diff --git a/.gitattributes b/.gitattributes
index 82a9f9b64c..f2b731b6e2 100644
--- a/.gitattributes
+++ b/.gitattributes
@@ -88,6 +88,7 @@ components/codetools/languages/codetools.es.po svneol=native#text/plain
 components/codetools/languages/codetools.esutf.po svneol=native#text/plain
 components/codetools/languages/codetools.fi.po svneol=native#text/plain
 components/codetools/languages/codetools.fr.po svneol=native#text/plain
+components/codetools/languages/codetools.id.po svneol=native#text/plain
 components/codetools/languages/codetools.it.po svneol=native#text/plain
 components/codetools/languages/codetools.pl.po svneol=native#text/plain
 components/codetools/languages/codetools.pliso.po svneol=native#text/plain
@@ -397,6 +398,7 @@ components/synedit/languages/synedit.ca.po svneol=native#text/plain
 components/synedit/languages/synedit.de.po svneol=native#text/plain
 components/synedit/languages/synedit.fi.po svneol=native#text/plain
 components/synedit/languages/synedit.fr.po svneol=native#text/plain
+components/synedit/languages/synedit.id.po svneol=native#text/plain
 components/synedit/languages/synedit.it.po svneol=native#text/plain
 components/synedit/languages/synedit.pl.po svneol=native#text/plain
 components/synedit/languages/synedit.pliso.po svneol=native#text/plain
@@ -407,6 +409,7 @@ components/synedit/languages/synedit.ua.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.ca.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.de.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.fr.po svneol=native#text/plain
+components/synedit/languages/synmacrorecorder.id.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.it.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.pl.po svneol=native#text/plain
 components/synedit/languages/synmacrorecorder.pliso.po svneol=native#text/plain
@@ -1793,6 +1796,7 @@ languages/lazaruside.es.po svneol=native#text/plain
 languages/lazaruside.fi.po svneol=native#text/plain
 languages/lazaruside.fr.po svneol=native#text/plain
 languages/lazaruside.he.po svneol=native#text/plain
+languages/lazaruside.id.po svneol=native#text/plain
 languages/lazaruside.it.po svneol=native#text/plain
 languages/lazaruside.ja.po svneol=native#text/plain
 languages/lazaruside.nl.po svneol=native#text/plain
@@ -1809,6 +1813,7 @@ languages/objinspstrconsts.de.po svneol=native#text/plain
 languages/objinspstrconsts.es.po svneol=native#text/plain
 languages/objinspstrconsts.fi.po svneol=native#text/plain
 languages/objinspstrconsts.fr.po svneol=native#text/plain
+languages/objinspstrconsts.id.po svneol=native#text/plain
 languages/objinspstrconsts.it.po svneol=native#text/plain
 languages/objinspstrconsts.ja.po svneol=native#text/plain
 languages/objinspstrconsts.nl.po svneol=native#text/plain
@@ -2319,6 +2324,7 @@ lcl/languages/lcl.de.po svneol=native#text/plain
 lcl/languages/lcl.es.po svneol=native#text/plain
 lcl/languages/lcl.fi.po svneol=native#text/plain
 lcl/languages/lcl.fr.po svneol=native#text/plain
+lcl/languages/lcl.id.po svneol=native#text/plain
 lcl/languages/lcl.it.po svneol=native#text/plain
 lcl/languages/lcl.nl.po svneol=native#text/plain
 lcl/languages/lcl.pb.po svneol=native#text/plain
diff --git a/components/codetools/languages/codetools.id.po b/components/codetools/languages/codetools.id.po
new file mode 100644
index 0000000000..a867237d2b
--- /dev/null
+++ b/components/codetools/languages/codetools.id.po
@@ -0,0 +1,762 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus Code Tools v1.x\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-03 02:29+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Zaenal Mutaqin <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: codetoolsstrconsts:ctsunknownsubdescriptor
+msgid "(unknown subdescriptor %s)"
+msgstr "(subdeskriptor tidak dikenal %s)"
+
+#: codetoolsstrconsts:ctsforward
+msgid "Forward"
+msgstr "Maju"
+
+#: codetoolsstrconsts:ctsunparsed
+msgid "Unparsed"
+msgstr "Tidak dipindai"
+
+#: codetoolsstrconsts:ctsinvalidflagvaluefordirective
+msgid "invalid flag value \"%s\" for directive %s"
+msgstr "Nilai tanda tidak benar \"%s\" untuk direktif %s"
+
+#: codetoolsstrconsts:ctsinvalidmode
+msgid "invalid mode \"%s\""
+msgstr "Mode tidak benar \"%s\""
+
+#: codetoolsstrconsts:ctsawithoutb
+msgid "%s without %s"
+msgstr "%s tanpa %s"
+
+#: codetoolsstrconsts:ctsincludefilenotfound
+msgid "include file not found \"%s\""
+msgstr "file include tidak ditemukan \"%s\""
+
+#: codetoolsstrconsts:ctserrorindirectiveexpression
+msgid "error in directive expression"
+msgstr "Kesalahan dalam ekspresi direktif"
+
+#: codetoolsstrconsts:ctsincludecircledetected
+msgid "Include circle detected"
+msgstr "Lingkaran Include terdeteksi"
+
+#: codetoolsstrconsts:ctsfileisreadonly
+msgid "file is read only"
+msgstr "file hanya baca"
+
+#: codetoolsstrconsts:ctscommentendnotfound
+msgid "Comment end not found"
+msgstr "Akhir komentar tidak ditemukan"
+
+#: codetoolsstrconsts:ctsidentexpectedbutatomfound
+msgid "identifier expected, but %s found"
+msgstr "pengenal diharapkan, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsidentexpectedbutkeywordfound
+msgid "identifier expected, but keyword %s found"
+msgstr "pengenal diharapkan, tapi keyword %s ditemukan"
+
+#: codetoolsstrconsts:ctsstrexpectedbutatomfound
+msgid "%s expected, but %s found"
+msgstr "%s diharapkan, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctspositionnotinsource
+msgid "Position not in source"
+msgstr "Posisi tidak dalam sumber"
+
+#: codetoolsstrconsts:ctsinvalidclassname
+msgid "invalid class name=%s%s%s"
+msgstr "nama kelas tidak benar=%s%s%s"
+
+#: codetoolsstrconsts:ctsclassnotfound
+msgid "class %s%s%s not found"
+msgstr "kelas %s%s%s tidak ditemukan"
+
+#: codetoolsstrconsts:ctsinvalidclassname2
+msgid "invalid class name %s%s%s"
+msgstr "nama kelas tidak benar %s%s%s"
+
+#: codetoolsstrconsts:ctsinvalidvariablename
+msgid "invalid variable name %s%s%s"
+msgstr "nama variabel tidak benar %s%s%s"
+
+#: codetoolsstrconsts:ctsinvalidvariabletype
+msgid "invalid variable type %s%s%s"
+msgstr "tipe variabel tidak benar %s%s%s"
+
+#: codetoolsstrconsts:ctsclasssnotfound
+msgid "Class %s not found"
+msgstr "Kelas %s%s%s tidak ditemukan"
+
+#: codetoolsstrconsts:ctsidentexpectedbuteoffound
+msgid "unexpected end of file (identifier expected)"
+msgstr "akhir file tidak diharapkan (pengenal diharapkan)"
+
+#: codetoolsstrconsts:ctsbracketopenexpectedbutatomfound
+msgid "bracket open expected, but %s found"
+msgstr "kurung buka diharapkan, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsbracketcloseexpectedbutatomfound
+msgid "bracket close expected, but %s found"
+msgstr "kurung tutup diharapkan, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsbracketnotfound
+msgid "bracket %s not found"
+msgstr "kurung %s tidak ditemukan"
+
+#: codetoolsstrconsts:ctsnonodefoundatcursor
+msgid "no pascal node found at cursor (i.e. in unparsed code)"
+msgstr "tidak ada kode pascal ditemukan pada kursor (contoh. dalam kode yang tidak dipindai)"
+
+#: codetoolsstrconsts:ctsunknownmainfilename
+msgid "(unknown mainfilename)"
+msgstr "(nama file utama tidak dikenal)"
+
+#: codetoolsstrconsts:ctsunexpectedkeyword
+msgid "unexpected keyword \"%s\""
+msgstr "keyword tidak diharapkan \"%s\""
+
+#: codetoolsstrconsts:ctsnopascalcodefound
+msgid "no pascal code found (first token is %s)"
+msgstr "Tidak ada kode pascal ditemukan (token pertama adalah %s)"
+
+#: codetoolsstrconsts:ctsstringconstant
+msgid "string constant"
+msgstr "konstan string"
+
+#: codetoolsstrconsts:ctsanoymdefinitionsarenotallowed
+msgid "Anonymous %s definitions are not allowed"
+msgstr "Definisi anonim %s tidak dibolehkan"
+
+#: codetoolsstrconsts:ctsendforrecordnotfound
+msgid "end for record not found"
+msgstr "akhir untuk record tidak ditemukan"
+
+#: codetoolsstrconsts:ctsmissingenumlist
+msgid "missing enum list"
+msgstr "daftar enum tidak ada"
+
+#: codetoolsstrconsts:ctsmissingtypeidentifier
+msgid "missing type identifier"
+msgstr "pengenal type tidak ada"
+
+#: codetoolsstrconsts:ctsprocedureorfunction
+msgid "procedure or function"
+msgstr "function atau procedure"
+
+#: codetoolsstrconsts:ctsmethodname
+msgid "method name"
+msgstr "nama method"
+
+#: codetoolsstrconsts:ctsidentifier
+msgid "identifier"
+msgstr "pengenal"
+
+#: codetoolsstrconsts:ctssemicolonnotfound
+msgid "semicolon not found"
+msgstr "titik koma tidak ditemukan"
+
+#: codetoolsstrconsts:ctskeyword
+msgid "keyword"
+msgstr "keyword"
+
+#: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound
+msgid "keyword (e.g. %s) expected, but %s found"
+msgstr "keyword (contoh. %s) diharapkan, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsconstant
+msgid "constant"
+msgstr "konstan"
+
+#: codetoolsstrconsts:ctssemicolonafterpropspecmissing
+msgid "; expected after \"%s\" property specifier, but %s found"
+msgstr "; diharapkan setelah \"%s\" pemisah properti, tetapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsunknownsectionkeyword
+msgid "unknown section keyword %s found"
+msgstr "bagian keyword %s yang ditemukan tidak dikenal"
+
+#: codetoolsstrconsts:ctsillegalqualifier
+msgid "illegal qualifier %s found"
+msgstr "pembatas %s yang ditemukan tidak benar"
+
+#: codetoolsstrconsts:ctsunexpectedendofsource
+msgid "unexpected end of source"
+msgstr "akhir sumber tidak diharapkan"
+
+#: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound
+msgid "expected end., but %s found"
+msgstr "diharapkan end, tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctspointstartat
+msgid ". start at "
+msgstr ". mulai di"
+
+#: codetoolsstrconsts:ctsunexpectedkeywordinasmblock
+msgid "unexpected keyword \"%s\" in asm block found"
+msgstr "keyword \"%s\" yang tidak diharapkan dalam blok asm ditemukan"
+
+#: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock
+msgid "unexpected keyword \"%s\" in begin..end found"
+msgstr "keyword \"%s\" yang tidak diharapkan dalam begin..end ditemukan"
+
+#: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards
+msgid "unexpected keyword \"%s\" found while reading blocks backwards"
+msgstr "keyword \"%s\" yang tidak diharapkan ditemukan saat pembacaan blok mundur"
+
+#: codetoolsstrconsts:ctswordnotfound
+msgid "\"%s\" not found"
+msgstr "\"%s\" tidak ditemukan"
+
+#: codetoolsstrconsts:ctspointhintprocstartat
+msgid ".  Hint: proc start at "
+msgstr ".  Petunjuk: proc mulai di "
+
+#: codetoolsstrconsts:ctsmissingpointafterend
+msgid "missing . after end"
+msgstr "kurang . setelah end"
+
+#: codetoolsstrconsts:ctsendforclassnotfound
+msgid "\"end\" for class/object not found"
+msgstr "\"end\" untuk class/object tidak ditemukan"
+
+#: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound
+msgid "unexpected subrange operator '..' found"
+msgstr "operator sub jangkauan  '..' yang tidak diharapkan ditemukan"
+
+#: codetoolsstrconsts:ctsinvalidsubrange
+msgid "invalid subrange"
+msgstr "sub jangkauan tidak benar"
+
+#: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries
+msgid "exports clause only allowed in libraries"
+msgstr "klausul ekspor hanya dibolehkan dalam librari"
+
+#: codetoolsstrconsts:ctsunitnotfound
+msgid "unit not found: %s"
+msgstr "unit tidak ditemukan: %s"
+
+#: codetoolsstrconsts:ctssourcenotfoundunit
+msgid "source not found: unit %s"
+msgstr "sumber tidak ditemukan: unit %s"
+
+#: codetoolsstrconsts:ctsidentifiernotfound
+msgid "identifier not found: %s"
+msgstr "pengenal tidak ditemukan: %s"
+
+#: codetoolsstrconsts:ctsnocontextnodefoundatcursor
+msgid "no context node found at cursor"
+msgstr "tidak ada node konteks ditemukan pada kursor"
+
+#: codetoolsstrconsts:ctsinheritedkeywordonlyallowedinmethods
+msgid "inherited keyword only allowed in methods"
+msgstr "keyword yang diturunkan hanya dibolehkan dalam method"
+
+#: codetoolsstrconsts:ctscircleindefinitions
+msgid "circle in definitions"
+msgstr "lingkaran dalam definisi"
+
+#: codetoolsstrconsts:ctsforwardclassdefinitionnotresolved
+msgid "Forward class definition not resolved: %s"
+msgstr "Definisi forward class tidak terpecahkan: %s"
+
+#: codetoolsstrconsts:ctsclassofdefinitionnotresolved
+msgid "\"class of\" definition not resolved: %s"
+msgstr "definisi \"class of\" tidak terpecahkan: %s"
+
+#: codetoolsstrconsts:ctstypeidentifier
+msgid "type identifier"
+msgstr "pengenal type"
+
+#: codetoolsstrconsts:ctsancestorisnotproperty
+msgid "ancestor of untyped property is not a property"
+msgstr "karuhun dari properti untyped bukan properti"
+
+#: codetoolsstrconsts:ctsbasetypeofnotfound
+msgid "base type of \"%s\" not found"
+msgstr "dasar type dari \"%s\" tidak ditemukan"
+
+#: codetoolsstrconsts:ctsclassidentifierexpected
+msgid "class identifier expected"
+msgstr "pengenal class diharapkan"
+
+#: codetoolsstrconsts:ctsdefaultclassancestortobjectnotfound
+msgid "default class ancestor TObject not found"
+msgstr "karuhun class default TObject tidak ditemukan"
+
+#: codetoolsstrconsts:ctsdefaultinterfaceancestoriinterfacenotfound
+msgid "default interface ancestor IInterface not found"
+msgstr "karuhun interface default IInterface tidak ditemukan"
+
+#: codetoolsstrconsts:ctsexprtypemustbeclassorrecord
+msgid "expression type must be class or record type"
+msgstr "tipe ekspresi harus tipe class atau record"
+
+#: codetoolsstrconsts:ctsclasswithoutname
+msgid "class without name"
+msgstr "class tanpa nama"
+
+#: codetoolsstrconsts:ctsbinaryoperator
+msgid "binary operator"
+msgstr "operator biner"
+
+#: codetoolsstrconsts:ctsinvalidtype
+msgid "invalid type"
+msgstr "tipe tidak benar"
+
+#: codetoolsstrconsts:ctskeywordin
+msgid "keyword \"in\""
+msgstr "keyword \"in\""
+
+#: codetoolsstrconsts:ctsillegalcircleinusedunits
+msgid "illegal circle using unit: %s"
+msgstr "lingkaran tidak benar menggunakan unit: %s"
+
+#: codetoolsstrconsts:ctssourceisnotunit
+msgid "source is not unit"
+msgstr "sumber bukan unit"
+
+#: codetoolsstrconsts:ctsinterfacesectionnotfound
+msgid "interface section not found"
+msgstr "bagian interface tidak ditemukan"
+
+#: codetoolsstrconsts:ctsusedunitisnotapascalunit
+msgid "used unit is not a pascal unit"
+msgstr "unit yang digunakan bukan unit pascal"
+
+#: codetoolsstrconsts:ctsduplicateidentifier
+msgid "duplicate identifier: %s"
+msgstr "duplikasi pengenal: %s"
+
+#: codetoolsstrconsts:ctsqualifierexpectedbutatomfound
+msgid "qualifier expected but %s found"
+msgstr "pembatas diharapkan tapi %s ditemukan"
+
+#: codetoolsstrconsts:ctsincompatibletypesgotexpected
+msgid "incompatibles types: expected \"%s\" but got \"%s\""
+msgstr "tipe tidak sama: diharapkan \"%s\" tapi didapat \"%s\""
+
+#: codetoolsstrconsts:ctsdefaultpropertynotfound
+msgid "default property not found"
+msgstr "properti default tidak ditemukan"
+
+#: codetoolsstrconsts:ctspropertyspecifieralreadydefined
+msgid "property specifier already defined: %s"
+msgstr "pemisah properti sudah didefinisikan: %s"
+
+#: codetoolsstrconsts:ctserrorinparamlist
+msgid "error in paramlist"
+msgstr "kesalahan dalam paramlist"
+
+#: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound
+msgid "property type expected, but %s found"
+msgstr "properti type diharapkan, tapi %s yang ditemukan"
+
+#: codetoolsstrconsts:ctsindexspecifierredefined
+msgid "index specifier redefined"
+msgstr "pemisah indeks didefinisikan ulang"
+
+#: codetoolsstrconsts:ctsindexparameterexpectedbutatomfound
+msgid "index parameter expected, but %s found"
+msgstr "parameter indeks diharapkan, tapi %s yang ditemukan"
+
+#: codetoolsstrconsts:ctsdefaultspecifierredefined
+msgid "default specifier redefined"
+msgstr "pemisah default didefinisikan ulang"
+
+#: codetoolsstrconsts:ctsdefaultparameterexpectedbutatomfound
+msgid "default parameter expected, but %s found"
+msgstr "parameter default diharapkan, tapi %s yang ditemukan"
+
+#: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice
+msgid "nodefault specifier defined twice"
+msgstr "pemisah non default didefinisikan dua kali"
+
+#: codetoolsstrconsts:ctsimplementationnodenotfound
+msgid "implementation node not found"
+msgstr "node implementation tidak ditemukan"
+
+#: codetoolsstrconsts:ctsclassnodewithoutparentnode
+msgid "class node without parent node"
+msgstr "node class tanpa node parent"
+
+#: codetoolsstrconsts:ctstypesectionofclassnotfound
+msgid "type section of class not found"
+msgstr "bagian type dari class tidak ditemukan"
+
+#: codetoolsstrconsts:ctsunabletocompleteproperty
+msgid "unable to complete property"
+msgstr "tidak bisa menyempurnakan properti"
+
+#: codetoolsstrconsts:ctserrorduringinsertingnewclassparts
+msgid "error during inserting new class parts"
+msgstr "kesalahan selama penyisipan bagian class"
+
+#: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies
+msgid "error during creation of new proc bodies"
+msgstr "kesalahan selama pembuatan dari badan proc baru"
+
+#: codetoolsstrconsts:ctsunabletoapplychanges
+msgid "unable to apply changes"
+msgstr "tidak bisa menerapkan perubahan"
+
+#: codetoolsstrconsts:ctsendofsourcenotfound
+msgid "End of source not found"
+msgstr "Akhir dari sumber tidak ditemukan"
+
+#: codetoolsstrconsts:ctscursorposoutsideofcode
+msgid "cursor pos outside of code"
+msgstr "posisi kursor diluar kode"
+
+#: codetoolsstrconsts:ctsnewprocbodynotfound
+msgid "new proc body not found"
+msgstr "badan proc baru tidak ditemukan"
+
+#: codetoolsstrconsts:ctsidentifieralreadydefined
+msgid "Identifier %s already defined"
+msgstr "Pengenal %s sudah didefinisikan"
+
+#: codetoolsstrconsts:ctstermnotsimple
+msgid "Term has no simple type"
+msgstr "Term tidak mempunyai tipe sederhana"
+
+#: codetoolsstrconsts:ctsnoscannerfound
+msgid "No scanner found for \"%s\". If this is an include file, please open the main source first."
