" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" -msgstr "" +msgstr "Edtor de defines de CodeTools" #: lazarusidestrconsts.liskmcodetoolsoptions msgid "CodeTools options" @@ -7174,19 +7173,19 @@ msgstr "Esquema de teclado" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus (default)" -msgstr "" +msgstr "Lazarus (predeterminado)" #: lazarusidestrconsts.liskmmacosxapple msgid "Mac OS X (Apple style)" -msgstr "" +msgstr "Mac OS X (estilo Apple)" #: lazarusidestrconsts.liskmmacosxlaz msgid "Mac OS X (Lazarus style)" -msgstr "" +msgstr "Mac OS X (estilo Lazarus)" #: lazarusidestrconsts.liskmnewpackage msgid "New package" -msgstr "" +msgstr "Paquete Nuevo" #: lazarusidestrconsts.liskmnewproject msgid "New project" @@ -7199,11 +7198,11 @@ msgstr "Nuevo proyecto desde archivo" #: lazarusidestrconsts.liskmnewunit msgctxt "lazarusidestrconsts.liskmnewunit" msgid "New Unit" -msgstr "" +msgstr "Unidad Nueva" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." -msgstr "" +msgstr "Nota: Todas las teclas obtendrán los valores del equema seleccionado." #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" @@ -7227,7 +7226,7 @@ msgstr "Publicar proyecto" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" -msgstr "" +msgstr "Compilación rápida, sin Enlazado" #: lazarusidestrconsts.liskmremoveactiveunitfromproject msgid "Remove active unit from project" @@ -7279,7 +7278,7 @@ msgstr "Seleccionar palabra derecha" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" -msgstr "Establecer marcador libre" +msgstr "Establecer Apartador libre" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set marker 0" @@ -7331,43 +7330,43 @@ msgstr "Cambiar entre Unidad y Formulario" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle marker 0" -msgstr "" +msgstr "Intercambiar marcador 0" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle marker 1" -msgstr "" +msgstr "Intercambiar marcador 1" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle marker 2" -msgstr "" +msgstr "Intercambiar marcador 2" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle marker 3" -msgstr "" +msgstr "Intercambiar marcador 3" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle marker 4" -msgstr "" +msgstr "Intercambiar marcador 4" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle marker 5" -msgstr "" +msgstr "Intercambiar marcador 5" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle marker 6" -msgstr "" +msgstr "Intercambiar marcador 6" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle marker 7" -msgstr "" +msgstr "Intercambiar marcador 7" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle marker 8" -msgstr "" +msgstr "Intercambiar marcador 8" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle marker 9" -msgstr "" +msgstr "Intercambiar marcador 9" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" @@ -7395,7 +7394,7 @@ msgstr "Cambiar vista a Editor de documentación" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" -msgstr "Cambiar vista a accesos rápidos del IDE" +msgstr "Cambiar vista de botnes de IDE" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" @@ -7533,7 +7532,7 @@ msgstr "Opciones avanzadas de construcción" #: lazarusidestrconsts.lislazbuildbuild msgctxt "lazarusidestrconsts.lislazbuildbuild" msgid "Build" -msgstr "" +msgstr "Reconstruir" #: lazarusidestrconsts.lislazbuildbuildcodetools msgid "Build CodeTools" @@ -7587,7 +7586,7 @@ msgstr "Error escribiendo archivo" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow msgid "%s%s%s%slazbuild is non interactive, aborting now." -msgstr "" +msgstr "%s%s%s%slazbuild no es interactivo, abortando." #: lazarusidestrconsts.lislazbuildlclinterface msgid "LCL interface" @@ -7706,7 +7705,7 @@ msgstr "La unidad %s no es propiedad de ningún paquete o proyecto.%sPor favor, #: lazarusidestrconsts.lisleaveemptyfo msgid "Leave empty for default .po file" -msgstr "Dejar vacío para el fichero .po por defecto" +msgstr "Dejar vacío para el fichero .po predeterminado" #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" @@ -7735,7 +7734,7 @@ msgstr "Igualar espacio a la izquierda" #: lazarusidestrconsts.lislegaltrademarks msgid "Legal Trademarks:" -msgstr "" +msgstr "Marcas Registradas:" #: lazarusidestrconsts.lislevels msgid "Levels" @@ -7755,11 +7754,11 @@ msgstr "Fichero LFM no encontrado" #: lazarusidestrconsts.lislfmisok msgid "LFM is ok" -msgstr "" +msgstr "LFM esta bien" #: lazarusidestrconsts.lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." #: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." @@ -7771,15 +7770,15 @@ msgstr "ruta de biblioteca" #: lazarusidestrconsts.lisline msgid "Line:" -msgstr "" +msgstr "Línea:" #: lazarusidestrconsts.lislinelength msgid "Line/Length" -msgstr "" +msgstr "Línea/Longitud" #: lazarusidestrconsts.lislink msgid "Link:" -msgstr "" +msgstr "Enlace:" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" @@ -7787,11 +7786,11 @@ msgstr "opciones del enlazador" #: lazarusidestrconsts.lislinktarget msgid "Link target" -msgstr "" +msgstr "Enlace objetivo:" #: lazarusidestrconsts.lislistofallcasevalues msgid "list of all case values" -msgstr "" +msgstr "listar todos los valores case" #: lazarusidestrconsts.lisloadingfailed msgid "Loading %s failed." @@ -7799,7 +7798,7 @@ msgstr "La carga de %s falló" #: lazarusidestrconsts.lislocals msgid "Locals" -msgstr "" +msgstr "Locales" #: lazarusidestrconsts.lislocalsdlgname msgctxt "lazarusidestrconsts.lislocalsdlgname" @@ -7813,7 +7812,7 @@ msgstr "Valor" #: lazarusidestrconsts.lislogmessage msgid "Log message" -msgstr "" +msgstr "Registrar Mensaje" #: lazarusidestrconsts.lislogo msgid "Logo" @@ -7821,15 +7820,15 @@ msgstr "Logotipo" #: lazarusidestrconsts.lislowercasestring msgid "lowercase string" -msgstr "" +msgstr "cadena en minúsculas" #: lazarusidestrconsts.lislowercasestringgivenasparameter msgid "Lowercase string given as parameter" -msgstr "" +msgstr "cadena dada como parámetro en minúsculas" #: lazarusidestrconsts.lismacpascal msgid "Mac Pascal" -msgstr "" +msgstr "Mac Pascal" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" @@ -7853,7 +7852,7 @@ msgstr "La unidad principal tiene una sección uses que contiene todas las unida #: lazarusidestrconsts.lismainunitispascalsource msgid "Main Unit is Pascal Source" -msgstr "" +msgstr "La Unidad Principal es fuente en Pascal" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" @@ -7910,7 +7909,7 @@ msgstr "Sección de Resourcesting inválida" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." -msgstr "" +msgstr "Por favor, escoja una sección de resourcestring de la lista." #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" @@ -7934,11 +7933,11 @@ msgstr "Las cadenas con mismo valor:" #: lazarusidestrconsts.lismaxs msgid "Max %d" -msgstr "" +msgstr "Máx %d" #: lazarusidestrconsts.lismemorydump msgid "Memory Dump" -msgstr "" +msgstr "Volcado de Memoria" #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" @@ -7970,7 +7969,7 @@ msgstr "Añadir punto de observación" #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in selection" -msgstr "" +msgstr "Dividir Líneas en la selección" #: lazarusidestrconsts.lismenubuild msgctxt "lazarusidestrconsts.lismenubuild" @@ -8014,7 +8013,7 @@ msgstr "Cerrar Proyecto" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." -msgstr "Definir editor de CodeTools ..." +msgstr "Editor de definiciones de CodeTools ..." #: lazarusidestrconsts.lismenucollectpofil msgid "Collect .po files" @@ -8047,7 +8046,7 @@ msgstr "Configurar componentes personalizados ..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." -msgstr "" +msgstr "Configuración de herramientas externas ..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." @@ -8079,7 +8078,7 @@ msgstr "Convertir archivo DFM a LFM ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." -msgstr "" +msgstr "Convertir Codificación de página de proyectos/paquetes ..." #: lazarusidestrconsts.lismenucopy msgctxt "lazarusidestrconsts.lismenucopy" @@ -8143,7 +8142,7 @@ msgstr "Borrar Elemento" #: lazarusidestrconsts.lismenueditorhandleonclickevent msgid "Handle OnClick Event" -msgstr "" +msgstr "Procesar Evento OnClick" #: lazarusidestrconsts.lismenueditorinsertfromtemplate msgid "Insert From Template..." @@ -8253,7 +8252,7 @@ msgstr "Editor FPDoc" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." -msgstr "" +msgstr "Opciones ..