+msgstr "Tidak ada pemindai ditemukan untuk \"%s\". Jika ini adalah file include, silahkan buka sumber utama lebih dulu."
+
+#: codetoolsstrconsts:ctsnoscanneravailable
+msgid "No scanner available"
+msgstr "Tidak ada pemindai yang tersedia"
+
+#: codetoolsstrconsts:ctsunknownfunction
+msgid "Unknown function %s"
+msgstr "Fungsi tidak dikenal %s"
+
+#: codetoolsstrconsts:ctssyntaxerrorinexpr
+msgid "Syntax Error in expression \"%s\""
+msgstr "Kesalahan sintaks dalam ekspresi \"%s\""
+
+#: codetoolsstrconsts:ctsdefaultppc386symbol
+msgid "Default ppc386 symbol"
+msgstr "Simbol ppc386 default"
+
+#: codetoolsstrconsts:ctsdefaultppc386targetoperatingsystem
+msgid "Default ppc386 target Operating System"
+msgstr "Target default Sistem Operasi ppc386"
+
+#: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem
+msgid "Default ppc386 source Operating System"
+msgstr "Sumber default Sistem Operasi ppc386"
+
+#: codetoolsstrconsts:ctsdefaultppc386source2operatingsystem
+msgid "Default ppc386 source Operating System 2"
+msgstr "Sumber default Sistem Operasi 2 ppc386"
+
+#: codetoolsstrconsts:ctsdefaultppc386targetprocessor
+msgid "Default ppc386 target processor"
+msgstr "Target prosesor default ppc386"
+
+#: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros
+msgid "Free Pascal Compiler initial macros"
+msgstr "Makro awal Kompilator Free Pascal"
+
+#: codetoolsstrconsts:ctsfreepascalsourcesplusdesc
+msgid "Free Pascal Sources, %s"
+msgstr "Sumber Free Pascal, %s"
+
+#: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits
+msgid "Source filenames for the standard fpc units"
+msgstr "Nama file sumber untuk unit fpc standar"
+
+#: codetoolsstrconsts:ctsfreepascalsourcedir
+msgid "Free Pascal Source Directory"
+msgstr "Direktori Sumber Free Pascal"
+
+#: codetoolsstrconsts:ctssrcpathinitialization
+msgid "SrcPath Initialization"
+msgstr "Inisialisasi SrcPath"
+
+#: codetoolsstrconsts:ctsunitpathinitialization
+msgid "UnitPath Initialization"
+msgstr "Inisialisasi UnitPath"
+
+#: codetoolsstrconsts:ctsnestedcommentson
+msgid "Nested Comments On"
+msgstr "Komentar Berulang On"
+
+#: codetoolsstrconsts:ctsfpdocsystemon
+msgid "enable FPDocSystem"
+msgstr "hidupkan FPDocSystem"
+
+#: codetoolsstrconsts:ctscompiler
+msgid "Compiler"
+msgstr "Kompilator"
+
+#: codetoolsstrconsts:ctsdefineprocessortype
+msgid "Define processor type"
+msgstr "Definisikan tipe prosesor"
+
+#: codetoolsstrconsts:ctsruntimelibrary
+msgid "Runtime library"
+msgstr "Librari Runtime"
+
+#: codetoolsstrconsts:ctsprocessorspecific
+msgid "processor specific"
+msgstr "spesifik prosesor"
+
+#: codetoolsstrconsts:ctsfreepascalcomponentlibrary
+msgid "Free Pascal Component Library"
+msgstr "Librari Komponen Free Pascal"
+
+#: codetoolsstrconsts:ctsincludedirectoriesplusdirs
+msgid "include directories: %s"
+msgstr "direktori include: %s"
+
+#: codetoolsstrconsts:ctspackagedirectories
+msgid "Package directories"
+msgstr "Direktori Paket"
+
+#: codetoolsstrconsts:ctsutilsdirectories
+msgid "Utils directories"
+msgstr "Direktori Utils"
+
+#: codetoolsstrconsts:ctsiftargetosisnotsrcos
+msgid "If TargetOS<>SrcOS"
+msgstr "Jika TargetOS<>SrcOS"
+
+#: codetoolsstrconsts:ctsiftargetosisnotsrcos2
+msgid "If TargetOS<>SrcOS2"
+msgstr "Jika TargetOS<>SrcOS"
+
+#: codetoolsstrconsts:ctsinstallerdirectories
+msgid "Installer directories"
+msgstr "Direktori Instalator"
+
+#: codetoolsstrconsts:ctsdefsforlazarussources
+msgid "Definitions for the Lazarus Sources"
+msgstr "Definisi untuk Sumber Lazarus"
+
+#: codetoolsstrconsts:ctsaddsdirtosourcepath
+msgid "adds %s to SrcPath"
+msgstr "tambahkan %s ke SrcPath"
+
+#: codetoolsstrconsts:ctssetsincpathto
+msgid "sets IncPath to %s"
+msgstr "set IncPath ke %s"
+
+#: codetoolsstrconsts:ctssetssrcpathto
+msgid "sets SrcPath to %s"
+msgstr "set SrcPath ke %s"
+
+#: codetoolsstrconsts:ctsnameddirectory
+msgid "%s Directory"
+msgstr " Direktori %s"
+
+#: codetoolsstrconsts:ctswidgetdirectory
+msgid "Widget Directory"
+msgstr "Direktori Widget"
+
+#: codetoolsstrconsts:ctsintfdirectory
+msgid "interface directory"
+msgstr "direktori interface"
+
+#: codetoolsstrconsts:ctsiflclwidgettypeequalsgtk2
+msgid "If LCLWidgetType=gtk2 then"
+msgstr "Jika LCLWidgetType=gtk2 lalu"
+
+#: codetoolsstrconsts:ctselse
+msgid "else"
+msgstr "else"
+
+#: codetoolsstrconsts:ctsiftargetosisnotwin32
+msgid "If TargetOS<>win32 then"
+msgstr "Jika TargetOS<>win32 lalu"
+
+#: codetoolsstrconsts:ctsiflclwidgettypeequalsgnome2
+msgid "If LCLWidgetType=gnome2 then"
+msgstr "Jika LCLWidgetType=gnome2 lalu"
+
+#: codetoolsstrconsts:ctsdefinemacrogtk1
+msgid "Define macro gtk1"
+msgstr "Definisikan makro gtk1"
+
+#: codetoolsstrconsts:ctsdefinemacrogtk2
+msgid "Define macro gtk2"
+msgstr "Definisikan makro gtk2"
+
+#: codetoolsstrconsts:ctsdefinemacrognome2
+msgid "Define macro gnome2"
+msgstr "Definisikan makro gnome2"
+
+#: codetoolsstrconsts:ctsdefinemacrocarbon1
+msgid "Define macro carbon1"
+msgstr "Definisikan makro carbon1"
+
+#: codetoolsstrconsts:ctsdefinemacroqt1
+msgid "Define macro qt1"
+msgstr "Definisikan makro qt1"
+
+#: codetoolsstrconsts:ctsgtk2intfdirectory
+msgid "gtk2 interface directory"
+msgstr "Direktori interface gtk2"
+
+#: codetoolsstrconsts:ctsdefinemacrowince1
+msgid "Define macro wince1"
+msgstr "Definisikan makro wince1"
+
+#: codetoolsstrconsts:ctsgnomeintfdirectory
+msgid "gnome interface directory"
+msgstr "Direktori interface gnome"
+
+#: codetoolsstrconsts:ctscomponentsdirectory
+msgid "Components Directory"
+msgstr "Direktori Komponen"
+
+#: codetoolsstrconsts:ctscustomcomponentsdirectory
+msgid "Custom Components Directory"
+msgstr "Direktori Komponen Kustom"
+
+#: codetoolsstrconsts:ctstoolsdirectory
+msgid "Tools Directory"
+msgstr "Direktori Tools"
+
+#: codetoolsstrconsts:ctsinstalldirectory
+msgid "Install Directory"
+msgstr "Direktori Instalasi"
+
+#: codetoolsstrconsts:ctsdesignerdirectory
+msgid "Designer Directory"
+msgstr "Direktori Desainer"
+
+#: codetoolsstrconsts:ctsideintfdirectory
+msgid "IDEIntf Directory"
+msgstr "Direktori IDEIntf"
+
+#: codetoolsstrconsts:ctsjitformdirectory
+msgid "JITForm Directory"
+msgstr "Direktori JITForm"
+
+#: codetoolsstrconsts:ctsdesignerunitsdirectory
+msgid "Designer Units"
+msgstr "Unit Desainer"
+
+#: codetoolsstrconsts:ctscompiledsrcpath
+msgid "Compiled SrcPath"
+msgstr "SrcPath yang Dikompilasi"
+
+#: codetoolsstrconsts:ctspackagerdirectory
+msgid "Packager Directory"
+msgstr "Direktori Packager"
+
+#: codetoolsstrconsts:ctspackagerregistrationdirectory
+msgid "Packager Registration Directory"
+msgstr "Direktori Registrasi Packager"
+
+#: codetoolsstrconsts:ctspackagerunitsdirectory
+msgid "Packager Units Directory"
+msgstr "Direktori Unit Packager"
+
+#: codetoolsstrconsts:ctscpudirectory
+msgid "CPU directory"
+msgstr "Direktori CPU"
+
+#: codetoolsstrconsts:ctslazarusmaindirectory
+msgid "lazarus main directory"
+msgstr "direktori utama lazarus"
+
+#: codetoolsstrconsts:ctsdebuggerdirectory
+msgid "Debugger Directory"
+msgstr "Direktori Debugger"
+
+#: codetoolsstrconsts:ctsconverterdirectory
+msgid "Converter Directory"
+msgstr "Direktori Konverter"
+
+#: codetoolsstrconsts:ctsidedirectory
+msgid "IDE Directory"
+msgstr "Direktori IDE"
+
+#: codetoolsstrconsts:ctsdoceditordirectory
+msgid "Doc Editor Directory"
+msgstr "Direktori Editor Doc"
+
+#: codetoolsstrconsts:ctslazarussources
+msgid "Lazarus Sources"
+msgstr "Sumber Lazarus"
+
+#: codetoolsstrconsts:ctsanlclproject
+msgid "an LCL project"
+msgstr "sebuah proyek LCL"
+
+#: codetoolsstrconsts:ctsothercompilerdefines
+msgid "%s Compiler Defines"
+msgstr "%s Defines Kompilator"
+
+#: codetoolsstrconsts:ctsresetalldefines
+msgid "Reset all defines"
+msgstr "Reset semua define"
+
+#: codetoolsstrconsts:ctsdefinemacroname
+msgid "Define Macro %s"
+msgstr "Definisikan Makro %s"
+
+#: codetoolsstrconsts:ctsnamedproject
+msgid "%s Project"
+msgstr "%s Proyek"
+
+#: codetoolsstrconsts:ctsdefine
+msgid "Define "
+msgstr "Define "
+
+#: codetoolsstrconsts:ctscommandlineparameters
+msgid "Command line parameters"
+msgstr "Parameter baris perintah"
+
+#: codetoolsstrconsts:ctsmethodtypedefinitionnotfound
+msgid "method type definition not found"
+msgstr "definisi tipe method tidak ditemukan"
+
+#: codetoolsstrconsts:ctsoldmethodnotfound
+msgid "old method not found: %s"
+msgstr "metode lama tidak ditemukan: %s"
+
+#: codetoolsstrconsts:ctsfiledoesnotexists
+msgid "file \"%s\" does not exist"
+msgstr "file \"%s\" tidak ada"
+
+#: codetoolsstrconsts:ctsexecuteaccessdeniedforfile
+msgid "execute access denied for %s"
+msgstr "akses eksekusi ditolak untuk %s"
+
+#: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink
+msgid "a directory component in %s does not exist or is a dangling symlink"
+msgstr "direktori komponen dalam %s tidak ada atau merupakan dangling symlink"
+
+#: codetoolsstrconsts:ctsdircomponentisnotdir
+msgid "a directory component in %s is not a directory"
+msgstr "direktori komponen dalam %s bukan sebuah direktori"
+
+#: codetoolsstrconsts:ctsinsufficientmemory
+msgid "insufficient memory"
+msgstr "memori tidak cukup"
+
+#: codetoolsstrconsts:ctsfilehascircularsymlink
+msgid "%s has a circular symbolic link"
+msgstr "%s mempunyai link simbolik berputar"
+
+#: codetoolsstrconsts:ctsfileisnotexecutable
+msgid "%s is not executable"
+msgstr "%s bukan eksekutabel"
+
+#: codetoolsstrconsts:ctssrcpathforcompiledunits
+msgid "src path for compiled units"
+msgstr "src path untuk unit yang dikompilasi"
+
diff --git a/components/synedit/languages/synedit.id.po b/components/synedit/languages/synedit.id.po
new file mode 100644
index 0000000000..c6d12fa40d
--- /dev/null
+++ b/components/synedit/languages/synedit.id.po
@@ -0,0 +1,226 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus 1.x\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-05 02:42+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Indonesian Translator <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: syneditstrconst:syns_exporterformathtml
+msgid "HTML"
+msgstr "HTML"
+
+#: syneditstrconst:syns_exporterformatrtf
+msgid "RTF"
+msgstr "RTF"
+
+#: syneditstrconst:syns_scrollinfofmt
+msgid "%d - %d"
+msgstr "%d - %d"
+
+#: syneditstrconst:syns_scrollinfofmttop
+msgid "Top Line: %d"
+msgstr "Baris teratas: %d"
+
+#: syneditstrconst:syns_previewscrollinfofmt
+msgid "Page: %d"
+msgstr "Halaman: %d"
+
+#: syneditstrconst:syns_eduplicateshortcut
+msgid "Shortcut already exists"
+msgstr "Jalan pintas sudah ada"
+
+#: syneditstrconst:syns_shortcutnone
+msgid "<none>"
+msgstr "<tidak ada>"
+
+#: syneditstrconst:syns_duplicateshortcutmsg
+msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)"
+msgstr "tekanan tombol \"%s\" sudah ditugaskan ke perintah editor lain. (%s)"
+
+#: syneditstrconst:syns_filterpascal
+msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc"
+msgstr "File Pascal (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc"
+
+#: syneditstrconst:syns_filterhp48
+msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp"
+msgstr "File HP48 (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp"
+
+#: syneditstrconst:syns_filtercaclipper
+msgid "CA-Clipper Files (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc"
+msgstr "File CA-Clipper (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc"
+
+#: syneditstrconst:syns_filtercorbaidl
+msgid "CORBA IDL files (*.idl)|*.idl"
+msgstr "File CORBA IDL (*.idl)|*.idl"
+
+#: syneditstrconst:syns_filtercpm
+msgid "CPM reports (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf"
+msgstr "Laporan CPM (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf"
+
+#: syneditstrconst:syns_filtercpp
+msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh"
+msgstr "File C++ (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh"
+
+#: syneditstrconst:syns_filterjava
+msgid "Java Files (*.java)|*.java"
+msgstr "File Java (*.java)|*.java"
+
+#: syneditstrconst:syns_filterperl
+msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi"
+msgstr "File Perl (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi"
+
+#: syneditstrconst:syns_filterawk
+msgid "AWK Script (*.awk)|*.awk"
+msgstr "Naskah AWK (*.awk)|*.awk"
+
+#: syneditstrconst:syns_filterhtml
+msgid "HTML Document (*.htm,*.html)|*.htm;*.html"
+msgstr "Dokumen HTML (*.htm,*.html)|*.htm;*.html"
+
+#: syneditstrconst:syns_filtervbscript
+msgid "VBScript Files (*.vbs)|*.vbs"
+msgstr "File VBScript (*.vbs)|*.vbs"
+
+#: syneditstrconst:syns_filtergalaxy
+msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt"
+msgstr "File Galaxy (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt"
+
+#: syneditstrconst:syns_filterpython
+msgid "Python Files (*.py)|*.py"
+msgstr "File Python (*.py)|*.py"
+
+#: syneditstrconst:syns_filtersql
+msgid "SQL Files (*.sql)|*.sql"
+msgstr "File SQL (*.sql)|*.sql"
+
+#: syneditstrconst:syns_filterhp
+msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP"
+msgstr "File HP48 (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP"
+
+#: syneditstrconst:syns_filtertcltk
+msgid "Tcl/Tk Files (*.tcl)|*.tcl"
+msgstr "File Tcl/Tk (*.tcl)|*.tcl"
+
+#: syneditstrconst:syns_filterrtf
+msgid "Rich Text Format (*.rtf)|*.rtf"
+msgstr "Rich Text Format (*.rtf)|*.rtf"
+
+#: syneditstrconst:syns_filterbatch
+msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd"
+msgstr "File Batch MS-DOS (*.bat;*.cmd)|*.bat;*.cmd"
+
+#: syneditstrconst:syns_filterdfm
+msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm"
+msgstr "File Form Borland (*.dfm;*.xfm)|*.dfm;*.xfm"
+
+#: syneditstrconst:syns_filterlfm
+msgid "Lazarus Form Files (*.lfm)|*.lfm"
+msgstr "File Form Lazarus (*.lfm)|*.lfm"
+
+#: syneditstrconst:syns_filterx86asm
+msgid "x86 Assembly Files (*.asm)|*.ASM"
+msgstr "File Assembly x86(*.asm)|*.ASM"
+
+#: syneditstrconst:syns_filtergembase
+msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM"
+msgstr "File GEMBASE (*.dml,*.gem)|*.DML;*.GEM"
+
+#: syneditstrconst:syns_filterini
+msgid "INI Files (*.ini)|*.ini"
+msgstr "File INI (*.ini)|*.ini"
+
+#: syneditstrconst:syns_filtersml
+msgid "Standard ML Files (*.sml)|*.sml"
+msgstr "File ML Standar (*.sml)|*.sml"
+
+#: syneditstrconst:syns_filtervisualbasic
+msgid "Visual Basic Files (*.bas)|*.bas"
+msgstr "File Visual Basic (*.bas)|*.bas"
+
+#: syneditstrconst:syns_filteradsp21xx
+msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC"
+msgstr "File DSP (*.dsp,*.inc)|*.DSP;*.INC"
+
+#: syneditstrconst:syns_filterphp
+msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc"
+msgstr "Fo;e PHP (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc"
+
+#: syneditstrconst:syns_filtercache
+msgid "Cache Files (*.mac,*.inc,*.int)|*.mac;*.inc;*.int"
+msgstr "File Cache (*.mac,*.inc,*.int)|*.mac;*.inc;*.int"
+
+#: syneditstrconst:syns_filtercss
+msgid "Cascading Stylesheets (*.css)|*.css"
+msgstr "Cascading Stylesheets (*.css)|*.css"
+
+#: syneditstrconst:syns_filterjscript
+msgid "Javascript Files (*.js)|*.js"
+msgstr "File Javascript (*.js)|*.js"
+
+#: syneditstrconst:syns_filterkix
+msgid "KiXtart scripts (*.kix)|*.kix"
+msgstr "Naskah KiXtart (*.kix)|*.kix"
+
+#: syneditstrconst:syns_filterbaan
+msgid "Baan 4GL Files (*.cln)|*.cln"
+msgstr "File Baan 4GL (*.cln)|*.cln"
+
+#: syneditstrconst:syns_filterfoxpro
+msgid "Foxpro Files (*.prg)|*.prg"
+msgstr "File Foxpro (*.prg)|*.prg"
+
+#: syneditstrconst:syns_filterfortran
+msgid "Fortran Files (*.for)|*.for"
+msgstr "File Fortran (*.for)|*.for"
+
+#: syneditstrconst:syns_filterasm68hc11
+msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC"
+msgstr "File Assembler 68HC11(*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC"
+
+#: syneditstrconst:syns_filterprogress
+msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i"
+msgstr "File Progress (*.w,*.p,*.i)|*.w;*.p;*.i"
+
+#: syneditstrconst:syns_filterinno
+msgid "Inno Setup Script Files (*.iss)|*.iss"
+msgstr "File Naskah Inno Setup (*.iss)|*.iss"
+
+#: syneditstrconst:syns_filtermodelica
+msgid "Modelica Files (*.mo)|*.mo"
+msgstr "File Modelica (*.mo)|*.mo"
+
+#: syneditstrconst:syns_filtermodula3
+msgid "Modula-3 Files (*.m3)|*.m3"
+msgstr "File Modula-3 (*.m3)|*.m3"
+
+#: syneditstrconst:syns_filtersdd
+msgid "Semanta DD files (*.sdd)|*.sdd"
+msgstr "File Semanta DD (*.sdd)|*.sdd"
+
+#: syneditstrconst:syns_filterxml
+msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd"
+msgstr "Dokumen XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd"
+
+#: syneditstrconst:syns_filtergws
+msgid "GW-TEL Script Files (*.gws)|*.gws"
+msgstr "File Naskah GW-TEL (*.gws)|*.gws"
+
+#: syneditstrconst:syns_filtersyngenmsgfiles
+msgid "Msg files (*.msg)|*.msg"
+msgstr "File Msg (*.msg)|*.msg"
+
+#: syneditstrconst:syns_filterunixshellscript
+msgid "UNIX Shell Scripts (*.sh)|*.sh"
+msgstr "Naskah Shell UNIX (*.sh)|*.sh"
+
+#: syneditstrconst:syns_filtertex
+msgid "TeX Files (*.tex)|*.tex"
+msgstr "File TeX (*.tex)|*.tex"
+
diff --git a/components/synedit/languages/synmacrorecorder.id.po b/components/synedit/languages/synmacrorecorder.id.po
new file mode 100644
index 0000000000..9ab28649ea
--- /dev/null
+++ b/components/synedit/languages/synmacrorecorder.id.po
@@ -0,0 +1,30 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus v1.x\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-05 02:31+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Indonesian Translator <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: synmacrorecorder:scannotrecord
+msgid "Cannot record macro when recording"
+msgstr "Tidak bisa merekam makro saat perekaman"
+
+#: synmacrorecorder:scannotplay
+msgid "Cannot playback macro when recording"
+msgstr "Tidak bisa memainkan makro saat perekaman"
+
+#: synmacrorecorder:scannotpause
+msgid "Can only pause when recording"
+msgstr "Hanya bisa istirahat ketika perekaman"
+
+#: synmacrorecorder:scannotresume
+msgid "Can only resume when paused"
+msgstr "Hanya bisa melanjutkan lagi ketika istirahat"
+
diff --git a/languages/lazaruside.id.po b/languages/lazaruside.id.po
new file mode 100644
index 0000000000..1fb256bf73
--- /dev/null
+++ b/languages/lazaruside.id.po
@@ -0,0 +1,9162 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus 1.x\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-03 01:08+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Indonesian <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: lazarusidestrconsts:lisentertransla
+msgid "Enter translation language"
+msgstr "Masukkan bahasa terjemahan"
+
+#: lazarusidestrconsts:lislazarusversionstring
+msgid "%s beta"
+msgstr "%s beta"
+
+#: lazarusidestrconsts:lisleaveemptyfo
+msgid "Leave empty for default .po file"
+msgstr "Biarkan kosong untuk default file .po"
+
+#: lazarusidestrconsts:lismenucollectpofil
+msgid "Collect .po files"
+msgstr "Kumpulkan file .po"
+
+#: lazarusidestrconsts:lismenucreatepofile
+msgid "Create .po files"
+msgstr "Buat file .po"
+
+#: lazarusidestrconsts:listhishelpmessage
+msgid "this help message"
+msgstr "pesan panduan ini"
+
+#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
+msgid "primary config directory, where Lazarus stores its config files. Default is "
+msgstr "direktori konfigurasi utama, dimana Lazarus menyimpan file konfigurasinya. Default adalah"
+
+#: lazarusidestrconsts:lislazarusoptionsprojectfilename
+msgid "lazarus [options] <project-filename>"
+msgstr "lazarus [opsi] <namafile-proyek>"
+
+#: lazarusidestrconsts:lisideoptions
+msgid "IDE Options:"
+msgstr "Opsi IDE"
+
+#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
+msgid "LCL Interface specific options:"
+msgstr "Opsi khusus Antarmuka LCL"
+
+#: lazarusidestrconsts:lisdonotshowsplashscreen
+msgid "Do not show splash screen"
+msgstr "Jangan tampilkan layar splash"
+
+#: lazarusidestrconsts:lisskiploadinglastproject
+msgid "Skip loading last project"
+msgstr "Lewati pengambilan proyek terakhir"
+
+#: lazarusidestrconsts:lisoverridelanguage
+msgid "Override language. For example --language=de. For possible values see files in the languages directory."
+msgstr "Timpa bahasa. Sebagai contoh  --language=de. untuk nilai yang mungkin lihat file dalam direktori languages."
+
+#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
+msgid "secondary config directory, where Lazarus searches for config template files. Default is "
+msgstr "direktori konfig kedua, dimana Lazarus mencari file template konfig. Default adalah"
+
+#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
+msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
+msgstr "file, dimana output debug ditulisnya. Jika tidak ditetapkan, output debug ditulis ke konsol"
+
+#: lazarusidestrconsts:lisselectiontool
+msgid "Selection tool"
+msgstr "Piranti pemilihan"
+
+#: lazarusidestrconsts:liscursorcolumnincurrenteditor
+msgid "Cursor column in current editor"
+msgstr "Kolom kursor dalam editor saat ini"
+
+#: lazarusidestrconsts:liscursorrowincurrenteditor
+msgid "Cursor row in current editor"
+msgstr "Baris kursor dalam editor saat ini"
+
+#: lazarusidestrconsts:liscompilerfilename
+msgid "Compiler filename"
+msgstr "Nama file kompilator"
+
+#: lazarusidestrconsts:liswordatcursorincurrenteditor
+msgid "Word at cursor in current editor"
+msgstr "Kata di kursor dalam editor saat ini"
+
+#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
+msgid "Expanded filename of current editor file"
+msgstr "Nama file lebar dari file editor saat ini"
+
+#: lazarusidestrconsts:lisfreepascalsourcedirectory
+msgid "Freepascal source directory"
+msgstr "direktori sumber Freepascal"
+
+#: lazarusidestrconsts:lislazarusdirectory
+msgid "Lazarus directory"
+msgstr "Direktori Lazarus"
+
+#: lazarusidestrconsts:lislclwidgettype
+msgid "LCL Widget Type"
+msgstr "Tipe Widget LCL"
+
+#: lazarusidestrconsts:listargetcpu
+msgid "Target CPU"
+msgstr "Target CPU"
+
+#: lazarusidestrconsts:listargetos
+msgid "Target OS"
+msgstr "Target OS"
+
+#: lazarusidestrconsts:liscommandlineparamsofprogram
+msgid "Command line parameters of program"
+msgstr "Parameter baris perintah dari program"
+
+#: lazarusidestrconsts:lispromptforvalue
+msgid "Prompt for value"
+msgstr "Nilai untuk prompt"
+
+#: lazarusidestrconsts:lisprojectfilename
+msgid "Project filename"
+msgstr "Nama file proyek"
+
+#: lazarusidestrconsts:lisprojectdirectory
+msgid "Project directory"
+msgstr "Direktori proyek"
+
+#: lazarusidestrconsts:lissavecurrenteditorfile
+msgid "save current editor file"
+msgstr "simpan file editor saat ini"
+
+#: lazarusidestrconsts:lissaveallmodified
+msgid "save all modified files"
+msgstr "simpan semua file yang diubah"
+
+#: lazarusidestrconsts:listargetfilenameofproject
+msgid "Target filename of project"
+msgstr "Nama file target dari proyek"
+
+#: lazarusidestrconsts:listargetfilenameplusparams
+msgid "Target filename + params"
+msgstr "Nama file target + param"
+
+#: lazarusidestrconsts:listestdirectory
+msgid "Test directory"
+msgstr "Direktori Tes"
+
+#: lazarusidestrconsts:lislaunchingcmdline
+msgid "Launching target command line"
+msgstr "Menjalankan baris perintah target"
+
+#: lazarusidestrconsts:lispublishprojdir
+msgid "Publish project directory"
+msgstr "Direktori publikasi proyek"
+
+#: lazarusidestrconsts:lisprojectunitpath
+msgid "Project Unit Path"
+msgstr "Path Unir Proyek"
+
+#: lazarusidestrconsts:lisprojectincpath
+msgid "Project Include Path"
+msgstr "Path Include Proyek"
+
+#: lazarusidestrconsts:lisprojectsrcpath
+msgid "Project Src Path"
+msgstr "Path Src Proyek"
+
+#: lazarusidestrconsts:lismakeexe
+msgid "Make Executable"
+msgstr "Buat Eksekutabel"
+
+#: lazarusidestrconsts:lisprojectmakroproperties
+msgid "Project makro properties"
+msgstr "Properti makro proyek"
+
+#: lazarusidestrconsts:lisopenproject2
+msgid "Open project"
+msgstr "Buka proyek"
+
+#: lazarusidestrconsts:lisopenasxmlfile
+msgid "Open as XML file"
+msgstr "Buka sebagai file XML"
+
+#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
+msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
+msgstr "Kesalahan terjadi saat terakhir startup ketika mengambil %s!%s%sAmbil proyek ini lagi?"