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" @@ -8318,7 +8317,7 @@ msgstr "Anuncio LGPL" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" -msgstr "" +msgstr "Notificación de Modified LGPL" #: lazarusidestrconsts.lismenuinserttext msgid "Insert text" @@ -8346,7 +8345,7 @@ msgstr "Saltar a" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to next bookmark" -msgstr "Saltar a próximo marcador" +msgstr "Saltar a próximo Apartador" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to next error" @@ -8354,7 +8353,7 @@ msgstr "Saltar a próximo error" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to previous bookmark" -msgstr "Saltar a marcador previo" +msgstr "Saltar a Apartador previo" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to previous error" @@ -8378,7 +8377,7 @@ msgstr "Nuevo ..." #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." -msgstr "" +msgstr "Paquete Nuevo ..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." @@ -8490,7 +8489,7 @@ msgstr "Chequeo rápido de la sintaxis" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" -msgstr "" +msgstr "Verificación rápida de sintaxis exitosa" #: lazarusidestrconsts.lismenuquit #, fuzzy @@ -8615,7 +8614,7 @@ msgstr "Sleccionar palabra" #: lazarusidestrconsts.lismenusetfreebookmark msgid "Set a free bookmark" -msgstr "Establecer un marcador libre" +msgstr "Establecer un Apartador libre" #: lazarusidestrconsts.lismenusortselection msgid "Sort selection ..." @@ -8741,11 +8740,11 @@ msgstr "Tutorial" #: lazarusidestrconsts.lismenutemplateundo msgctxt "lazarusidestrconsts.lismenutemplateundo" msgid "Undo" -msgstr "" +msgstr "Deshacer" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle comment" -msgstr "" +msgstr "Intercambiar Comentario" #: lazarusidestrconsts.lismenutools msgid "&Tools" @@ -8780,7 +8779,7 @@ msgstr "Ver editor de anclaje" #: lazarusidestrconsts.lismenuviewassembler msgid "Assembler" -msgstr "" +msgstr "Ensamblador" #: lazarusidestrconsts.lismenuviewbreakpoints msgid "BreakPoints" @@ -8800,14 +8799,12 @@ msgid "Code Explorer" msgstr "Explorador de Código" #: lazarusidestrconsts.lismenuviewcomponentpalette -#, fuzzy -#| msgid "View Component Palette" msgid "Component Palette" -msgstr "Ver paleta de componente" +msgstr "Paleta de componentes" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" -msgstr "&Componentes" +msgstr "Lista de &Componentes" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug output" @@ -8818,17 +8815,13 @@ msgid "Forms..." msgstr "Formularios..." #: lazarusidestrconsts.lismenuviewidespeedbuttons -#, fuzzy -#| msgid "View IDE speed buttons" msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons" msgid "IDE speed buttons" -msgstr "Ver accesos rápidos del IDE" +msgstr "Ver botones del IDE" #: lazarusidestrconsts.lismenuviewjumphistory -#, fuzzy -#| msgid "View Jump-History ..." msgid "Jump-History ..." -msgstr "Ver historial de salto ..." +msgstr "Ver historial de saltos ..." #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" @@ -8837,7 +8830,7 @@ msgstr "Variables locales" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" -msgstr "Mensajes" +msgstr "Ventana de Mensajes" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" @@ -8847,11 +8840,11 @@ msgstr "Inspector de Objetos" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" msgid "Registers" -msgstr "" +msgstr "Registros" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" -msgstr "" +msgstr "Explorador de Restricciones" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" @@ -8869,23 +8862,19 @@ msgstr "Editor de código fuente" #: lazarusidestrconsts.lismenuviewtodolist msgctxt "lazarusidestrconsts.lismenuviewtodolist" msgid "ToDo List" -msgstr "Lista Para-Hacer" +msgstr "Lista Por-Hacer" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Cambiar vista Formulario/Unidad" #: lazarusidestrconsts.lismenuviewunitdependencies -#, fuzzy -#| msgid "View Unit Dependencies" msgid "Unit Dependencies" -msgstr "Ver dependencias de la unidad" +msgstr "Dependencias de la Unidad" #: lazarusidestrconsts.lismenuviewunitinfo -#, fuzzy -#| msgid "View Unit Information" msgid "Unit Information" -msgstr "Ver Información de Unidad" +msgstr "Información de la Unidad" #: lazarusidestrconsts.lismenuviewunits msgid "Units..." @@ -8901,11 +8890,11 @@ msgstr "&Ventana" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" -msgstr "" +msgstr "Editor de Mensajes" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" -msgstr "" +msgstr "Método de clase no hallado" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" @@ -8921,27 +8910,27 @@ msgstr "Paquetes desaparecidos" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." #: lazarusidestrconsts.lismodify msgid "&Modify" -msgstr "" +msgstr "&Modificar" #: lazarusidestrconsts.lismore msgid "More" -msgstr "" +msgstr "Más" #: lazarusidestrconsts.lismovepage msgid "Move Page ..." -msgstr "" +msgstr "Mover Página ..." #: lazarusidestrconsts.lisms msgid "(ms)" -msgstr "" +msgstr "(ms)" #: lazarusidestrconsts.lismvdocking msgid "Docking" -msgstr "" +msgstr "Empotrado" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" @@ -8949,7 +8938,7 @@ msgstr "Guardar mensajes al archivo (*.txt)" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" -msgstr "" +msgstr "Conflicto de nombre" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" @@ -8957,7 +8946,7 @@ msgstr "Nombre del nuevo procedimiento" #: lazarusidestrconsts.lisnever msgid "Never" -msgstr "" +msgstr "Nunca" #: lazarusidestrconsts.lisnew msgid "new" @@ -8973,11 +8962,11 @@ msgstr "Nueva clase" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" -msgstr "" +msgstr "Nueva aplicación de consola" #: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "" +msgstr "Crear una aplicación cgi nueva.%sEl archivo de programa es administrado por Lazarus." #: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram msgid "Create a new program." @@ -9017,7 +9006,7 @@ msgstr "Crear una unidad nueva con un módulo de datos." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame" -msgstr "" +msgstr "Crear una unidad nueva con un frame" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." @@ -9025,7 +9014,7 @@ msgstr "Crear una unidad nueva con un formulario LCL." #: lazarusidestrconsts.lisnewdlginheritanexistingcomponent msgid "Inherit from an existing component." -msgstr "" +msgstr "Heredar de un componente existente." #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" @@ -9037,7 +9026,7 @@ msgstr "Por favor seleccione primero un elemento." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" -msgstr "" +msgstr "Codificación de página nueva:" #: lazarusidestrconsts.lisnewproject msgid "%s - (new project)" @@ -9045,11 +9034,11 @@ msgstr "%s - (nuevo proyecto)" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections:" -msgstr "" +msgstr "Unidades nuevas son añadidas a las secciones uses:" #: lazarusidestrconsts.lisno msgid "No" -msgstr "" +msgstr "No" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" @@ -9069,11 +9058,11 @@ msgstr "No se heredan opciones del compilador." #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" -msgstr "" +msgstr "No hay ninguna ventana IDE seleccionada" #: lazarusidestrconsts.lisnolfmfile msgid "No LFM file" -msgstr "" +msgstr "Sin archivo LFM" #: lazarusidestrconsts.lisnoname msgid "noname" @@ -9089,15 +9078,15 @@ msgstr "ninguno" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" -msgstr "" +msgstr "No hay ningún nodo seleccionado" #: lazarusidestrconsts.lisnopascalfile msgid "No pascal file" -msgstr "" +msgstr "no es un archivo pascal" #: lazarusidestrconsts.lisnoprogramfilesfound msgid "No program file %s%s%s found." -msgstr "" +msgstr "Ningún archivo de programa %s%s%s ha sido encontrado." #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" @@ -9137,7 +9126,7 @@ msgstr "No implementado todavía:%s%s" #: lazarusidestrconsts.lisnotimplementedyet2 msgid "Not implemented yet." -msgstr "" +msgstr "Aún no implementado" #: lazarusidestrconsts.lisnotnow msgid "Not now" @@ -9157,11 +9146,11 @@ msgstr "Seleccionar un tipo de proyecto" #: lazarusidestrconsts.lisnumberoffilestoconvert msgid "Number of files to convert: %s" -msgstr "" +msgstr "Número de archivos a convertir: %s" #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" -msgstr "" +msgstr "Object Pascal - predeterminado" #: lazarusidestrconsts.lisobjectpath msgid "object path" @@ -9169,7 +9158,7 @@ msgstr "ruta de objeto" #: lazarusidestrconsts.lisoff msgid "? (Off)" -msgstr "" +msgstr "? (Desactivado)" #: lazarusidestrconsts.lisoifaddtofavouriteproperties msgid "Add to favourite properties" @@ -9277,7 +9266,7 @@ msgstr "Clase antigua" #: lazarusidestrconsts.lison msgid "? (On)" -msgstr "" +msgstr "? (Activado)" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" @@ -9297,7 +9286,7 @@ msgstr "Abrir archivo" #: lazarusidestrconsts.lisopenfile2 msgid "Open File ..." -msgstr "" +msgstr "Abrir Archivo ..." #: lazarusidestrconsts.lisopenlfm msgid "Open %s" @@ -9357,7 +9346,7 @@ msgstr "o" #: lazarusidestrconsts.lisoriginalfilename msgid "Original File Name:" -msgstr "" +msgstr "Nombre de archivo original:" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." @@ -9365,19 +9354,19 @@ msgstr "Ignorar lenguaje. Por ejemplo --languaje=de. Para los valores posibles m #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" -msgstr "" +msgstr "%sreemplaza al compilador predeterminado. ej. ppc386 ppcx64 ppcppc etc. El predeterminado se almacena en environmentoptions.xml" #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" -msgstr "" +msgstr "%sreemplaza al cpu del proyecto. ej. i386 x86_64 powerpc powerpc_64 etc. predeterminado: %s" #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau msgid "%soverride the project operating system. e.g. win32 linux. default: %s" -msgstr "" +msgstr "%sreemplaza al sistema operativo del proyecto. ej. win32 linux. predeterminado: %s" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" -msgstr "" +msgstr "%sreemplaza el widgetset del proyecto. ej. gtk gtk2 qt win32 carbon. predeterminado: %s" #: lazarusidestrconsts.lisoverwritefile msgid "Overwrite file?" @@ -9393,7 +9382,7 @@ msgstr "Paquete" #: lazarusidestrconsts.lispackage2 msgid "package %s" -msgstr "" +msgstr "paquete %s" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" @@ -9417,7 +9406,7 @@ msgstr "Paquetes a instalar en el IDE" #: lazarusidestrconsts.lispackageunit msgid "package unit" -msgstr "" +msgstr "Unidad de paquete" #: lazarusidestrconsts.lispascalsourcefile msgid "Pascal source file" @@ -9429,19 +9418,19 @@ msgstr "Unidad Pascal" #: lazarusidestrconsts.lispasscount msgid "Pass Count" -msgstr "" +msgstr "Cuenta Pasos" #: lazarusidestrconsts.lispasteclipboard msgid "paste clipboard" -msgstr "" +msgstr "Pegar portapapeles" #: lazarusidestrconsts.lispastetextfromclipboard msgid "Paste text from clipboard" -msgstr "" +msgstr "Pegar texto desde el portapapeles" #: lazarusidestrconsts.lispath msgid "Path" -msgstr "" +msgstr "Ruta" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" @@ -9470,7 +9459,7 @@ msgstr "Seleccionar directorio" #: lazarusidestrconsts.lispathtoinstance msgid "Path to failed Instance:" -msgstr "" +msgstr "Ruta a Instancia Fallida" #: lazarusidestrconsts.lispckeditaddanitem msgid "Add an item" @@ -9479,7 +9468,7 @@ msgstr "Añadir un elemento" #: lazarusidestrconsts.lispckeditaddtoproject msgctxt "lazarusidestrconsts.lispckeditaddtoproject" msgid "Add to project" -msgstr "" +msgstr "Agregar al proyecto" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" @@ -9522,7 +9511,7 @@ msgstr "Crear Makefile" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" -msgstr "" +msgstr "Propiedades de la dependencia" #: lazarusidestrconsts.lispckediteditgeneraloptions msgid "Edit General Options" @@ -9866,7 +9855,7 @@ msgstr "Progreso" #: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" -msgstr "" +msgstr "Una Unidad pascal debe tener la extensión .pp o .pas" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" @@ -9907,17 +9896,17 @@ msgstr "Ordenar archivos" #: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" -msgstr "" +msgstr "Ya hay una unidad con este nombre.%sArchivo: %s" #: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid pascal identifier." -msgstr "" +msgstr "El nombre de la unidad no es un identificador pascal válido" #: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses" msgid "The unitname is used when the IDE extends uses clauses." -msgstr "" +msgstr "El nombre de la unidad se usa cuando el IDE extiende las clausulas Uses." #: lazarusidestrconsts.lispeunitname msgid "Unitname:" @@ -9926,7 +9915,7 @@ msgstr "Nombre de unidad:" #: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" -msgstr "" +msgstr "El nombre de Unidad y el nombre de archivo no coinciden.%sEjemplo: unit1.pas y Unit1" #: lazarusidestrconsts.lispeviewtodolist msgid "View ToDo list" @@ -9990,7 +9979,7 @@ msgstr "Incluir Archivo" #: lazarusidestrconsts.lispkgfiletypeissues msgid "Issues xml file" -msgstr "" +msgstr "Archivo xml de problemas" #: lazarusidestrconsts.lispkgfiletypelfm msgid "LFM - Lazarus form text" @@ -10177,7 +10166,7 @@ msgstr "Archivo de paquete desaparecido" #: lazarusidestrconsts.lispkgmangpackagefilenotsaved msgid "Package file not saved" -msgstr "" +msgstr "Archivo de paquete no guardado" #: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" @@ -10225,7 +10214,7 @@ msgstr "¿Renombrar archivo en el paquete?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" -msgstr "" +msgstr "¿Renombrar archivo a minúsculas?" #: lazarusidestrconsts.lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" @@ -10422,7 +10411,7 @@ msgstr "No se ha podido borrar el archivo de estado viejo %s%s%s%s para el paque #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" -msgstr "" +msgstr "No se pudo cargar el paquete" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." @@ -10510,7 +10499,7 @@ msgstr "SynEdit - El componente editor usado por Lazarus. http://sourceforge.net #: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "" +msgstr "La FCL - Biblioteca de componentes de FreePascal proporciona las clases básicas para object pascal." #: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." @@ -10526,7 +10515,7 @@ msgstr "La RTL - La biblioteca en tiempo de ejecución. Es la base de todos los #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "Este es el paquete por defecto. Usado únicamente para componentes sin paquete. Estos componentes están sin actualizar." +msgstr "Este es el paquete predeterminado. Usado únicamente para componentes sin paquete. Estos componentes están sin actualizar." #: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." @@ -10558,7 +10547,7 @@ msgstr "Existe" #: lazarusidestrconsts.lispldglobal msgid "Global" -msgstr "" +msgstr "Global" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" @@ -10635,7 +10624,7 @@ msgstr "Tipo" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" -msgstr "" +msgstr "Seleccione el directorio de archivos .po" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" @@ -10643,7 +10632,7 @@ msgstr "No guardar ninguna información de la sesión" #: lazarusidestrconsts.lispointer msgid "Pointer" -msgstr "" +msgstr "Puntero" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" @@ -10663,7 +10652,7 @@ msgstr "Guardar información de la sesión en" #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" -msgstr "" +msgstr "Palabra anterior" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " @@ -10696,11 +10685,11 @@ msgstr "Procedimiento con interface" #: lazarusidestrconsts.lisproductname msgid "Product Name:" -msgstr "" +msgstr "Nombre de Producto:" #: lazarusidestrconsts.lisproductversion msgid "Product Version:" -msgstr "" +msgstr "Versión del Producto:" #: lazarusidestrconsts.lisprogram msgctxt "lazarusidestrconsts.lisprogram" @@ -10721,7 +10710,7 @@ msgstr "El archivo de código del programa debe de tener una extensión de pasca #: lazarusidestrconsts.lisprojaddaddfilestoproject msgid "Add files to project" -msgstr "" +msgstr "Todos los archivos al proyecto" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" @@ -10862,7 +10851,7 @@ msgstr "macro ProjectUnitPath" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" -msgstr "" +msgstr "Directorio de salida del proyecto (ej. el directorio ppu)" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" @@ -10874,7 +10863,7 @@ msgstr "El proyecto %s%s%s se ha construido correctamente. :)" #: lazarusidestrconsts.lisprojectunit msgid "project unit" -msgstr "" +msgstr "Unidad del proyecto" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" @@ -10882,7 +10871,7 @@ msgstr "Ruta de Unidad del proyecto" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" -msgstr "" +msgstr "Asistente de proyecto" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" @@ -10890,7 +10879,7 @@ msgstr "Confirmar borrado de dependencia" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" -msgstr "" +msgstr "Confirmar eliminación de archivo" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" @@ -10914,7 +10903,7 @@ msgstr "No se puede leer el archivo de estado %s del proyecto %s.%sError: %s" #: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" -msgstr "" +msgstr "No es posible escribir el archivo de estado para el proyecto %s%sError: %s" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" @@ -10939,7 +10928,7 @@ msgstr "Preguntar por valor" #: lazarusidestrconsts.lispropertiesofconditionalcompileroption msgid "Properties of conditional compiler option" -msgstr "" +msgstr "Propiedades de la opción condicional de compilador" #: lazarusidestrconsts.lisprotected msgid "Protected" @@ -10971,7 +10960,7 @@ msgstr "Filtro de Incluir inválido" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" -msgstr "" +msgstr "Guardar archivos .lrs en el directorio de salida" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" @@ -11004,15 +10993,15 @@ msgstr "El nombre de la unidad y el nombre del archivo no coinciden.%sEjemplo: u #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" -msgstr "" +msgstr "Convertir proyecto Delphi" #: lazarusidestrconsts.lispwnewproject msgid "New Project" -msgstr "" +msgstr "Nuevo Proyecto" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" -msgstr "" +msgstr "Abrir Proyecto" #: lazarusidestrconsts.lispwopenrecentproject msgctxt "lazarusidestrconsts.lispwopenrecentproject" @@ -11021,7 +11010,7 @@ msgstr "Abrir Reciente" #: lazarusidestrconsts.lispwrecentprojects msgid "Recent Projects" -msgstr "" +msgstr "Proyectos Recientes" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" @@ -11033,12 +11022,12 @@ msgstr "Error de lectura" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" -msgstr "" +msgstr "Record/Estructura" #: lazarusidestrconsts.lisregisters msgctxt "lazarusidestrconsts.lisregisters" msgid "Registers" -msgstr "" +msgstr "Registros" #: lazarusidestrconsts.lisregistersdlgname msgctxt "lazarusidestrconsts.lisregistersdlgname" @@ -11052,7 +11041,7 @@ msgstr "Valor" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" -msgstr "" +msgstr "Expresión Regular" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" @@ -11068,7 +11057,7 @@ msgstr "Eliminar todas las propiedades inválidas" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" -msgstr "" +msgstr "Eliminar todas las Unidades" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" @@ -11076,7 +11065,7 @@ msgstr "Eliminar del proyecto" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" -msgstr "" +msgstr "Remover las Unidades seleccionadas" #: lazarusidestrconsts.lisremovethem msgid "Remove them" @@ -11096,11 +11085,11 @@ msgstr "Renombrar en minúsculas" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" -msgstr "" +msgstr "Re-Abrir con otra codificación de página" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" -msgstr "" +msgstr "Cuenta a Repetir:" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." @@ -11124,15 +11113,15 @@ msgstr "Error al guardar recurso" #: lazarusidestrconsts.lisresult msgid "Result :=" -msgstr "" +msgstr "Result :=" #: lazarusidestrconsts.lisresult2 msgid "Result:" -msgstr "" +msgstr "Result:" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "returns list of all values of case variable in front of variable" -msgstr "" +msgstr "Devuelve una lista de todos los valores de una variable CASE frente a la variable" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" @@ -11165,7 +11154,7 @@ msgstr "Igualar espacio a la derecha" #: lazarusidestrconsts.lisroot msgid "Root" -msgstr "" +msgstr "Raiz" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" @@ -11325,19 +11314,19 @@ msgstr "Seleccionar desde archivos Delphi (*.dfm)" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" -msgstr "" +msgstr "(vecino inferior seleccionado)" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" -msgstr "" +msgstr "(vecino izquierdo seleccionado)" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" -msgstr "" +msgstr "(vecino derecho seleccionado)" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" -msgstr "" +msgstr "(vecino superior seleccionado)" #: lazarusidestrconsts.lisselectfile msgid "Select the file" @@ -11353,23 +11342,23 @@ msgstr "Herramienta de selección" #: lazarusidestrconsts.lissetdefault msgid "Set default" -msgstr "" +msgstr "Establecer predeterminado" #: lazarusidestrconsts.lissetvalue msgid "Set value" -msgstr "" +msgstr "Establecer valor" #: lazarusidestrconsts.lisshort msgid "Short:" -msgstr "" +msgstr "Corto:" #: lazarusidestrconsts.lisshow msgid "Show" -msgstr "" +msgstr "Mostrar" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" -msgstr "" +msgstr "Mostrar Panel Fijo" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" @@ -11393,11 +11382,11 @@ msgstr "Mostrar paquetes" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" -msgstr "" +msgstr "Mostrar carácteres especiales" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" -msgstr "" +msgstr "Mostrar barra de estado" #: lazarusidestrconsts.lisshowunits msgid "Show units" @@ -11405,11 +11394,11 @@ msgstr "Mostrar unidades" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" -msgstr "" +msgstr "Mostrar versión y salir" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" -msgstr "" +msgstr "Encoger al más pequeño" #: lazarusidestrconsts.lissibling msgid "Sibling" @@ -11429,7 +11418,7 @@ msgstr "Continuar cargando el último proyecto" #: lazarusidestrconsts.lissmallerratherthanfaster msgid "smaller rather than faster" -msgstr "" +msgstr "Más pequeño en lugar de más rápido" #: lazarusidestrconsts.lissmatches msgid "Matches" @@ -11437,7 +11426,7 @@ msgstr "Coincidencias" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" -msgstr "" +msgstr "Lo siento, aún no implementado" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" @@ -11506,11 +11495,11 @@ msgstr "Origen y destino son el mismo:%s%s" #: lazarusidestrconsts.lissourcebreakpoint msgid "&Source breakpoint" -msgstr "" +msgstr "Punto de interrupción fuente" #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." -msgstr "" +msgstr "El directorio origen %s%s%s%sy el directorio de destino %s%s%s%sson el mismo.%s%sQuizas no entendió bien ésta función.%sLa cúal limpiará/recreará el directorio de destino%sy copiará el paquete/proyecto en el." #: lazarusidestrconsts.lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." @@ -11534,7 +11523,7 @@ msgstr "Igualar espacio" #: lazarusidestrconsts.lissrcos msgid "Src OS" -msgstr "" +msgstr "OS Fuente" #: lazarusidestrconsts.lisssearching msgid "Searching" @@ -11562,7 +11551,7 @@ msgstr "¿Parar sesión de depuración?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" -msgstr "" +msgstr "Detener en excepción" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" @@ -11578,12 +11567,12 @@ msgstr "Error de flujo" #: lazarusidestrconsts.lisstring msgid "String" -msgstr "" +msgstr "Cadena" #: lazarusidestrconsts.lisstyle msgctxt "lazarusidestrconsts.lisstyle" msgid "Style" -msgstr "" +msgstr "Estilo" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" @@ -11624,7 +11613,7 @@ msgstr "SynEdit" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" -msgstr "" +msgstr "Modo de sintaxis" #: lazarusidestrconsts.listab msgid "Tab" @@ -11644,7 +11633,7 @@ msgstr "Nombre del archivo objetivo del proyecto" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" -msgstr "" +msgstr "NombreDeArchivo + Parametros objetivo" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" @@ -11661,7 +11650,7 @@ msgstr "Insertar Para-Hacer" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" -msgstr "" +msgstr "Celda Editable" #: lazarusidestrconsts.listemplateeditparamcellhelp msgid "" @@ -11669,6 +11658,9 @@ msgid "" "\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n" "\"default\",Sync, to Sync with a previous cell of equal default\n" msgstr "" +"Inserta una celda editable, con un valor predeterminado\n" +"\"\",Sync=n (,S=n), para Sincronizar con una celda previa (n=1 para la celda anterior más alta\n" +"\"default\",Sync, para Sincronizar con celda una anterior con igual predeterminado\n" #: lazarusidestrconsts.listestdirectory msgid "Test directory" @@ -11692,7 +11684,7 @@ msgstr "El comando después de publicar es inválido:%s%s%s%s" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." -msgstr "" +msgstr "El componente %s no pude ser eliminado por que %s no es su propietario" #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" @@ -11704,7 +11696,7 @@ msgstr "El editor de componentes de la clase %s%s%s%sinvocado con el verbo #%s % #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." -msgstr "" +msgstr "El componente %s hereda de %s.Para eliminar un componente heredado, abra el ancestro y borrelo ahí." #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" @@ -11744,11 +11736,11 @@ msgstr "El directorio de destino%s%s%s%s no existe." #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." -msgstr "" +msgstr "El directorio de destino %s%s%s no existe.%sFavor de verificar el nombre del archivo objetivo del proyecto en Menu > Proyecto > Opciones de Proyecto." #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "El directorio %s%s%s no se necesitará mas en la ruta de la unidad.%s¿Eliminarlo?" +msgstr "El directorio %s%s%s no se necesitará más en la ruta de la unidad.%s¿Eliminarlo?" #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" @@ -11756,7 +11748,7 @@ msgstr "El directorio %s%s%s no está todavía en la ruta de la unidad.%s¿Añad #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." -msgstr "" +msgstr "El directorio %s no fue encontrado." #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" @@ -11784,7 +11776,7 @@ msgstr "El archivo %s parece ser el archivo de programa de un proyecto de Lazaru #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "" +msgstr "El archivo %s%s%s%sfue hallado en uno de los directorios de fuentes del paquete %s y parece una Unidad compilada. Las Unidades compiladas deben estar en el directorio de Salida del paquete, de otro modo otros paquetes pueden tener problemas cuando usen éste paquete.%s%s¿Eliminar el archivo causante de la ambigüedad?" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" @@ -11812,11 +11804,11 @@ msgstr "El directorio de fuentes de Free Pascal no ha sido encontrado.%sAlgunas #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." -msgstr "" +msgstr "El identificador es una Unidad. Favor de usar la función Archivo -> Guardar Como para renombrar una Unidad." #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" -msgstr "" +msgstr "La tecla %s%sya ha sido asignada a %s.%s%s¿Eliminar la asignación anterior y asignar la tecla a la nueva función%s%s?" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." @@ -11844,31 +11836,31 @@ msgstr "La nueva unidad no está todavía en la ruta de búsqueda de unidad.%s¿ #: lazarusidestrconsts.listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." -msgstr "" +msgstr "No se encuentra el directorio de salida %s%s%s." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." -msgstr "" +msgstr "El directorio de salida de %s esta listado en la ruta de archivos incluidos de %s." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." -msgstr "" +msgstr "El directori de salida de %s esta listado en la ruta de archivos incluidos heredada de %s." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." -msgstr "" +msgstr "El directorio de salida de %s esta listado en la ruta de busqueda de Unidades heredada de %s." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." -msgstr "" +msgstr "El directorio de salida de %s esta listado en la ruta de busqueda de Unidades de %s." #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." -msgstr "" +msgstr "El directorio de salida debería ser un directorio aparte y que no contenga archivos de código fuente." #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." -msgstr "" +msgstr "El paquete ya contiene una Unidad con este nombre." #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" @@ -11884,7 +11876,7 @@ msgstr "El proyecto debe guardarse antes de construirlo%sSi establece el Directo #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." -msgstr "" +msgstr "El proyecto usa OS objetivo=%s y CPU=%s.%sEl system.ppu para este objetivo no se encontró en los directorios de los binarios de FPC. %sAsegúrese de que FPC esta instalado correctamente para este objetivo y que el archivo fpc.cfg contiene los directorios correctos." #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" @@ -11896,7 +11888,7 @@ msgstr "Hay un archivo con el mismo nombre y extensión similar en disco%sArchiv #: lazarusidestrconsts.listhereisalreadyabuildmodewiththename msgid "There is already a build mode with the name %s%s%s." -msgstr "" +msgstr "Ya existe un Modo de Construcción con el nombre %s%s%s." #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" @@ -11932,7 +11924,7 @@ msgstr "No se puede eliminar el componente raiz." #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "" +msgstr "El Directorio de Pruebas no pudo ser localizado:%s%s%s%s%s(ver Entorno->Opciones .. -> Archivos)" #: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." @@ -11944,11 +11936,11 @@ msgstr "La unidad %s existe dos veces en la ruta de unidad de %s:" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" -msgstr "" +msgstr "En nombre de archivo de la Unidad %s%s%s no esta en minúsculas.%sEl compilador FreePascal no busca todas las coincidencias de mayúsculas/Minúsculas. Se recomienda usar minúsculas en el nombre de archivo.%s%s¿Renombrar archivo en minúsculas?" #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic msgid "The unit %s is used by other files.%sUpdate references automatically?" -msgstr "" +msgstr "La Unidad %s es usada por otros archivos.%s¿Desea actualizar las referencias automáticamente?" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." @@ -11956,15 +11948,15 @@ msgstr "La unidad también tiene el nombre %s%s%s. Los identificadores Pascal de #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" -msgstr "" +msgstr "La ruta de Busqueda de Unidades de %s%s%s contiene el directorio de fuentes %s%s%s del paquete %s" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." -msgstr "" +msgstr "El directorio de trabajo %s%s%s no existe.