+
+#: lazarusidestrconsts:lisopenprojectagain
+msgid "Open project again"
+msgstr "Buka lagi proyek"
+
+#: lazarusidestrconsts:lisstartwithanewproject
+msgid "Start with a new project"
+msgstr "Mulai dengan proyek baru"
+
+#: lazarusidestrconsts:lisprojectmakrounitpath
+msgid "makro ProjectUnitPath"
+msgstr "makro ProjectUnitPath"
+
+#: lazarusidestrconsts:lisconfigdirectory
+msgid "Lazarus config directory"
+msgstr "Direktori konfig Lazarus"
+
+#: lazarusidestrconsts:lismenufile
+msgid "&File"
+msgstr "&File"
+
+#: lazarusidestrconsts:lismenuedit
+msgid "&Edit"
+msgstr "&Edit"
+
+#: lazarusidestrconsts:lismenusearch
+msgid "&Search"
+msgstr "&Cari"
+
+#: lazarusidestrconsts:lismenuview
+msgid "&View"
+msgstr "&Lihat"
+
+#: lazarusidestrconsts:lismenuproject
+msgid "&Project"
+msgstr "&Proyek"
+
+#: lazarusidestrconsts:lismenurun
+msgid "&Run"
+msgstr "&Jalankan"
+
+#: lazarusidestrconsts:lismenucomponents
+msgid "&Components"
+msgstr "&Komponen"
+
+#: lazarusidestrconsts:lismenutools
+msgid "&Tools"
+msgstr "&Piranti"
+
+#: lazarusidestrconsts:lismenuenvironent
+msgid "E&nvironment"
+msgstr "Li&ngkungan"
+
+#: lazarusidestrconsts:lismenuwindows
+msgid "&Windows"
+msgstr "Jen&dela"
+
+#: lazarusidestrconsts:lismenuhelp
+msgid "&Help"
+msgstr "&Panduan"
+
+#: lazarusidestrconsts:lismenunewunit
+msgid "New Unit"
+msgstr "Unit Baru"
+
+#: lazarusidestrconsts:lismenunewform
+msgid "New Form"
+msgstr "Form Baru"
+
+#: lazarusidestrconsts:lismenunewother
+msgid "New ..."
+msgstr "Baru ..."
+
+#: lazarusidestrconsts:lismenuopen
+msgid "Open"
+msgstr "Buka"
+
+#: lazarusidestrconsts:lismenurevert
+msgid "Revert"
+msgstr "Kembalikan"
+
+#: lazarusidestrconsts:lispkgeditpublishpackage
+msgid "Publish Package"
+msgstr "Publikasikan Paket"
+
+#: lazarusidestrconsts:lismenuopenrecent
+msgid "Open Recent"
+msgstr "Buka yang Terakhir"
+
+#: lazarusidestrconsts:lismenusave
+msgid "Save"
+msgstr "Simpan"
+
+#: lazarusidestrconsts:lisdiscardchanges
+msgid "Discard changes"
+msgstr "Abaikan perubahan"
+
+#: lazarusidestrconsts:lisdonotclosetheide
+msgid "Do not close the IDE"
+msgstr "Jangan tutup IDE"
+
+#: lazarusidestrconsts:lismenusaveas
+msgid "Save As"
+msgstr "Simpan Sebagai"
+
+#: lazarusidestrconsts:lismenusaveall
+msgid "Save All"
+msgstr "Simpan Semua"
+
+#: lazarusidestrconsts:lismenuclose
+msgid "Close"
+msgstr "Tutup"
+
+#: lazarusidestrconsts:lismenucloseall
+msgid "Close all editor files"
+msgstr "Tutup semua file editor"
+
+#: lazarusidestrconsts:lismenucleandirectory
+msgid "Clean directory"
+msgstr "Bersihkan direktori"
+
+#: lazarusidestrconsts:lismenuquit
+msgid "Quit"
+msgstr "Keluar"
+
+#: lazarusidestrconsts:lismenurestart
+msgid "Restart"
+msgstr "Mulai lagi"
+
+#: lazarusidestrconsts:lismenuundo
+msgid "Undo"
+msgstr "Undo"
+
+#: lazarusidestrconsts:lismenuredo
+msgid "Redo"
+msgstr "Redo"
+
+#: lazarusidestrconsts:lismenucut
+msgid "Cut"
+msgstr "Cut"
+
+#: lazarusidestrconsts:lismenucopy
+msgid "Copy"
+msgstr "Copy"
+
+#: lazarusidestrconsts:lismenupaste
+msgid "Paste"
+msgstr "Paste"
+
+#: lazarusidestrconsts:lismenuindentselection
+msgid "Indent selection"
+msgstr "Lekukan pilihan"
+
+#: lazarusidestrconsts:lismenuunindentselection
+msgid "Unindent selection"
+msgstr "Jangan lekukan pilihan"
+
+#: lazarusidestrconsts:lismenuuppercaseselection
+msgid "Uppercase selection"
+msgstr "Besarkan huruf pilihan"
+
+#: lazarusidestrconsts:lismenulowercaseselection
+msgid "Lowercase selection"
+msgstr "Kecilkan huruf pilihan"
+
+#: lazarusidestrconsts:lismenutabstospacesselection
+msgid "Tabs to spaces in selection"
+msgstr "Tab ke spasi dalam pilihan"
+
+#: lazarusidestrconsts:lismenuencloseselection
+msgid "Enclose selection"
+msgstr "Tutupi pilihan"
+
+#: lazarusidestrconsts:lismenucommentselection
+msgid "Comment selection"
+msgstr "Komentari pilihan"
+
+#: lazarusidestrconsts:lismenuuncommentselection
+msgid "Uncomment selection"
+msgstr "Jangan komentari pilihan"
+
+#: lazarusidestrconsts:lismenuconditionalselection
+msgid "Insert $IFDEF..."
+msgstr "Sisipkan $IFDEF..."
+
+#: lazarusidestrconsts:lismenusortselection
+msgid "Sort selection"
+msgstr "Urut pilihan"
+
+#: lazarusidestrconsts:lismenubeaklinesinselection
+msgid "Break Lines in selection"
+msgstr "Pisahkan Baris dalam pilihan"
+
+#: lazarusidestrconsts:lismenuselect
+msgid "Select"
+msgstr "Pilih"
+
+#: lazarusidestrconsts:lismenuselectall
+msgid "Select all"
+msgstr "Pilih semua"
+
+#: lazarusidestrconsts:lismenuselecttobrace
+msgid "Select to brace"
+msgstr "Pilih untuk dikurung"
+
+#: lazarusidestrconsts:lismenuselectcodeblock
+msgid "Select code block"
+msgstr "Pilih blok kode"
+
+#: lazarusidestrconsts:lismenuselectword
+msgid "Select word"
+msgstr "Pilih kata"
+
+#: lazarusidestrconsts:lismenuselectline
+msgid "Select line"
+msgstr "Pilih baris"
+
+#: lazarusidestrconsts:lismenuselectparagraph
+msgid "Select paragraph"
+msgstr "Pilih paragraf"
+
+#: lazarusidestrconsts:lismenuinsertcharacter
+msgid "Insert from Character Map"
+msgstr "Sisipkan dari Peta Karakter"
+
+#: lazarusidestrconsts:lismenuinserttext
+msgid "Insert text"
+msgstr "Sisipkan teks"
+
+#: lazarusidestrconsts:lismenuinsertcvskeyword
+msgid "CVS keyword"
+msgstr "kata kunci CVS"
+
+#: lazarusidestrconsts:lismenuinsertgeneral
+msgid "General"
+msgstr "Umum"
+
+#: lazarusidestrconsts:lismenucompletecode
+msgid "Complete Code"
+msgstr "Kode Lengkap"
+
+#: lazarusidestrconsts:lismenuextractproc
+msgid "Extract procedure"
+msgstr "Ekstraks prosedur"
+
+#: lazarusidestrconsts:lismenufindidentifierrefs
+msgid "Find Identifier References"
+msgstr "Cari Referensi Pengenal"
+
+#: lazarusidestrconsts:lismenurenameidentifier
+msgid "Rename Identifier"
+msgstr "Ganti nama Pengenal"
+
+#: lazarusidestrconsts:lismenuinsertgplnotice
+msgid "GPL notice"
+msgstr "catatan GPL"
+
+#: lazarusidestrconsts:lismenuinsertlgplnotice
+msgid "LGPL notice"
+msgstr "catatan LGPL"
+
+#: lazarusidestrconsts:lismenuinsertusername
+msgid "Current username"
+msgstr "Nama pemakai saat ini"
+
+#: lazarusidestrconsts:lismenuinsertdatetime
+msgid "Current date and time"
+msgstr "Tanggal dan waktu saat ini"
+
+#: lazarusidestrconsts:lismenuinsertchangelogentry
+msgid "ChangeLog entry"
+msgstr "Entri ChangeLog"
+
+#: lazarusidestrconsts:lismenufind
+msgid "Find"
+msgstr "Cari"
+
+#: lazarusidestrconsts:lismenufindnext
+msgid "Find &Next"
+msgstr "Cari Berikut&nya"
+
+#: lazarusidestrconsts:lismenufindprevious
+msgid "Find &Previous"
+msgstr "Cari &Sebelumnya"
+
+#: lazarusidestrconsts:lismenufindinfiles
+msgid "Find &in files"
+msgstr "Cari &dalam file"
+
+#: lazarusidestrconsts:lismenureplace
+msgid "Replace"
+msgstr "Ganti"
+
+#: lazarusidestrconsts:lismenuincrementalfind
+msgid "Incremental Find"
+msgstr "Pencarian inkremental"
+
+#: lazarusidestrconsts:lismenugotoline
+msgid "Goto line"
+msgstr "Pergi ke baris"
+
+#: lazarusidestrconsts:lismenujumpback
+msgid "Jump back"
+msgstr "Lompat kembali"
+
+#: lazarusidestrconsts:lismenujumpforward
+msgid "Jump forward"
+msgstr "Lompat maju"
+
+#: lazarusidestrconsts:lismenuaddjumppointtohistory
+msgid "Add jump point to history"
+msgstr "Tambah titik lompatan ke histori"
+
+#: lazarusidestrconsts:lismenuviewjumphistory
+msgid "View Jump-History"
+msgstr "Lihat Histori-Lompatan"
+
+#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
+msgid "Find other end of code block"
+msgstr "Cari akhir blok kode lainnya"
+
+#: lazarusidestrconsts:lismenufindcodeblockstart
+msgid "Find code block start"
+msgstr "Cari awal blok kode"
+
+#: lazarusidestrconsts:lismenufinddeclarationatcursor
+msgid "Find Declaration at cursor"
+msgstr "Cari Deklarasi di kursor"
+
+#: lazarusidestrconsts:lismenuopenfilenameatcursor
+msgid "Open filename at cursor"
+msgstr "Buka nama file di kursor"
+
+#: lazarusidestrconsts:lismenugotoincludedirective
+msgid "Goto include directive"
+msgstr "Pergi ke direktif include"
+
+#: lazarusidestrconsts:lismenujumptonexterror
+msgid "Jump to next error"
+msgstr "Lompat ke kesalahan berikutnya"
+
+#: lazarusidestrconsts:lismenujumptopreverror
+msgid "Jump to previous error"
+msgstr "Lompat ke kesalahan sebelumnya"
+
+#: lazarusidestrconsts:lismenusetfreebookmark
+msgid "Set a free bookmark"
+msgstr "Set penunjuk bebas"
+
+#: lazarusidestrconsts:lismenujumptonextbookmark
+msgid "Jump to next bookmark"
+msgstr "Lompat ke penunjuk berikutnya"
+
+#: lazarusidestrconsts:lismenujumptoprevbookmark
+msgid "Jump to previous bookmark"
+msgstr "Lompat ke penunjuk sebelumnya"
+
+#: lazarusidestrconsts:lismenuviewobjectinspector
+msgid "Object Inspector"
+msgstr "Inspektor Obyek"
+
+#: lazarusidestrconsts:lismenuviewsourceeditor
+msgid "Source Editor"
+msgstr "Editor Sumber"
+
+#: lazarusidestrconsts:lismenuviewcodeexplorer
+msgid "Code Explorer"
+msgstr "Eksplorer Kode"
+
+#: lazarusidestrconsts:lismenujumpto
+msgid "Jump to"
+msgstr "Lompat ke"
+
+#: lazarusidestrconsts:lismenuviewunits
+msgid "Units..."
+msgstr "Units..."
+
+#: lazarusidestrconsts:lismenuviewforms
+msgid "Forms..."
+msgstr "Forms..."
+
+#: lazarusidestrconsts:lismenuviewunitdependencies
+msgid "View Unit Dependencies"
+msgstr "Lihat Ketergantungan Unit"
+
+#: lazarusidestrconsts:lismenuviewunitinfo
+msgid "View Unit Information"
+msgstr "Lihat Informasi Unit"
+
+#: lazarusidestrconsts:lismenuviewtoggleformunit
+msgid "Toggle form/unit view"
+msgstr "Toggle tampilan form/unit"
+
+#: lazarusidestrconsts:lismenuviewmessages
+msgid "Messages"
+msgstr "Pesan"
+
+#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
+msgid "Copy selected messages to clipboard"
+msgstr "Copy pesan yang dipilih ke clipboard"
+
+#: lazarusidestrconsts:liscopyallmessagestoclipboard
+msgid "Copy all messages to clipboard"
+msgstr "Copy semua pesan ke clipboard"
+
+#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
+msgid "Copy all and hidden messages to clipboard"
+msgstr "Copy semua dan pesan tersembunyi ke clipboard"
+
+#: lazarusidestrconsts:lissaveallmessagestofile
+msgid "Save all messages to file"
+msgstr "Simpan semua pesan ke file"
+
+#: lazarusidestrconsts:lismenuviewsearchresults
+msgid "Search Results"
+msgstr "Cari Hasil"
+
+#: lazarusidestrconsts:lissearchagain
+msgid "Search again"
+msgstr "Cari lagi"
+
+#: lazarusidestrconsts:lismenuviewanchoreditor
+msgid "View Anchor Editor"
+msgstr "Lihat Editor Jangkar"
+
+#: lazarusidestrconsts:lismenuviewcomponentpalette
+msgid "View Component Palette"
+msgstr "Lihat Palet Komponen"
+
+#: lazarusidestrconsts:lismenuviewidespeedbuttons
+msgid "View IDE speed buttons"
+msgstr "Lihat tombol cepat IDE"
+
+#: lazarusidestrconsts:lismenudebugwindows
+msgid "Debug windows"
+msgstr "Jendela Debug"
+
+#: lazarusidestrconsts:lismenuviewwatches
+msgid "Watches"
+msgstr "Pengawasan"
+
+#: lazarusidestrconsts:lismenuviewbreakpoints
+msgid "BreakPoints"
+msgstr "BreakPoints"
+
+#: lazarusidestrconsts:lismenuviewlocalvariables
+msgid "Local Variables"
+msgstr "Variabel Lokal"
+
+#: lazarusidestrconsts:lismenuviewcallstack
+msgid "Call Stack"
+msgstr "Tumpukan Panggilan"
+
+#: lazarusidestrconsts:lismenuviewdebugoutput
+msgid "Debug output"
+msgstr "Output Debug"
+
+#: lazarusidestrconsts:lismenunewproject
+msgid "New Project"
+msgstr "Proyek Baru"
+
+#: lazarusidestrconsts:lismenunewprojectfromfile
+msgid "New Project from file"
+msgstr "Proyek Baru dari file"
+
+#: lazarusidestrconsts:lismenuopenproject
+msgid "Open Project"
+msgstr "Buka Proyek"
+
+#: lazarusidestrconsts:lismenuopenrecentproject
+msgid "Open Recent Project"
+msgstr "Buka Proyek Terakhir"
+
+#: lazarusidestrconsts:lismenusaveproject
+msgid "Save Project"
+msgstr "Simpan Proyek"
+
+#: lazarusidestrconsts:lismenusaveprojectas
+msgid "Save Project As..."
+msgstr "Simpan Proyek Sebagai..."
+
+#: lazarusidestrconsts:lismenupublishproject
+msgid "Publish Project"
+msgstr "Publikasikan Proyek"
+
+#: lazarusidestrconsts:lismenuprojectinspector
+msgid "Project Inspector"
+msgstr "Inspektor Proyek"
+
+#: lazarusidestrconsts:lismenuaddtoproject
+msgid "Add editor file to Project"
+msgstr "Tambah file editor ke Proyek"
+
+#: lazarusidestrconsts:lismenuremovefromproject
+msgid "Remove from Project"
+msgstr "Hapus dari Proyek"
+
+#: lazarusidestrconsts:lismenuviewsource
+msgid "View Source"
+msgstr "Lihat Sumber"
+
+#: lazarusidestrconsts:lismenuviewprojecttodos
+msgid "View ToDo List"
+msgstr "Lihat Daftar ToDo"
+
+#: lazarusidestrconsts:lismenuprojectoptions
+msgid "Project Options..."
+msgstr "Opsi Proyek..."
+
+#: lazarusidestrconsts:lismenubuild
+msgid "Build"
+msgstr "Bangun"
+
+#: lazarusidestrconsts:lismenubuildall
+msgid "Build all"
+msgstr "Bangun semua"
+
+#: lazarusidestrconsts:lismenuabortbuild
+msgid "Abort Build"
+msgstr "Batalkan Pembangunan"
+
+#: lazarusidestrconsts:lismenuprojectrun
+msgid "Run"
+msgstr "Jalankan"
+
+#: lazarusidestrconsts:lismenupause
+msgid "Pause"
+msgstr "Istirahat"
+
+#: lazarusidestrconsts:lismenustepinto
+msgid "Step into"
+msgstr "Melangkah ke dalam"
+
+#: lazarusidestrconsts:lismenustepover
+msgid "Step over"
+msgstr "Melewati"
+
+#: lazarusidestrconsts:lismenuruntocursor
+msgid "Run to cursor"
+msgstr "Jalanjan sampai kursor"
+
+#: lazarusidestrconsts:lismenustop
+msgid "Stop"
+msgstr "Hentikan"
+
+#: lazarusidestrconsts:liscontinue
+msgid "Continue"
+msgstr "Lanjutkan"
+
+#: lazarusidestrconsts:lismenuresetdebugger
+msgid "Reset debugger"
+msgstr "Reset debugger"
+
+#: lazarusidestrconsts:lismenucompileroptions
+msgid "Compiler Options..."
+msgstr "Opsi Kompilator..."
+
+#: lazarusidestrconsts:lismenurunparameters
+msgid "Run Parameters ..."
+msgstr "Parameter Menjalankan ..."
+
+#: lazarusidestrconsts:lismenubuildfile
+msgid "Build File"
+msgstr "Bangun File"
+
+#: lazarusidestrconsts:lismenurunfile
+msgid "Run File"
+msgstr "Jalankan File"
+
+#: lazarusidestrconsts:lismenuconfigbuildfile
+msgid "Configure Build+Run File"
+msgstr "Konfigurasi Bangun+Jalankan File"
+
+#: lazarusidestrconsts:lismenuinspect
+msgid "Inspect ..."
+msgstr "Inspeksi ..."
+
+#: lazarusidestrconsts:lismenuevaluate
+msgid "Evaluate/Modify ..."
+msgstr "Evaluasi/Ubah ..."
+
+#: lazarusidestrconsts:lismenuaddwatch
+msgid "Add watch ..."
+msgstr "Tambah pengawasan ..."
+
+#: lazarusidestrconsts:lismenuaddbreakpoint
+msgid "Add breakpoint"
+msgstr "Tambah breakpoint"
+
+#: lazarusidestrconsts:lismenuaddbpsource
+msgid "Source breakpoint"
+msgstr "Sumber breakpoint"
+
+#: lazarusidestrconsts:lismenuopenpackage
+msgid "Open loaded package"
+msgstr "Buka paket yang diambil"
+
+#: lazarusidestrconsts:lismenuopenrecentpkg
+msgid "Open recent package"
+msgstr "Buka paket terbaru"
+
+#: lazarusidestrconsts:lismenuopenpackagefile
+msgid "Open package file (.lpk)"
+msgstr "Buka file paket (.lpk)"
+
+#: lazarusidestrconsts:lismenuopenpackageofcurunit
+msgid "Open package of current unit"
+msgstr "Open paket dari unit saat ini"
+
+#: lazarusidestrconsts:lismenuaddcurunittopkg
+msgid "Add active unit to a package"
+msgstr "Tambah unit aktif ke paket"
+
+#: lazarusidestrconsts:lismenupackagegraph
+msgid "Package Graph"
+msgstr "Paket Grafik"
+
+#: lazarusidestrconsts:lismenueditinstallpkgs
+msgid "Configure installed packages"
+msgstr "Konfigurasi paket terinstalasi"
+
+#: lazarusidestrconsts:lismenuconfigcustomcomps
+msgid "Configure custom components"
+msgstr "Konfigurasi komponen kustom"
+
+#: lazarusidestrconsts:lismenusettings
+msgid "Configure custom tools ..."
+msgstr "Konfigurasi piranti kustom ..."
+
+#: lazarusidestrconsts:lismenuquicksyntaxcheck
+msgid "Quick syntax check"
+msgstr "Pemeriksaan sintaks cepat"
+
+#: lazarusidestrconsts:lismenuguessunclosedblock
+msgid "Guess unclosed block"
+msgstr "Tebak blok tidak tertutup"
+
+#: lazarusidestrconsts:lismenuguessmisplacedifdef
+msgid "Guess misplaced IFDEF/ENDIF"
+msgstr "Tebak IFDEF/ENDIF salah tempat"
+
+#: lazarusidestrconsts:lismenumakeresourcestring
+msgid "Make Resource String"
+msgstr "Buat String Resource"
+
+#: lazarusidestrconsts:lismenudiff
+msgid "Diff"
+msgstr "Diff"
+
+#: lazarusidestrconsts:lismenuconvertdfmtolfm
+msgid "Convert DFM file to LFM"
+msgstr "Konversi file DFM ke LFM"
+
+#: lazarusidestrconsts:lismenuchecklfm
+msgid "Check LFM file in editor"
+msgstr "Periksa file LFM dalam editor"
+
+#: lazarusidestrconsts:lismenuconvertdelphiunit
+msgid "Convert Delphi unit to Lazarus unit"
+msgstr "Konversi unit Delphi ke unit Lazarus"
+
+#: lazarusidestrconsts:lismenuconvertdelphiproject
+msgid "Convert Delphi project to Lazarus project"
+msgstr "Konversi proyek Delphi ke proyek Lazarus"
+
+#: lazarusidestrconsts:lismenuconvertdelphipackage
+msgid "Convert Delphi package to Lazarus package"
+msgstr "Konversi paket Delphi ke paket Lazarus"
+
+#: lazarusidestrconsts:lismenubuildlazarus
+msgid "Build Lazarus"
+msgstr "Bangun Lazarus"
+
+#: lazarusidestrconsts:lismenuconfigurebuildlazarus
+msgid "Configure \"Build Lazarus\""
+msgstr "Konfigurasi \"Bangun Lazarus\""
+
+#: lazarusidestrconsts:lismenugeneraloptions
+msgid "Environment options"
+msgstr "Opsi Lingkungan"
+
+#: lazarusidestrconsts:lismenueditoroptions
+msgid "Editor options"
+msgstr "Opsi editor"
+
+#: lazarusidestrconsts:lismenueditcodetemplates
+msgid "Code Templates"
+msgstr "Template kode"
+
+#: lazarusidestrconsts:lismendebuggeroptions
+msgid "Debugger Options"
+msgstr "Opsi Debugger"
+
+#: lazarusidestrconsts:lismenucodetoolsoptions
+msgid "CodeTools options"
+msgstr "Opsi CodeTools"
+
+#: lazarusidestrconsts:lismenucodetoolsdefineseditor
+msgid "CodeTools defines editor"
+msgstr "Editor definisi CodeTools"
+
+#: lazarusidestrconsts:lismenuaboutlazarus
+msgid "About Lazarus"
+msgstr "Tentang Lazarus"
+
+#: lazarusidestrconsts:lismenuonlinehelp
+msgid "Online Help"
+msgstr "Panduan Online"
+
+#: lazarusidestrconsts:lismenuconfigurehelp
+msgid "Configure Help"
+msgstr "Konfigurasi Panduan"
+
+#: lazarusidestrconsts:lismenucontexthelp
+msgid "Context sensitive Help"
+msgstr "Panduan sensitif isi"
+
+#: lazarusidestrconsts:lisdsgcopycomponents
+msgid "Copy selected components to clipboard"
+msgstr "Copy komponen yang dipilih ke clipboard"
+
+#: lazarusidestrconsts:lisdsgcutcomponents
+msgid "Cut selected components to clipboard"
+msgstr "Potong komponen yang dipilih ke clipboard"
+
+#: lazarusidestrconsts:lisdsgpastecomponents
+msgid "Paste selected components from clipboard"
+msgstr "Paste komponen yang dipilih dari clipboard"
+
+#: lazarusidestrconsts:lisdsgselectparentcomponent
+msgid "Select parent component"
+msgstr "Pilih komponen leluhurnya"
+
+#: lazarusidestrconsts:lisdsgordermovetofront
+msgid "Move component to front"
+msgstr "Pindahkan komponen ke depan"
+
+#: lazarusidestrconsts:lisdsgordermovetoback
+msgid "Move component to back"
+msgstr "Pindahkan komponen ke belakang"
+
+#: lazarusidestrconsts:lisdsgorderforwardone
+msgid "Move component one forward"
+msgstr "Pindahkan komponen selangkah kedepan"
+
+#: lazarusidestrconsts:lisdsgorderbackone
+msgid "Move component one back"
+msgstr "Pindahkan komponen selangkah kebelakang"
+
+#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
+msgid "Choose program source (*.pp,*.pas,*.lpr)"
+msgstr "Pilih sumber program (*.pp,*.pas,*.lpr)"
+
+#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
+msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
+msgstr "Sumber program harus ekstensi pascal seperti .pas, .pp or .lpr"
+
+#: lazarusidestrconsts:liscompileroptionsforproject
+msgid "Compiler Options for Project: %s"
+msgstr "Opsi Kompilator untuk Proyek: %s"
+
+#: lazarusidestrconsts:lischoosedelphiunit
+msgid "Choose Delphi unit (*.pas)"
+msgstr "Pilih unit Delphi (*.pas)"
+
+#: lazarusidestrconsts:lischoosedelphiproject
+msgid "Choose Delphi project (*.dpr)"
+msgstr "Pilih proyek Delphi (*.dpr)"
+
+#: lazarusidestrconsts:lischoosedelphipackage
+msgid "Choose Delphi package (*.dpk)"
+msgstr "Pilih paket Delphi (*.dpk)"
+
+#: lazarusidestrconsts:lisdelphiproject
+msgid "Delphi project"
+msgstr "Proyek Delphi"
+
+#: lazarusidestrconsts:lisunabletoreadfileerror
+msgid "Unable to read file %s%s%s%sError: %s"
+msgstr "Tidak bisa membaca file %s%s%s%sKesalahan: %s"
+
+#: lazarusidestrconsts:lisformaterror
+msgid "Format error"
+msgstr "Format salah"
+
+#: lazarusidestrconsts:lislfmfilecorrupt
+msgid "LFM file corrupt"
+msgstr "File LFM rusak"
+
+#: lazarusidestrconsts:lisunabletofindavalidclassnamein
+msgid "Unable to find a valid classname in %s%s%s"
+msgstr "Tidak menemukan nama class yang benar dalam %s%s%s"
+
+#: lazarusidestrconsts:lisunabletoconvertfileerror
+msgid "Unable to convert file %s%s%s%sError: %s"
+msgstr "Tidak bisa mengubah file %s%s%s%sKesalahan: %s"
+
+#: lazarusidestrconsts:lisunabletowritefileerror
+msgid "Unable to write file %s%s%s%sError: %s"
+msgstr "Tidak bisa menulis file %s%s%s%sKesalahan: %s"
+
+#: lazarusidestrconsts:liserrorcreatinglrs
+msgid "Error creating lrs"
+msgstr "Kesalahan pembuatan lrs"
+
+#: lazarusidestrconsts:lislfmfilenotfound
+msgid "LFM file not found"
+msgstr "File LFM tidak ditemukan"
+
+#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
+msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
+msgstr "Unit berikut tidak ditemukan:%s%s%s%s1) Unit ini tidak dalam path unit, anda bisa membatalkannya sekarang, membetulkan path unit dan mencoba lagi.%s2) Atau anda bisa mengabaikan unit yang hilang dan membuiatnya jadi komentar"
+
+#: lazarusidestrconsts:lisunitnotfound
+msgid "Unit not found"
+msgstr "Unit tidak ditemukan"
+
+#: lazarusidestrconsts:lisunitsnotfound2
+msgid "Units not found"
+msgstr "Unit tidak ditemukan"
+
+#: lazarusidestrconsts:lisunitlfmfile
+msgid "Unit: %s%sLFM file: %s"
+msgstr "Unit: %s%sfile LFM: %s"
+
+#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
+msgid "Unable to convert lfm to lrs and write lrs file."
+msgstr "Tidak bisa mengubah lfm ke lrs dan menulis file lrs"
+
+#: lazarusidestrconsts:lisnotadelphiproject
+msgid "Not a Delphi project"
+msgstr "Bukan proyek Delphi"
+
+#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
+msgid "The file %s%s%s is not a Delphi project (.dpr)"
+msgstr "File %s%s%s bukan proyek Delphi (.dpr)"
+
+#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
+msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
+msgstr "Tidak bisa mengambil file resource. %sFile resource adalah file include pertama dalam %sbagian inisialisasi. %sSebagai contoh {$I %s.lrs} %sKemungkinan kesalahan sintaks."
+
+#: lazarusidestrconsts:lisresourceloaderror
+msgid "Resource load error"
+msgstr "Kesalahan pengambilan resource"
+
+#: lazarusidestrconsts:lisignoremissingfile
+msgid "Ignore missing file"
+msgstr "Abaikan file hilang"
+
+#: lazarusidestrconsts:lisnoname
+msgid "noname"
+msgstr "tanpa nama"
+
+#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
+msgid "The destination directory%s%s%s%s does not exist."