%sPor favor, verifique el directorio de trabajo en el Menu > Ejecutar > Parámetros de Ejecución." #: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor msgid "This function needs an open .lfm file in the source editor." -msgstr "" +msgstr "Esta función necesita un archivo .lfm abierto en el editor de código fuente." #: lazarusidestrconsts.listhishelpmessage msgid "this help message" @@ -11984,11 +11976,11 @@ msgstr "Pasará esto:%s%s%s¿Continuar?" #: lazarusidestrconsts.listitle msgid "&Title" -msgstr "" +msgstr "&Título" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" -msgstr "" +msgstr "Título (dejar vacio en forma predeterminada)" #: lazarusidestrconsts.listmfunctionappendpathdelimiter msgid "Function: append path delimiter" @@ -12021,7 +12013,7 @@ msgstr "(macro desconocida: %s)" #: lazarusidestrconsts.listodoexport msgctxt "lazarusidestrconsts.listodoexport" msgid "Export" -msgstr "" +msgstr "Exportar" #: lazarusidestrconsts.listodogoto msgid "Goto" @@ -12082,11 +12074,11 @@ msgstr "Ruta:" #: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" -msgstr "" +msgstr "Intercambiar mostrar ruta completa o relativa para nombres de archivo" #: lazarusidestrconsts.listop msgid "Top" -msgstr "" +msgstr "Arriba" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" @@ -12115,7 +12107,7 @@ msgstr "Categoría" #: lazarusidestrconsts.listurbopascal msgid "Turbo Pascal" -msgstr "" +msgstr "Turbo Pascal" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." @@ -12311,7 +12303,7 @@ msgstr "No se ha podido crear el archivo %s%s%s" #: lazarusidestrconsts.lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" -msgstr "" +msgstr "No se puede crear el archivo%s%s%s%s" #: lazarusidestrconsts.lisunabletocreatefilename msgid "Unable to create file %s%s%s." @@ -12319,7 +12311,7 @@ msgstr "No se ha podido crear el archivo %s%s%s" #: lazarusidestrconsts.lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" -msgstr "" +msgstr "No se puede crear el enlace %s%s%s con destino %s%s%s" #: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin msgid "Unable to create new method. Please fix the error shown in the message window." @@ -12335,7 +12327,7 @@ msgstr "No se ha podido borrar el archivo ambiguo %s%s%s" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." -msgstr "" +msgstr "No se encontró una sección ResourceString en ésta o en cualquier de las Unidades usadas." #: lazarusidestrconsts.lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" @@ -12347,7 +12339,7 @@ msgstr "No se ha podido encontrar el archivo %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test" -msgstr "" +msgstr "No se halló el archivo %s%s%s.%sSi pertenece a su proyecto, verifique la ruta busqueda en%sProyecto->Opciones del Compilador ->Rutas->Otros Archivos de Unidad. Si este archivo pertenece a un paquete, verifique las opciones del compilador del propio paquete. Si este archivo pertenece a Lazarus, asegúrese de efectuar una compilación limpia. Si el archivo pertenece a FPC entonces verifique el archivo fpc.cfg. Si no esta seguro, pruebe con, Proyecto -> Opciones del Compilador ... -> Probar" #: lazarusidestrconsts.lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." @@ -12359,7 +12351,7 @@ msgstr "No se ha podido encontrar el método. Por favor corrija el error mostrad #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s" -msgstr "" +msgstr "No fue posible encontrar la Unidad pascal (.pas,.pp) para el archivo .lfm %s%s%s%s" #: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." @@ -12379,7 +12371,7 @@ msgstr "No se ha podido cargar el archivo de recursos viejo.%s El archivo de rec #: lazarusidestrconsts.lisunabletoloadpackage msgid "Unable to load package %s%s%s" -msgstr "" +msgstr "No fué posible cargar el paquete %s%s%s" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." @@ -12387,7 +12379,7 @@ msgstr "No se ha podido cargar la clase del componente %s%s%s porque depende de #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" -msgstr "" +msgstr "No fué posible abrir el componente ancestro" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." @@ -12395,7 +12387,7 @@ msgstr "No se podido abrir el diseñador.%sLa clase %s no desciende de una clase #: lazarusidestrconsts.lisunabletoread msgid "Unable to read %s" -msgstr "" +msgstr "No se puede leer %s" #: lazarusidestrconsts.lisunabletoreadfile msgid "Unable to read file" @@ -12447,7 +12439,7 @@ msgstr "No se ha podido renombrar la variable en la fuente." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" -msgstr "" +msgstr "No es posible ejecutar" #: lazarusidestrconsts.lisunabletosavefile msgid "Unable to save file %s%s%s" @@ -12483,7 +12475,7 @@ msgstr "No se ha podido actualizar la declaración CreateForm en la fuente del p #: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt." -msgstr "" +msgstr "No es posible actualizar el archivo de resource binario%s%s%sdesde el archivo de resource de texto%s%s%s%sProbablemente el archivo de texto esté corrompido." #: lazarusidestrconsts.lisunabletowrite msgid "Unable to write %s%s%s%s%s." @@ -12491,7 +12483,7 @@ msgstr "No se ha podido escribir %s%s%s%s%s" #: lazarusidestrconsts.lisunabletowrite2 msgid "Unable to write %s%s%s" -msgstr "" +msgstr "No es posible escribir %s%s%s" #: lazarusidestrconsts.lisunabletowritefile msgid "Unable to write file" @@ -12519,7 +12511,7 @@ msgstr "No se ha podido escribir el archivo %s%s%s" #: lazarusidestrconsts.lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" -msgstr "" +msgstr "No es posible escribir el stream xml en %s%sError: %s" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" @@ -12527,7 +12519,7 @@ msgstr "Desinstalar selección" #: lazarusidestrconsts.lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" -msgstr "" +msgstr "La Unidad %s%s%s ha cambiado. ¿Guardar?" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" @@ -12575,27 +12567,27 @@ msgstr "Unidades no encontradas" #: lazarusidestrconsts.lisunusedunits msgid "Unused units" -msgstr "" +msgstr "Unidades no usadas" #: lazarusidestrconsts.lisupdatepreview msgid "Update preview" -msgstr "" +msgstr "Actualizar vista previa" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" -msgstr "" +msgstr "¿Actualizar referencias?" #: lazarusidestrconsts.lisuppercasestring msgid "uppercase string" -msgstr "" +msgstr "Cadena a mayúsculas" #: lazarusidestrconsts.lisuppercasestringgivenasparameter msgid "Uppercase string given as parameter" -msgstr "" +msgstr "Cadena dada como parámetro a mayúsculas" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" -msgstr "" +msgstr "Mensaje de uso (opción -h)" #: lazarusidestrconsts.lisuseexcludefilter msgid "Use Exclude Filter" @@ -12611,27 +12603,27 @@ msgstr "Lanzador de aplicaciones" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" -msgstr "" +msgstr "Directorio (home) del usuario" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" -msgstr "" +msgstr "UTF-8 con BOM" #: lazarusidestrconsts.lisvalue msgid "Value:" -msgstr "" +msgstr "Valor:" #: lazarusidestrconsts.lisvalue2 msgid "Value%s" -msgstr "" +msgstr "Valor%s" #: lazarusidestrconsts.lisvalues msgid "Values" -msgstr "" +msgstr "Valores" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" -msgstr "" +msgstr "Verificar llamadas de método" #: lazarusidestrconsts.lisversion msgid "Version" @@ -12647,7 +12639,7 @@ msgstr "Copiar información de la versión al portapapeles" #: lazarusidestrconsts.lisviewbreakpointproperties msgid "View Breakpoint Properties" -msgstr "" +msgstr "Ver propiedades del Punto de Interrupción" #: lazarusidestrconsts.lisviewprojectunits msgid "View Project Units" @@ -12671,15 +12663,15 @@ msgstr "Advertencia: encontrado archivo ambiguo : %s%s%s. El archivo fuente es: #: lazarusidestrconsts.liswatch msgid "&Watch" -msgstr "" +msgstr "&Watch" #: lazarusidestrconsts.liswatchpropert msgid "Watch Properties" -msgstr "" +msgstr "Propiedades del Watch" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references ..." -msgstr "" +msgstr "Cuando una Unidad es renombrada, actualizar referencias ..." #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" @@ -12764,7 +12756,7 @@ msgstr "Editor de código fuente" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" -msgstr "" +msgstr "Añadir la Unidad del paquete a la sección Uses" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" @@ -12780,7 +12772,7 @@ msgstr "Incrementar automáticamente el número de construcción" #: lazarusidestrconsts.rsavailablescanners msgid "Available scanners" -msgstr "" +msgstr "Escáners disponibles" #: lazarusidestrconsts.rsbuild msgid "Build:" @@ -12792,7 +12784,7 @@ msgstr "Conjunto de caracteres:" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page" -msgstr "" +msgstr "Cerrar página actual" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" @@ -12808,15 +12800,15 @@ msgstr "Crear un nuevo define" #: lazarusidestrconsts.rscreatingdirfailed msgid "Creating directory \"%s\" failed!" -msgstr "" +msgstr "La creación del directorio \"%s\" ¡Ha fallado!" #: lazarusidestrconsts.rscreatingsymlinkfailed msgid "Creating symbolic link \"%s\" failed!" -msgstr "" +msgstr "La creación del enlace simbólico \"%s\" ¡Ha fallado!" #: lazarusidestrconsts.rscreatingsymlinknotsupported msgid "Creating symbolic link is not supported on this platform!" -msgstr "" +msgstr "La creación de enlaces simbólicos en ésta plataforma ¡No es soportada!" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" @@ -12824,11 +12816,11 @@ msgstr "Activar internacionalización" #: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma" -msgstr "" +msgstr "Introducir una o más frases que Usted deseé buscar o filtrar en la lista, separadas por espacio o coma" #: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression msgid "Filter the list with the current filter expression" -msgstr "" +msgstr "Filtrar la lista con la expresión de filtro actual" #: lazarusidestrconsts.rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" @@ -12836,11 +12828,11 @@ msgstr "Fichero de datos del formulario (*.dfm)|*.dfm" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found, but not listed here: " -msgstr "" +msgstr "Hallado, pero no listado aquí:" #: lazarusidestrconsts.rsgotothenextiteminthesearchlist msgid "Go to the next item in the search list" -msgstr "" +msgstr "Pasar al siguiente elemento en la lista de busqueda" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" @@ -12857,7 +12849,7 @@ msgstr "Posición personalizada" #: lazarusidestrconsts.rsiwpdefault msgctxt "lazarusidestrconsts.rsiwpdefault" msgid "Default" -msgstr "Por defecto" +msgstr "Preterminada" #: lazarusidestrconsts.rsiwpdocked msgid "Docked" @@ -12965,7 +12957,7 @@ msgstr "Castellano" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" -msgstr "" +msgstr "Turco" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" @@ -12981,7 +12973,7 @@ msgstr "Revisión menor:" #: lazarusidestrconsts.rsok msgid "ok" -msgstr "" +msgstr "Aceptar" #: lazarusidestrconsts.rsotherinfo msgid "Other info" @@ -12997,19 +12989,19 @@ msgstr "&Eliminar" #: lazarusidestrconsts.rsresetfilter msgid "Reset filter" -msgstr "" +msgstr "Restablecer filtro" #: lazarusidestrconsts.rsscanners msgid "Scanners" -msgstr "" +msgstr "Scáners" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" -msgstr "" +msgstr "Seleccionar un elemento heredado" #: lazarusidestrconsts.rsstartanewsearch msgid "Start a new search" -msgstr "" +msgstr "Comenzar una nueva busqueda" #: lazarusidestrconsts.rsversion msgid "Version:" @@ -13041,7 +13033,7 @@ msgstr "Comandos de CodeTools" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" -msgstr "" +msgstr "Comandos para selección de texto en modo columna" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" @@ -13061,7 +13053,7 @@ msgstr "Comandos del menú archivo" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" -msgstr "" +msgstr "Comandos para plegado de código" #: lazarusidestrconsts.srkmcatmarker msgid "Text marker commands" @@ -13069,7 +13061,7 @@ msgstr "Comandos de marcas de texto" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" -msgstr "" +msgstr "Comandos para el menu del Paquete" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" @@ -13093,23 +13085,23 @@ msgstr "Comandos de bloc de notas fuente" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" -msgstr "" +msgstr "Edición Sincrónizada" #: lazarusidestrconsts.srkmcatsyncroeditoff msgid "Syncron Editing (not in Cell)" -msgstr "" +msgstr "Edición Sincronizada (no en celda)" #: lazarusidestrconsts.srkmcatsyncroeditsel msgid "Syncron Editing (while selecting)" -msgstr "" +msgstr "Edición Sincronizada (Durante la selección)" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" -msgstr "" +msgstr "Edición de Plantilla" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" -msgstr "" +msgstr "Edición de Plantilla (no en celda)" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" @@ -13158,23 +13150,23 @@ msgstr "Completar plantilla de código" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" -msgstr "" +msgstr "Copiar Bloque" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" -msgstr "" +msgstr "Eliminar Bloque" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" -msgstr "" +msgstr "Ir al begin del bloque" #: lazarusidestrconsts.srkmecblockgotoend msgid "Goto Block end" -msgstr "" +msgstr "ir al end del bloque" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" -msgstr "" +msgstr "Esconder Bloque" #: lazarusidestrconsts.srkmecblockindent msgid "Indent block" @@ -13182,23 +13174,23 @@ msgstr "Sangrar bloque" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" -msgstr "" +msgstr "Mover Bloque" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" -msgstr "" +msgstr "Establecer inicio de bloque" #: lazarusidestrconsts.srkmecblocksetend msgid "Set block end" -msgstr "" +msgstr "Establecer final de bloque" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" -msgstr "" +msgstr "Mostra Bloque" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" -msgstr "" +msgstr "Intercabiar Bloque" #: lazarusidestrconsts.srkmecblockunindent msgid "Unindent block" @@ -13238,59 +13230,59 @@ msgstr "Opciones de CodeTools" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" -msgstr "" +msgstr "Selección de Columna Abajo" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" -msgstr "" +msgstr "Selección de Columna a final absoluto" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" -msgstr "" +msgstr "Selección de Columna a comienzo absoluto" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" -msgstr "" +msgstr "Selección de Columna izquierda" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" -msgstr "" +msgstr "Selección de Columna Fin de Línea" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" -msgstr "" +msgstr "Selección de Columna Inicio de Línea" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" -msgstr "" +msgstr "Selección de Columna inferior de página" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" -msgstr "" +msgstr "Selección de Columna página abajo" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" -msgstr "" +msgstr "Selección de Columna página arriba" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" -msgstr "" +msgstr "Selección de Columna página arriba" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" -msgstr "" +msgstr "Selección de Columna derecha" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" -msgstr "" +msgstr "Selección de Columna arriba" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" -msgstr "" +msgstr "Selección de Columna Palabra Izquierda" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" -msgstr "" +msgstr "Selección de Columna Palabra Derecha" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" @@ -13363,7 +13355,7 @@ msgstr "Mover cursor al principio absoluto" #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" -msgstr "" +msgstr "Opciones del IDE" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" @@ -13415,7 +13407,7 @@ msgstr "Buscar próxima coincidencia de palabra" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find overloads" -msgstr "" +msgstr "Encontrar recargadas" #: lazarusidestrconsts.srkmecfindprevious msgid "Find previous" @@ -13435,11 +13427,11 @@ msgstr "Buscar método de procedimiento" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" -msgstr "" +msgstr "Plegar en cursor" #: lazarusidestrconsts.srkmecfoldlevel msgid "Fold to Level %d" -msgstr "" +msgstr "Plegar al nivel %d" #: lazarusidestrconsts.srkmecgotoeditor msgid "Go to editor %d" @@ -13591,7 +13583,7 @@ msgstr "Mover ventana del editor al último" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" -msgstr "Siguiente marcador" +msgstr "Siguiente Apartador" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" @@ -13643,7 +13635,7 @@ msgstr "pausar programa" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" -msgstr "Anterior marcador" +msgstr "Apartador Anterior" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" @@ -13663,11 +13655,11 @@ msgstr "quitar punto de ruptura" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove empty methods" -msgstr "" +msgstr "Eliminar métodos vacios" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove unused units" -msgstr "" +msgstr "Eliminar Unidades vacias" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename identifier" @@ -13789,7 +13781,7 @@ msgstr "Seleccionar palabra derecha" #: lazarusidestrconsts.srkmecsetfreebookmark msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" msgid "Set a free Bookmark" -msgstr "" +msgstr "Establecer un Apartador libre" #: lazarusidestrconsts.srkmecsetmarker msgid "Set Marker %d" @@ -13814,96 +13806,96 @@ msgstr "Parar programa" #: lazarusidestrconsts.srkmecsynpsyncroedcellend msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" msgid "Goto last pos in cell" -msgstr "" +msgstr "Ir a la ultima posición en celda" #: lazarusidestrconsts.srkmecsynpsyncroedcellhome msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" msgid "Goto first pos in cell" -msgstr "" +msgstr "Ir a la primer posición en celda" #: lazarusidestrconsts.srkmecsynpsyncroedcellselect msgid "Select Cell" -msgstr "" +msgstr "Seleccinar celda" #: lazarusidestrconsts.srkmecsynpsyncroedescape msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" msgid "Escape" -msgstr "" +msgstr "Escape" #: lazarusidestrconsts.srkmecsynpsyncroednextcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" msgid "Next Cell" -msgstr "" +msgstr "Celda Siguiente" #: lazarusidestrconsts.srkmecsynpsyncroednextcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" msgid "Next Cell (all selected)" -msgstr "" +msgstr "Celda Siguiente (Seleccionar todo)" #: lazarusidestrconsts.srkmecsynpsyncroedprevcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" msgid "Previous Cell" -msgstr "" +msgstr "Celda Anterior" #: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" msgid "Previous Cell (all selected)" -msgstr "" +msgstr "Celda Anterior (Seleccionar Todo)" #: lazarusidestrconsts.srkmecsynpsyncroedstart msgid "Start Syncro edit" -msgstr "" +msgstr "Iniciar Edición Sincronizada" #: lazarusidestrconsts.srkmecsynptmpledcellend msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" msgid "Goto last pos in cell" -msgstr "" +msgstr "Ir a la última posición en la celda" #: lazarusidestrconsts.srkmecsynptmpledcellhome msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" msgid "Goto first pos in cell" -msgstr "" +msgstr "Ir a la primera posición en la celda" #: lazarusidestrconsts.srkmecsynptmpledcellselect msgid "Select cell" -msgstr "" +msgstr "Seleccionar Celda" #: lazarusidestrconsts.srkmecsynptmpledescape msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" msgid "Escape" -msgstr "" +msgstr "Escape" #: lazarusidestrconsts.srkmecsynptmpledfinish msgid "Finish" -msgstr "" +msgstr "Terminar" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" -msgstr "" +msgstr "Celda Siguiente" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" -msgstr "" +msgstr "Celda Siguiente (rotar)" #: lazarusidestrconsts.srkmecsynptmplednextcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" msgid "Next Cell (all selected)" -msgstr "" +msgstr "Celda Siguiente (todo seleccionado)" #: lazarusidestrconsts.srkmecsynptmplednextcellselrotate msgid "Next Cell (rotate / all selected)" -msgstr "" +msgstr "Celda Siguiente (rotar/todo seleccionado)" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" -msgstr "" +msgstr "Celda Anterior" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" msgid "Previous Cell (all selected)" -msgstr "" +msgstr "Celda Anterior (todo seleccionado)" #: lazarusidestrconsts.srkmecsyntaxcheck msgid "Syntax check" @@ -13911,7 +13903,7 @@ msgstr "Verificar sintaxis" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle break point" -msgstr "" +msgstr "Intercambiar Punto de Interrupción" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" @@ -13948,7 +13940,7 @@ msgstr "Ver editor de documentación" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" msgid "View IDE speed buttons" -msgstr "Ver accesos rápidos del IDE" +msgstr "Ver botones del IDE" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" @@ -13956,11 +13948,11 @@ msgstr "Ver variables locales" #: lazarusidestrconsts.srkmectogglemarker msgid "Toggle Marker %d" -msgstr "" +msgstr "Intercambiar Marcador %d" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" -msgstr "" +msgstr "Intercambiar Resaltado de Palabra-Actual" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" @@ -13976,7 +13968,7 @@ msgstr "Ver Inspector de Objetos" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" -msgstr "" +msgstr "Ver Explorador de Restricciones" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" @@ -13992,11 +13984,11 @@ msgstr "Ver vigilantes" #: lazarusidestrconsts.srkmecunfoldall msgid "Unfold all" -msgstr "" +msgstr "Desplegar Todo" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" -msgstr "" +msgstr "Desplegar en Cursor" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" @@ -14020,7 +14012,7 @@ msgstr "Ver formularios" #: lazarusidestrconsts.srkmecviewtodolist msgid "View todo list" -msgstr "" +msgstr "Ver lista de Por-Hacer" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" @@ -14048,7 +14040,7 @@ msgstr "Mover cursor una palabra a la derecha" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" -msgstr "" +msgstr "Editar teclas de comando" #: lazarusidestrconsts.srkmeditkeys msgid "Edit Keys" @@ -14088,11 +14080,11 @@ msgstr "Añadir punto de observación en cursor" #: lazarusidestrconsts.uembookmarkn msgid "Bookmark" -msgstr "Marcador" +msgstr "Apartador" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" -msgstr "" +msgstr "Cerrar todas las &Otras páginas" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" @@ -14134,7 +14126,7 @@ msgstr "Encerrar Selección" #: lazarusidestrconsts.uemencoding msgid "Encoding" -msgstr "" +msgstr "Codificación" #: lazarusidestrconsts.uemextractproc msgctxt "lazarusidestrconsts.uemextractproc" @@ -14151,7 +14143,7 @@ msgstr "Buscar Referencias a Identificador" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" -msgstr "&Ir a Marcador" +msgstr "&Ir al Apartador" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" @@ -14167,23 +14159,23 @@ msgstr "Invertir tarea" #: lazarusidestrconsts.uemmovepageleft msgid "Move page left" -msgstr "" +msgstr "Mover página a la izquierda" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move page leftmost" -msgstr "" +msgstr "Mover página hacia la extrema izquierda" #: lazarusidestrconsts.uemmovepageright msgid "Move page right" -msgstr "" +msgstr "Mover pagina a la derecha" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move page rightmost" -msgstr "" +msgstr "Mover pagina hacia la extrema derecha" #: lazarusidestrconsts.uemnextbookmark msgid "Goto next Bookmark" -msgstr "Ir al próximo marcador" +msgstr "Ir al próximo Apartador" #: lazarusidestrconsts.uemodified msgid "Modified" @@ -14200,7 +14192,7 @@ msgstr "Pegar" #: lazarusidestrconsts.uemprevbookmark msgid "Goto previous Bookmark" -msgstr "Ir al anterior marcador" +msgstr "Ir al Apartador anterior" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" @@ -14224,12 +14216,12 @@ msgstr "&Ejecutar desde Cursor" #: lazarusidestrconsts.uemsetbookmark msgid "&Set Bookmark" -msgstr "&Seleccionar Marcador" +msgstr "&Seleccionar Apartador" #: lazarusidestrconsts.uemsetfreebookmark msgctxt "lazarusidestrconsts.uemsetfreebookmark" msgid "Set a free Bookmark" -msgstr "Establecer un marcador libre" +msgstr "Establecer un Apartador libre" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" @@ -14241,11 +14233,11 @@ msgstr "Información de la unidad" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" -msgstr "" +msgstr "&Intercambiar Apartador" #: lazarusidestrconsts.uemtogglebreakpoint msgid "&Toggle Breakpoint" -msgstr "" +msgstr "&Revertir Punto de Interrupción" #: lazarusidestrconsts.uemviewcallstack msgid "View Call Stack"