+msgstr "Direktori tujuan %s%s%s%s tidak ada."
+
+#: lazarusidestrconsts:lisrenamefile
+msgid "Rename file?"
+msgstr "Ganti nama file?"
+
+#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
+msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
+msgstr "Ini sepertinya file pascal. %s direkomendasikan untuk menggunakan nama file dengan huruf kecil, untuk menghindari berbagai masalah pada beberapa filesystems dan kompilator berbeda. %sGanti nama ke huruf kecil?"
+
+#: lazarusidestrconsts:lisrenametolowercase
+msgid "Rename to lowercase"
+msgstr "Ganti nama ke huruf kecil"
+
+#: lazarusidestrconsts:liskeepname
+msgid "Keep name"
+msgstr "Biarkan nama"
+
+#: lazarusidestrconsts:lisoverwritefile
+msgid "Overwrite file?"
+msgstr "Timpa file?"
+
+#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
+msgid "A file %s%s%s already exists.%sReplace it?"
+msgstr "File %s%s%s sudah ada.%sTimpa saja?"
+
+#: lazarusidestrconsts:lisoverwritefileondisk
+msgid "Overwrite file on disk"
+msgstr "Timpa file pada disk"
+
+#: lazarusidestrconsts:lisambiguousfilesfound
+msgid "Ambiguous files found"
+msgstr "File yang meragukan ditemukan"
+
+#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
+msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
+msgstr "Ada file lain dalam direktori dengan nama yang sama, %syang beda hanya jenis hurufnya:%s%s%sHapus dulu?"
+
+#: lazarusidestrconsts:lisdeleteoldfile
+msgid "Delete old file %s%s%s?"
+msgstr "Hapus file lama %s%s%s?"
+
+#: lazarusidestrconsts:lisdeletingoffilefailed
+msgid "Deleting of file %s%s%s failed."
+msgstr "Penghapusan file %s%s%s gagal."
+
+#: lazarusidestrconsts:lisstreamingerror
+msgid "Streaming error"
+msgstr "Pengaliran salah"
+
+#: lazarusidestrconsts:lisunabletostreamt
+msgid "Unable to stream %s:T%s."
+msgstr "Tidak bisa mengalirkan %s:T%s."
+
+#: lazarusidestrconsts:lisresourcesaveerror
+msgid "Resource save error"
+msgstr "Penyimpanan resource salah"
+
+#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
+msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
+msgstr "Tidak bisa menambah komentar header resource ke file resource %s%s%s%s.%sKemungkinan salah sintaks"
+
+#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
+msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
+msgstr "Tidak bisa menambah resource T%s:FORMDATA ke file resource %s%s%s%s.%sKemungkinan salah sintaks."
+
+#: lazarusidestrconsts:lisunabletocreatefile2
+msgid "Unable to create file %s%s%s"
+msgstr "Tidak bisa membuat file %s%s%s"
+
+#: lazarusidestrconsts:liscontinuewithoutloadingform
+msgid "Continue without loading form"
+msgstr "Lanjutkan tanpa pengambilan form"
+
+#: lazarusidestrconsts:liscancelloadingunit
+msgid "Cancel loading unit"
+msgstr "Batalkan pengambilan unit"
+
+#: lazarusidestrconsts:lisabortallloading
+msgid "Abort all loading"
+msgstr "Batalkan semua pengambilan"
+
+#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
+msgid "Unable to transform binary component stream of %s:T%s into text."
+msgstr "Tidak bisa mentransformasi aliran komponen biner %s:T%s ke dalam teks"
+
+#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
+msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
+msgstr "File %s%s%s%stidak ditemukan. %sMengabaikan akan tetap mengambil proyek, %sMembatalkan akan menghentikan pengambilan."
+
+#: lazarusidestrconsts:lisskipfileandcontinueloading
+msgid "Skip file and continue loading"
+msgstr "Lewati file dan lanjutkan pengambilan"
+
+#: lazarusidestrconsts:lisabortloadingproject
+msgid "Abort loading project"
+msgstr "Batalkan pengambilan proyek"
+
+#: lazarusidestrconsts:lisfilenotfound2
+msgid "File %s%s%s not found.%s"
+msgstr "File %s%s%s tidak ditemukan.%s"
+
+#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
+msgid "File %s%s%s not found.%sDo you want to create it?%s"
+msgstr "File %s%s%s tidak ditemukan.%sAnda ingin membuatnya?%s"
+
+#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus
+msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source."
+msgstr "File %s%s%s%ssepertinya file program dari Prject1 Lazarus.%sBuka proyek?%sMembatalkab akan mengambil file sebagai sumber normal."
+
+#: lazarusidestrconsts:lisprojectinfofiledetected
+msgid "Project info file detected"
+msgstr "File info proyek dideteksi"
+
+#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
+msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
+msgstr "File %s%s%s%ssepertinya sebuah program. Tutup proyek sekarang dan buat proyek Lazarus baru untuk program ini?%s\"Tidak\" akan mengambil file sebagai sumber normal."
+
+#: lazarusidestrconsts:lisprogramdetected
+msgid "Program detected"
+msgstr "Program dideteksi"
+
+#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
+msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
+msgstr "Tidak bisa mengubah data form teks dari file %s%s%s%s%skedalam aliran biner. (%s)"
+
+#: lazarusidestrconsts:lisformloaderror
+msgid "Form load error"
+msgstr "Pengambilan form salah"
+
+#: lazarusidestrconsts:lissaveprojectlpi
+msgid "Save Project %s (*.lpi)"
+msgstr "Simpan Proyek %s (*.lpi)"
+
+#: lazarusidestrconsts:lisinvalidprojectfilename
+msgid "Invalid project filename"
+msgstr "Nama file proyek tidak benar"
+
+#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
+msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
+msgstr "%s%s%sbukan nama proyek yang benar.%sSilahkan pilih yang lain (contoh. project1.lpi)"
+
+#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
+msgid "The name %s%s%s is not a valid pascal identifier."
+msgstr "Nama %s%s%s bukan pengenal pascal yang benar."
+
+#: lazarusidestrconsts:lischooseadifferentname
+msgid "Choose a different name"
+msgstr "Pilih nama yang berbeda"
+
+#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
+msgid "The project info file %s%s%s%sis equal to the project main source file!"
+msgstr "File info proyek %s%s%s%ssama dengan file sumber utama proyek!"
+
+#: lazarusidestrconsts:lisunitidentifierexists
+msgid "Unit identifier exists"
+msgstr "Pengenal unit sudah ada"
+
+#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose
+msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name"
+msgstr "Ada unit dengan nama %s%s%s dalam proyek.%sSilahkan pilih nama yang berbeda"
+
+#: lazarusidestrconsts:liserrorcreatingfile
+msgid "Error creating file"
+msgstr "Kesalahan pembuatan file"
+
+#: lazarusidestrconsts:lisunabletocreatefile3
+msgid "Unable to create file%s%s%s%s"
+msgstr "Tidak bisa membuat file%s%s%s%s"
+
+#: lazarusidestrconsts:liscopyerror2
+msgid "Copy error"
+msgstr "Copy salah"
+
+#: lazarusidestrconsts:lissourcedirectorydoesnotexist
+msgid "Source directory %s%s%s does not exist."
+msgstr "Direktori sumber %s%s%s tidak ada."
+
+#: lazarusidestrconsts:lisunabletocreatedirectory
+msgid "Unable to create directory %s%s%s."
+msgstr "Tidak bisa membuat direktori %s%s%s."
+
+#: lazarusidestrconsts:lisunabletocopyfileto
+msgid "Unable to copy file %s%s%s%sto %s%s%s"
+msgstr "Tidak bisa meng- copy file %s%s%s%sto %s%s%s"
+
+#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
+msgid "Sorry, this type is not yet implemented"
+msgstr "Maaf, tipe ini belum diimplementasikan"
+
+#: lazarusidestrconsts:lisfilehaschangedsave
+msgid "File %s%s%s has changed. Save?"
+msgstr "File %s%s%s sudah diubah. Simpan?"
+
+#: lazarusidestrconsts:lisunithaschangedsave
+msgid "Unit %s%s%s has changed. Save?"
+msgstr "Unit %s%s%s sudah diubah. Simpan?"
+
+#: lazarusidestrconsts:lissourceofpagehaschangedsave
+msgid "Source of page %s%s%s has changed. Save?"
+msgstr "Sumber dari halaman %s%s%s sudah diubah. Simpan?"
+
+#: lazarusidestrconsts:lissourcemodified
+msgid "Source modified"
+msgstr "Sumber dimodifikasi"
+
+#: lazarusidestrconsts:lisopenproject
+msgid "Open Project?"
+msgstr "Buka Proyek?"
+
+#: lazarusidestrconsts:lisopentheproject
+msgid "Open the project %s?"
+msgstr "Buka proyek %s?"
+
+#: lazarusidestrconsts:lisopenpackage
+msgid "Open Package?"
+msgstr "Buka Paket?"
+
+#: lazarusidestrconsts:lisopenthepackage
+msgid "Open the package %s?"
+msgstr "Buka paket %s?"
+
+#: lazarusidestrconsts:lisrevertfailed
+msgid "Revert failed"
+msgstr "Pengembalian gagal"
+
+#: lazarusidestrconsts:lisfileisvirtual
+msgid "File %s%s%s is virtual."
+msgstr "File %s%s%s adalah virtual."
+
+#: lazarusidestrconsts:lisunabletowrite
+msgid "Unable to write %s%s%s%s%s."
+msgstr "Tidak bisa menulis %s%s%s%s%s."
+
+#: lazarusidestrconsts:lisfilenottext
+msgid "File not text"
+msgstr "File bukan teks"
+
+#: lazarusidestrconsts:lisunabletorenamefile
+msgid "Unable to rename file"
+msgstr "Tidak bisa mengganti nama file"
+
+#: lazarusidestrconsts:lisunabletocopyfile
+msgid "Unable to copy file"
+msgstr "Tidak bisa meng-copy file"
+
+#: lazarusidestrconsts:lissourceanddestinationarethesame
+msgid "Source and Destination are the same:%s%s"
+msgstr "Sumber dan Tujuan adalah sama:%s%s"
+
+#: lazarusidestrconsts:lisunabletorenamefileto2
+msgid "Unable to rename file %s%s%s%sto %s%s%s."
+msgstr "Tidak bisa mengganti nama file %s%s%s%sto %s%s%s."
+
+#: lazarusidestrconsts:lisunabletocopyfileto2
+msgid "Unable to copy file %s%s%s%sto %s%s%s."
+msgstr "Tidak bisa meng-copy file %s%s%s%sto %s%s%s."
+
+#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
+msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
+msgstr "File %s%s%s%ssepertinya bukan file teks.%sBuka saja?"
+
+#: lazarusidestrconsts:lisinvalidcommand
+msgid "Invalid command"
+msgstr "Perintah tidak benar"
+
+#: lazarusidestrconsts:listhecommandafterisnotexecutable
+msgid "The command after %s%s%s is not executable."
+msgstr "Perintah seteleh %s%s%s bukan eksekutabel."
+
+#: lazarusidestrconsts:lisinvaliddestinationdirectory
+msgid "Invalid destination directory"
+msgstr "Direktori tujuan tidak benar"
+
+#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
+msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
+msgstr "Direktori tujuan %s%s%s tidak benar.%sSilahkan pilih path lengkap."
+
+#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
+msgid "Unable to clean up destination directory"
+msgstr "Tidak bisa membersihkan direktori tujuan"
+
+#: lazarusidestrconsts:liscommandafterinvalid
+msgid "Command after invalid"
+msgstr "Perintah seteleahnya tidak benar"
+
+#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
+msgid "The command after publishing is invalid:%s%s%s%s"
+msgstr "Perintah setelah publikasi tidak benar:%s%s%s%s"
+
+#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
+msgid "Unable to clean up %s%s%s.%sPlease check permissions."
+msgstr "Tidak bisa membersihkan %s%s%s.%sSilahkan periksa perijinan."
+
+#: lazarusidestrconsts:liscommandafterpublishingmodule
+msgid "Command after publishing module"
+msgstr "Perintah setelah mempublikasikan modul"
+
+#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
+msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
+msgstr "Tidak bisa menambah %s ke proyek, karena sudah ada unit dengan nama yang sama dalam Proyek."
+
+#: lazarusidestrconsts:lisaddtoproject
+msgid "Add %s to project?"
+msgstr "Tambah %s ke proyek?"
+
+#: lazarusidestrconsts:listhefile
+msgid "The file %s%s%s"
+msgstr "File %s%s%s"
+
+#: lazarusidestrconsts:lisisalreadypartoftheproject
+msgid "%s is already part of the Project."
+msgstr "%s sudah merupakan bagian dari Proyek."
+
+#: lazarusidestrconsts:lisremovefromproject
+msgid "Remove from project"
+msgstr "Hapus dari proyek"
+
+#: lazarusidestrconsts:liscreateaprojectfirst
+msgid "Create a project first!"
+msgstr "Buat proyek dulu!"
+
+#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
+msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
+msgstr "Direktori Test tidak ditemukan:%s%s%s%s%s(lihat opsi lingkungan)"
+
+#: lazarusidestrconsts:lisbuildnewproject
+msgid "Build new project"
+msgstr "Bangun proyek baru"
+
+#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
+msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
+msgstr "Proyek harus disimpan sebelum pembangunan%sJika anda menset Direktori Test dalam opsi lingkungan,%sanda bisa membuat proyek baru dan membangunnya sekaligus.%sSimpan proyek?"
+
+#: lazarusidestrconsts:lisprojectsuccessfullybuilt
+msgid "Project %s%s%s successfully built. :)"
+msgstr "Proyek %s%s%s dibangun dengan sukses. :)"
+
+#: lazarusidestrconsts:lisexecutingcommandbefore
+msgid "Executing command befor"
+msgstr "Mengeksekusi perintah sebelum"
+
+#: lazarusidestrconsts:lisexecutingcommandafter
+msgid "Executing command after"
+msgstr "Mengeksekusi perintah setelah"
+
+#: lazarusidestrconsts:lisnoprogramfilesfound
+msgid "No program file %s%s%s found."
+msgstr "File program %s%s%s tidak ditemukan"
+
+#: lazarusidestrconsts:liserrorinitializingprogramserrors
+msgid "Error initializing program%s%s%s%s%sError: %s"
+msgstr "Kesalahan menginisialisasi program%s%s%s%s%sKesalahan: %s"
+
+#: lazarusidestrconsts:lisnotnow
+msgid "Not now"
+msgstr "Tdak sekarang"
+
+#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
+msgid "You can not build lazarus while debugging or compiling."
+msgstr "Anda tidak bisa membangun lazarus saat debugging atau kompilasi."
+
+#: lazarusidestrconsts:lisunabletosavefile
+msgid "Unable to save file %s%s%s"
+msgstr "Tidak bisa menyimpan file %s%s%s"
+
+#: lazarusidestrconsts:lisreaderror
+msgid "Read Error"
+msgstr "Pembacaan Salah"
+
+#: lazarusidestrconsts:lisunabletoreadfile2
+msgid "Unable to read file %s%s%s!"
+msgstr "Tidak bisa membaca file %s%s%s!"
+
+#: lazarusidestrconsts:liswriteerror
+msgid "Write Error"
+msgstr "Penulisan Salah"
+
+#: lazarusidestrconsts:lisunabletowritetofile
+msgid "Unable to write to file %s%s%s!"
+msgstr "Tidak bisa menulis ke file %s%s%s!"
+
+#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2
+msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
+msgstr "File %s%s%s%ssepertinya bukan file teks.%sBuka saja?"
+
+#: lazarusidestrconsts:lisunabletocreatebackupdirectory
+msgid "Unable to create backup directory %s%s%s."
+msgstr "Tidak bisa membuat direktori backup %s%s%s."
+
+#: lazarusidestrconsts:lisdeletefilefailed
+msgid "Delete file failed"
+msgstr "Penghapusan file gagal"
+
+#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
+msgid "Unable to remove old backup file %s%s%s!"
+msgstr "Tidak bisa menghapus file backup lama %s%s%s!"
+
+#: lazarusidestrconsts:lisrenamefilefailed
+msgid "Rename file failed"
+msgstr "Penggantian nama file gagal"
+
+#: lazarusidestrconsts:lisunabletorenamefileto
+msgid "Unable to rename file %s%s%s to %s%s%s!"
+msgstr "Tidak bisa mengganti nama file %s%s%s to %s%s%s!"
+
+#: lazarusidestrconsts:lisbackupfilefailed
+msgid "Backup file failed"
+msgstr "Mem-backup file gagal"
+
+#: lazarusidestrconsts:lisunabletobackupfileto
+msgid "Unable to backup file %s%s%s to %s%s%s!"
+msgstr "Tidak bisa mem-backup file %s%s%s to %s%s%s!"
+
+#: lazarusidestrconsts:lisfilenotlowercase
+msgid "File not lowercase"
+msgstr "File tidak dengan huruf kecil"
+
+#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
+msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
+msgstr "Unit %s%s%s tidak dengan huruf kecil.%sThe FreePascal compiler 1.0.x memerlukan nama file dengan huruf kecil. Jika anda tidak menggunakan fpc 1.0.x untuk mengkompilasi unit, anda bisa mengabaikan pesan ini.%s%sGanti nama file?"
+
+#: lazarusidestrconsts:lisdeleteambiguousfile
+msgid "Delete ambiguous file?"
+msgstr "Hapus file yang tidak jelas?"
+
+#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
+msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
+msgstr "File yang tidak jelas ditemukan: %s%s%s%sFile ini mungkin salah dengan %s%s%s%s%sHapus file tidak jelas?"
+
+#: lazarusidestrconsts:lislazaruseditorv
+msgid "Lazarus Editor v%s"
+msgstr "Editor Lazarus v%s"
+
+#: lazarusidestrconsts:lisnewproject
+msgid "%s - (new project)"
+msgstr "%s - (proyek baru)"
+
+#: lazarusidestrconsts:liscompiling
+msgid "%s (compiling ...)"
+msgstr "%s (kompilasi ...)"
+
+#: lazarusidestrconsts:lisdebugging
+msgid "%s (debugging ...)"
+msgstr "%s (debugging ...)"
+
+#: lazarusidestrconsts:lisunabletofindfile
+msgid "Unable to find file %s%s%s."
+msgstr "Tidak bisa menemukan file %s%s%s."
+
+#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
+msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
+msgstr "Tidak bisa menemukan file %s%s%s.%sPeriksa path pencarian dalam%sPryek->Opsi Kompilator...->Path Pencarian->File Unit Lain"
+
+#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
+msgid "NOTE: Could not create Define Template for Free Pascal Sources"
+msgstr "CATATAN: Tidak bisa membuat  Define Template untuk Sumber Free Pascal"
+
+#: lazarusidestrconsts:lisclassnotfound
+msgid "Class not found"
+msgstr "Class tidak ditemukan"
+
+#: lazarusidestrconsts:lisoifclassnotfound
+msgid "Class %s%s%s not found."
+msgstr "Class %s%s%s tidak ditemukan."
+
+#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
+msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
+msgstr "Class %s%s%s tidak terdaftar sebagai kompnen class.%sTidak bisa mem- paste."
+
+#: lazarusidestrconsts:liscontrolneedsparent
+msgid "Control needs parent"
+msgstr "Kontrol membutuhkan leluhurnya"
+
+#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
+msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
+msgstr "Class %s%s%s adalah TControl dan tidak bisa di-paste ke dalam non kontrol.%sTidak mem-paste."
+
+#: lazarusidestrconsts:lisconversionerror
+msgid "Conversion error"
+msgstr "Konversi salah"
+
+#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
+msgid "Unable to convert component text into binary format:%s%s"
+msgstr "Tidak bisa mengkonversi teks komponen ke dalam format biner:%s%s"
+
+#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
+msgid "NOTE: Could not create Define Template for Lazarus Sources"
+msgstr "CATATAN: Tidak bisa membuat  Define Template untuk Sumber Lazarus"
+
+#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
+msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again."
+msgstr "Ekspresi tidak benar.%sPetunjuk: Fungsi Make Resourcestring mengharapkan konstan string dalam file tunggal. Silahkan pilih ekspresi dan coba lagi."
+
+#: lazarusidestrconsts:lisselectionexceedsstringconstant
+msgid "Selection exceeds string constant"
+msgstr "Pilihan melebih konstan string"
+
+#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
+msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again."
+msgstr "Petunjuk: Fungsi Make Resourcestring mengharapkan konstan string. %sSiliahkan pilih hanya ekspresi string dan coba lagi."
+
+#: lazarusidestrconsts:lisnoresourcestringsectionfound
+msgid "No ResourceString Section found"
+msgstr "ResourceString Section tidak ditemukan"
+
+#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
+msgid "Unable to find a ResourceString section in this or any of the used units."
+msgstr "Tidak bisa menemukan bagian ResourceString dalam setiap unit yang digunakan."
+
+#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
+msgid "Component name %s%s%s is not a valid identifier"
+msgstr "Nama komponen %s%s%s bukan pengenal yang benar"
+
+#: lazarusidestrconsts:liscomponentnameiskeyword
+msgid "Component name %s%s%s is keyword"
+msgstr "Nama kompionen %s%s%s adalah kata kunci"
+
+#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
+msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
+msgstr "Unit sendiri sudah mempunyai nama %s%s%s. Pengenal Pascal harus unik."
+
+#: lazarusidestrconsts:lisunabletorenamevariableinsource
+msgid "Unable to rename variable in source."
+msgstr "Tidak bisa mengganti nama variabel dalam sumber."
+
+#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
+msgid "Unable to update CreateForm statement in project source"
+msgstr "Tidak bisa memutakhirkan pernyataan CreateForm dalam sumber proyek"
+
+#: lazarusidestrconsts:listhereisalreadyaformwiththename
+msgid "There is already a form with the name %s%s%s"
+msgstr "Sudah ada form dengan nama %s%s%s"
+
+#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
+msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
+msgstr "Sudah ada unit dengan nama%s%s%s. Pengenal Pascal harus unik."
+
+#: lazarusidestrconsts:lisseemessages
+msgid "See messages."
+msgstr "Lihat pesan."
+
+#: lazarusidestrconsts:liserror
+msgid "Error: "
+msgstr "Salah:"
+
+#: lazarusidestrconsts:lissavechanges
+msgid "Save changes?"
+msgstr "Simpan perubahan?"
+
+#: lazarusidestrconsts:lissavefilebeforeclosingform
+msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
+msgstr "Simpan file %s%s%s%ssebelum menutup form %s%s%s?"
+
+#: lazarusidestrconsts:lisunabletorenameforminsource
+msgid "Unable to rename form in source."
+msgstr "Tidak bisa mengganti nama form dalam sumber."
+
+#: lazarusidestrconsts:lissorrynotimplementedyet
+msgid "Sorry, not implemented yet"
+msgstr "Maaf, belum diimplementasikan"
+
+#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage
+msgid "Unable to find method. Plz fix the error shown in the message window."
+msgstr "Tidak bisa menemukan metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
+
+#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin
+msgid "Unable to create new method. Plz fix the error shown in the message window."
+msgstr "Tidak bisa membuat metode baru. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
+
+#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage
+msgid "Unable to show method. Plz fix the error shown in the message window."
+msgstr "Tidak bisa menampilkan metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
+
+#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag
+msgid "Unable to rename method. Plz fix the error shown in the message window."
+msgstr "Tidak bisa mengganti nama metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
+
+#: lazarusidestrconsts:lisstopdebugging
+msgid "Stop Debugging?"
+msgstr "Hentikan Debugging?"
+
+#: lazarusidestrconsts:lisstopthedebugging
+msgid "Stop the debugging?"
+msgstr "Hentikan debugging?"
+
+#: lazarusidestrconsts:liscannotfindlazarusstarter
+msgid "Cannot find lazarus starter:%s%s"
+msgstr "Tidak bisas menemukan starter lazarus:%s%s"
+
+#: lazarusidestrconsts:lisresourcefilecomment
+msgid "This is an automatically generated lazarus resource file"
+msgstr "File resource lazarus ini dibuat secara otomatis"
+
+#: lazarusidestrconsts:lisopenfile
+msgid "Open file"
+msgstr "Buka file"
+
+#: lazarusidestrconsts:lislazarusfile
+msgid "Lazarus File"
+msgstr "File Lazarus"
+
+#: lazarusidestrconsts:lispascalunit
+msgid "Pascal unit"
+msgstr "Unit Pascal"
+
+#: lazarusidestrconsts:lispascalsourcefile
+msgid "Pascal source file"
+msgstr "File sumber Pascal"
+
+#: lazarusidestrconsts:lisfreepascalsourcefile
+msgid "FreePascal source file"
+msgstr "File sumber FreePascal"
+
+#: lazarusidestrconsts:lisdebugunabletoloadfile
+msgid "Unable to load file"
+msgstr "Tidak bisa mengambil file"
+
+#: lazarusidestrconsts:lisdebugunabletoloadfile2
+msgid "Unable to load file %s%s%s."
+msgstr "Tidak bisa mengambil file %s%s%s."
+
+#: lazarusidestrconsts:lisopenprojectfile
+msgid "Open Project File"
+msgstr "Buka File Proyek"
+
+#: lazarusidestrconsts:lislazarusprojectinfofile
+msgid "Lazarus Project Info file"
+msgstr "File Info Proyek Lazarus"
+
+#: lazarusidestrconsts:lisallfiles
+msgid "All Files"
+msgstr "Semua File"
+
+#: lazarusidestrconsts:lisopenpackagefile
+msgid "Open Package File"
+msgstr "Buka File Paket"
+
+#: lazarusidestrconsts:lissavespace
+msgid "Save "
+msgstr "Simpan"
+
+#: lazarusidestrconsts:lisselectdfmfiles
+msgid "Select Delphi form files (*.dfm)"
+msgstr "Pilih form Delphi dari file (*.dfm)"
+
+#: lazarusidestrconsts:lischoosedirectory
+msgid "Choose directory"
+msgstr "Pilih direktori"
+
+#: lazarusidestrconsts:lisdestinationdirectory
+msgid "Destination directory"
+msgstr "Direktori Tujuan"
+
+#: lazarusidestrconsts:liscommandafter
+msgid "Command after"
+msgstr "Perintah setelah"
+
+#: lazarusidestrconsts:lischooselazarussourcedirectory
+msgid "Choose Lazarus Directory"
+msgstr "Pilih Direktori Lazarus"
+
+#: lazarusidestrconsts:lischoosecompilerpath
+msgid "Choose compiler filename (%s)"
+msgstr "Pilih nama file kompilator (%s)"
+
+#: lazarusidestrconsts:lischoosefpcsourcedir
+msgid "Choose FPC source directory"
+msgstr "Pilih direktori sumber FPC"
+
+#: lazarusidestrconsts:lischoosemakepath
+msgid "Choose make path"
+msgstr "Pilih path make"
+
+#: lazarusidestrconsts:lischoosedebuggerpath
+msgid "Choose debugger filename"
+msgstr "Pilih nama file debugger"
+
+#: lazarusidestrconsts:lischoosetestbuilddir
+msgid "Choose the directory for tests"
+msgstr "Pilih direktori untuk pengujian"
+
+#: lazarusidestrconsts:lislazarusdesktopsettings
+msgid "Lazarus Desktop Settings"
+msgstr "Seting Desktop Lazarus"
+
+#: lazarusidestrconsts:lisxmlfiles
+msgid "XML files"
+msgstr "File XML"
+
+#: lazarusidestrconsts:lissavechangestoproject
+msgid "Save changes to project %s?"
+msgstr "Simpan perubahan ke proyek %s?"
+
+#: lazarusidestrconsts:lisprojectchanged
+msgid "Project changed"
+msgstr "Prouek diubah"
+
+#: lazarusidestrconsts:lisfpcsourcedirectoryerror
+msgid "FPC Source Directory error"
+msgstr "Direktori Sumber FPC salah"
+
+#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory
+msgid "Please check the freepascal source directory"
+msgstr "Silahkan periksa direktori sumber freepascal"
+
+#: lazarusidestrconsts:liscompilererror
+msgid "Compiler error"
+msgstr "Kompilator salah"
+
+#: lazarusidestrconsts:lisplzcheckthecompilername
+msgid "Please check the compiler name"
+msgstr "Silahkan periksa nama kompilator"
+
+#: lazarusidestrconsts:lisaboutlazarus
+msgid "About Lazarus"
+msgstr "Tentang Lazarus"
+
+#: lazarusidestrconsts:lisversion
+msgid "Version"
+msgstr "Versi"
+
+#: lazarusidestrconsts:lisdate
+msgid "Date"
+msgstr "Tanggal"
+
+#: lazarusidestrconsts:lissvnrevision
+msgid "SVN Revision: "
+msgstr "Revisi SVN:"
+
+#: lazarusidestrconsts:lisclose
+msgid "Close"
+msgstr "Tutup"
+
+#: lazarusidestrconsts:lisaboutlazarusmsg
+msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
+msgstr "Lisensi: GPL/LGPL%sLazarus adalah pustaka class untuk  Free Pascal yang mengemulasi Delphi. Free Pascal adalah kompilator (L)GP yang berjalan diatas Linux, Win32, OS/2, 68K dan banyak lagi. Free Pascal didesain agar bisa mengerti dan mengkompilasi sintaks Delphi, yang tentu saja OOP.%sLazarus adalah bagian yang hilang dari teka-teki yang akan membolehkan anda untuk mengembangkan program mirip Delphi dalam semua platform diatas. IDE akan secara kebetulan menjadi piranti RAD seperti Delphi.%sKarena Lazarus terus berkembang kami membutuhkan lebih banyak developers."
+
+#: lazarusidestrconsts:lisaboutnocontributors
+msgid "Cannot find contributors list."
+msgstr "Tidak menemukan daftar kontributor."
+
+#: lazarusidestrconsts:lisunitnamealreadyexistscap
+msgid "Unitname already in project"
+msgstr "Nama unit sudah ada dalam proyek"
+
+#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
+msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
+msgstr "Unit %s%s%s sudah ada.%sAbaikan akan memaksa penggantian nama,%sBatal akan membatalkan penyimpanan sumber ini dan%sGugurkan akan membatalkan semua penyimpanan."
+
+#: lazarusidestrconsts:lisforcerenaming
+msgid "Force renaming"
+msgstr "Paksa penggantian nama"
+
+#: lazarusidestrconsts:liscancelrenaming
+msgid "Cancel renaming"
+msgstr "Batalkan penggantian nama"
+
+#: lazarusidestrconsts:lisabortall
+msgid "Abort all"
+msgstr "Gugurkan semua"
+
+#: lazarusidestrconsts:lisinvalidpascalidentifiercap
+msgid "Invalid Pascal Identifier"
+msgstr "Pengenal Pascal Tidak Benar"
+
+#: lazarusidestrconsts:lisinvalidpascalidentifiertext
+msgid "The name \"%s\" is not a valid pascal identifier."
+msgstr "Nama \"%s\" bukan pengenal pascal yang benar."
+
+#: lazarusidestrconsts:liscopyerror
+msgid "Copy Error"
+msgstr "Copy Salah"
+
+#: lazarusidestrconsts:lishintnewunit
+msgid "New Unit"
+msgstr "Unit Baru"
+
+#: lazarusidestrconsts:lishintopen
+msgid "Open"
+msgstr "Buka"
+
+#: lazarusidestrconsts:lishintsave
+msgid "Save"
+msgstr "Simpan"
+
+#: lazarusidestrconsts:lishintsaveall
+msgid "Save all"
+msgstr "Simpan semua"
+
+#: lazarusidestrconsts:lishintnewform
+msgid "New Form"
+msgstr "Form Baru"
+
+#: lazarusidestrconsts:lishinttoggleformunit
+msgid "Toggle Form/Unit"
+msgstr "Toggle Form/Unit"
+
+#: lazarusidestrconsts:lishintviewunits
+msgid "View Units"
+msgstr "Lihat Unit"
+
+#: lazarusidestrconsts:lishintviewforms
+msgid "View Forms"
+msgstr "Lihat Form"
+
+#: lazarusidestrconsts:lishintrun
+msgid "Run"
+msgstr "Jalankan"
+
+#: lazarusidestrconsts:lishintpause
+msgid "Pause"
+msgstr "Pause"
+
+#: lazarusidestrconsts:lishintstepinto
+msgid "Step Into"
+msgstr "Melangkah kedalam"
+
+#: lazarusidestrconsts:lishintstepover
+msgid "Step Over"
+msgstr "Melewati"
+
+#: lazarusidestrconsts:lisgplnotice
+msgid "Copyright (C) <year> <name of author> %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+msgstr "Hak Cipta (C) <year> <name of author> %sSumber ini adalah piranti lunak bebas; anda bisa mendistribusikannya dan/atau memodifikasi dengan persyaratan dari GNU General Public License seperti dipublikasikan oleh Free Software Foundation; baik versi 2 dari Lisensi, atau (dengan pilihan anda) setiap versi terbaru. %sSumber ini didistribusikan dengan harapan bahwa ini akan berguna, tetapi TANPA JAMINAN APAPUN; bahkan tanpa jaminan berarti dari KEBERLAKUAN atau KECUKUPAN UNTUK KEPERLUAN TERTENTU.  Lihat GNU General Public License untuk keterangan lebih jelas. %sA copy dari GNU General Public License tersedia pada the World Wide Web di <http://www.gnu.org/copyleft/gpl.html>. Anda juga bisa mendapatkannya dengan menulis ke Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+
+#: lazarusidestrconsts:lislgplnotice
+msgid "Copyright (C) <year> <name of author>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+msgstr "Hak Cipta (C) <year> <name of author>%sPustaka ini adalah piranti lunak bebas; anda dapat mendistribusikannya dibawah persyaratan GNU Library General Public License seperti dipublikasikan oleh Free Software Foundation; baik versi 2 dari Lisensi, atau (dengan pilihan anda) setiap versi terbaru. %sProgram ini didistribusikan dengan harapan bahwa ini akan berguna, tetapi TANPA JAMINAN APAPUN; bahkan jaminan berarti dari KEBERLAKUAN atau KECUKUPAN UNTUK KEPERLUAN TERTENTU. Lihat GNU Library General Public License untuk keterangan lebih jelas. %sAnda harus menerima duplikat dari GNU Library General Public License bersamaan dengan pustaka ini; jika tidak, tulis ke Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+
+#: lazarusidestrconsts:dlgbaknosubdirectory
+msgid "(no subdirectory)"
+msgstr "(tidak ada sub direktori)"
+
+#: lazarusidestrconsts:dlgsearchcaption
+msgid "Searching..."
+msgstr "Pencarian..."
+
+#: lazarusidestrconsts:dlgsearchabort
+msgid "Search terminated by user."
+msgstr "Pencarian dibatalkan oleh pemakai."
+
+#: lazarusidestrconsts:lissmatches
+msgid "Matches"
+msgstr "Sama"
+
+#: lazarusidestrconsts:lisssearching
+msgid "Searching"
+msgstr "Pencarian"
+
+#: lazarusidestrconsts:lisssearchtext
+msgid "Search text"
+msgstr "Cari teks"
+
+#: lazarusidestrconsts:dlgdesktop
+msgid "Desktop"
+msgstr "Desktop"
+
+#: lazarusidestrconsts:dlgwindows
+msgid "Windows"
+msgstr "Jendela"
+
+#: lazarusidestrconsts:dlgfrmeditor
+msgid "Form Editor"
+msgstr "Editor Form"
+
+#: lazarusidestrconsts:dlgobjinsp
+msgid "Object Inspector"
+msgstr "Inspektor Objek"
+
+#: lazarusidestrconsts:dlgenvfiles
+msgid "Files"
+msgstr "File"
+
+#: lazarusidestrconsts:lisignorebinaries
+msgid "Ignore binaries"
+msgstr "Abaikan biner"
+
+#: lazarusidestrconsts:lissimplesyntax
+msgid "Simple Syntax"
+msgstr "Sintaks Sederhana"
+
+#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
+msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
+msgstr "Biasanya filter adalah ekspresi reguler. Dalam Sintaks Sederhana sebuah . adalah  karakter normal, sebuah * bisa berarti apapun, sebuah ? berarti setiap karakter, dan koma serta titk koma memisahkan alternatif. Sebagai contoh: Sintaks Sederhana *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
+
+#: lazarusidestrconsts:lisuseexcludefilter
+msgid "Use Exclude Filter"
+msgstr "Gunakan Filter Kekecualian"
+
+#: lazarusidestrconsts:lisexcludefilter
+msgid "Exclude Filter"
+msgstr "Filter Kekecualian"
+
+#: lazarusidestrconsts:lisprojectinformation
+msgid "Project Information"
+msgstr "Informasi Proyek"
+
+#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
+msgid "Save editor info of non project files"
+msgstr "Simpan info editor dari file non proyek"
+
+#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
+msgid "Save info of closed editor files"
+msgstr "Simpan info dari file editor yang ditutup"
+
+#: lazarusidestrconsts:lisuseincludefilter
+msgid "Use Include Filter"
+msgstr "Gunakan Filter Include"
+
+#: lazarusidestrconsts:lisincludefilter
+msgid "Include Filter"
+msgstr "Filter Include"
+
+#: lazarusidestrconsts:dlgenvbckup
+msgid "Backup"
+msgstr "Backup"
+
+#: lazarusidestrconsts:dlgnaming
+msgid "Naming"
+msgstr "Penamaan"
+
+#: lazarusidestrconsts:lislazdoc
+msgid "LazDoc"
+msgstr "LazDoc"
+
+#: lazarusidestrconsts:lisokbtn
+msgid "Ok"
+msgstr "Ok"
+
+#: lazarusidestrconsts:dlgcancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lazarusidestrconsts:liscmparameter
+msgid "Parameter"
+msgstr "Parameter"
+
+#: lazarusidestrconsts:lisctpleaseselectamacro
+msgid "please select a macro"
+msgstr "silahkan pilih makro"
+
+#: lazarusidestrconsts:lisa2pcreatenewfile
+msgid "Create new file"
+msgstr "Buat file baru"
+
+#: lazarusidestrconsts:dlgenvlanguage
+msgid "Language"
+msgstr "Bahasa"
+
+#: lazarusidestrconsts:dlgautosave
+msgid "Auto save"
+msgstr "Otomatis menyimpan"
+
+#: lazarusidestrconsts:dlgedfiles
+msgid "Editor files"
+msgstr "File Editor"
+
+#: lazarusidestrconsts:dlgenvproject
+msgid "Project"
+msgstr "Proyek"
+
+#: lazarusidestrconsts:dlgintvinsec
+msgid "Interval in secs"
+msgstr "Interval dalam detik"
+
+#: lazarusidestrconsts:dlgdesktopfiles
+msgid "Desktop files"
+msgstr "File Desktop"
+
+#: lazarusidestrconsts:dlgsavedfile
+msgid "Save desktop settings to file"
+msgstr "Simpan seting desktop ke file"
+
+#: lazarusidestrconsts:dlgloaddfile
+msgid "Load desktop settings from file"
+msgstr "Ambil seting desktop dari file"
+
+#: lazarusidestrconsts:dlgminimizeallonminimizemain
+msgid "Minimize all on minimize main"
+msgstr "Kecilkan semua saat mengecilkan yang utama"
+
+#: lazarusidestrconsts:dlghideideonrun
+msgid "Hide IDE windows on run"
+msgstr "Sembunyikan jendela IDE saat menjalankan"
+
+#: lazarusidestrconsts:dlgpalhints
+msgid "Hints for component palette"
+msgstr "Petunjuk untuk palet komponen"
+
+#: lazarusidestrconsts:lischeckchangesondiskwithloading
+msgid "Check changes on disk with loading"
+msgstr "Periksa perubahan pada disk tanpa pengambilan"
+
+#: lazarusidestrconsts:dlgspbhints
+msgid "Hints for main speed buttons (open, save, ...)"
+msgstr "Petunjuk untuk tombol cepat utama (buka, simpan, ...)"
+
+#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
+msgid "Double click on messages jumps (otherwise: single click)"
+msgstr "Klik ganda pada pesan lompat (sebaliknya: klik sekali)"
+
+#: lazarusidestrconsts:dlgwinpos
+msgid "Window Positions"
+msgstr "Posisi Jendela"
+
+#: lazarusidestrconsts:dlgmainmenu
+msgid "Main Menu"
+msgstr "Menu Utama"
+
+#: lazarusidestrconsts:dlgsrcedit
+msgid "Source Editor"
+msgstr "Editor Sumber"
+
+#: lazarusidestrconsts:dlgmsgs
+msgid "Messages"
+msgstr "Pesan"
+
+#: lazarusidestrconsts:dlgprojfiles
+msgid "Project files"
+msgstr "File Proyek"
+
+#: lazarusidestrconsts:dlgenvtype
+msgid "Type"
+msgstr "Tipe"
+
+#: lazarusidestrconsts:dlgenvnone
+msgid "None"
+msgstr "Tidak ada"
+
+#: lazarusidestrconsts:dlgsmbfront
+msgid "Symbol in front (.~pp)"
+msgstr "Simbol didepan (.~pp)"
+
+#: lazarusidestrconsts:dlgsmbbehind
+msgid "Symbol behind (.pp~)"
+msgstr "Simbol dibelakang (.pp~)"
+
+#: lazarusidestrconsts:dlgsmbcounter
+msgid "Counter (.pp;1)"
+msgstr "Penghitung (.pp;1)"
+
+#: lazarusidestrconsts:dlgcustomext
+msgid "User defined extension (.pp.xxx)"
+msgstr "Ekstensi ditetapkan pemakai (.pp.xxx)"
+
+#: lazarusidestrconsts:dlgbckupsubdir
+msgid "Same name (in subdirectory)"
+msgstr "Nama sama (dalam subdirektori)"
+
+#: lazarusidestrconsts:dlgedcustomext
+msgid "User defined extension"
+msgstr "Ekstensi ditetapkan pemakai"
+
+#: lazarusidestrconsts:dlgmaxcntr
+msgid "Maximum counter"
+msgstr "Penghitung maksimum"
+
+#: lazarusidestrconsts:dlgedbsubdir
+msgid "Sub directory"
+msgstr "Sub direktori"
+
+#: lazarusidestrconsts:dlgenvotherfiles
+msgid "Other files"
+msgstr "File Lain"
+
+#: lazarusidestrconsts:dlgmaxrecentfiles
+msgid "Max recent files"
+msgstr "Maks file terbaru"
+
+#: lazarusidestrconsts:dlgmaxrecentprojs
+msgid "Max recent project files"
+msgstr "Maks file proyek terbaru"
+
+#: lazarusidestrconsts:dlgqopenlastprj
+msgid "Open last project at start"
+msgstr "Buka proyek terakhir saat mulai"
+
+#: lazarusidestrconsts:dlglazarusdir
+msgid "Lazarus directory (default for all projects)"
+msgstr "Direktori Lazarus (default untuk semua proyek)"
+
+#: lazarusidestrconsts:dlgfpcpath
+msgid "Compiler path (%s)"
+msgstr "Path kompilator (%s)"
+
+#: lazarusidestrconsts:dlgfpcsrcpath
+msgid "FPC source directory"
+msgstr "Direktori sumber FPC"
+
+#: lazarusidestrconsts:dlgmakepath
+msgid "Make path"
+msgstr "Path Make"
+
+#: lazarusidestrconsts:dlgdebugtype
+msgid "Debugger type and path"
+msgstr "Path dan Tipe Debugger"
+
+#: lazarusidestrconsts:dlgtestprjdir
+msgid "Directory for building test projects"
+msgstr "Direktori untuk pembangunan proyek tes"
+
+#: lazarusidestrconsts:dlgqshowgrid
+msgid "Show grid"
+msgstr "Tampilkan grid"
+
+#: lazarusidestrconsts:dlgqshowborderspacing
+msgid "Show border spacing"
+msgstr "Tampilan ruang batas"
+
+#: lazarusidestrconsts:dlggridcolor
+msgid "Grid color"
+msgstr "Warna grid"
+
+#: lazarusidestrconsts:dlgqsnaptogrid
+msgid "Snap to grid"
+msgstr "Menempel ke grid"
+
+#: lazarusidestrconsts:dlggridx
+msgid "Grid size X"
+msgstr "Besar grid X"
+
+#: lazarusidestrconsts:dlggridxhint
+msgid "Horizontal grid step size"
+msgstr "Besar langkah grid horisontal"
+
+#: lazarusidestrconsts:dlggridy
+msgid "Grid size Y"
+msgstr "Besar grid Y"
+
+#: lazarusidestrconsts:dlggridyhint
+msgid "Vertical grid step size"
+msgstr "Besar langkah grid vertikal"
+
+#: lazarusidestrconsts:dlgguidelines
+msgid "Show Guide Lines"
+msgstr "Tampilkan Garis Pemandu"
+
+#: lazarusidestrconsts:dlgsnapguidelines
+msgid "Snap to Guide Lines"
+msgstr "Menempel ke Garis Pemandu"
+
+#: lazarusidestrconsts:dlglefttopclr
+msgid "color for left, top"
+msgstr "warna untuk kiri, atas"
+
+#: lazarusidestrconsts:dlgrightbottomclr
+msgid "color for right, bottom"
+msgstr "warna untuk kanan, bawah"
+
+#: lazarusidestrconsts:dlgshowcaps
+msgid "Show component captions"
+msgstr "Tampilkan judul komponen"
+
+#: lazarusidestrconsts:dlgshowedrhints
+msgid "Show editor hints"
+msgstr "Tampilkan petunjuk editor"
+
+#: lazarusidestrconsts:dlgautoform
+msgid "Auto create form when opening unit"
+msgstr "Otomatis buat form ketika membuka unit"
+
+#: lazarusidestrconsts:dlgrightclickselects
+msgid "Right Click selects"
+msgstr "Klik Kanan memilih"
+
+#: lazarusidestrconsts:dlggrabbercolor
+msgid "Grabber color"
+msgstr "Warna Penggengam"
+
+#: lazarusidestrconsts:dlgmarkercolor
+msgid "Marker color"
+msgstr "Warna Penanda"
+
+#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
+msgid "Reduce designer painting"
+msgstr "Kurangi penggambaran pendesain"
+
+#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
+msgid "Paint designer items only on idle (reduce overhead for slow computers)"
+msgstr "Gambar item pendesain hanya saat menganggur (mengurangi kelebihan beban untuk komputer lambat)"
+
+#: lazarusidestrconsts:dlgenvgrid
+msgid "Grid"
+msgstr "Grid"
+
+#: lazarusidestrconsts:dlgenvlguidelines
+msgid "Guide lines"
+msgstr "Garis Pemandu"
+
+#: lazarusidestrconsts:dlgenvmisc
+msgid "Miscellaneous"
+msgstr "Lain-lain"
+
+#: lazarusidestrconsts:dlgruberbandselectioncolor
+msgid "Selection"
+msgstr "Pemilihan"
+
+#: lazarusidestrconsts:dlgruberbandcreationcolor
+msgid "Creation"
+msgstr "Pembuatan"
+
+#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
+msgid "Select grand childs"
+msgstr "Pilih anak cucu"
+
+#: lazarusidestrconsts:dlgrubberbandgroup
+msgid "Rubber band"
+msgstr "Glang karet"
+
+#: lazarusidestrconsts:dlgpasext
+msgid "Default pascal extension"
+msgstr "Ekstensi pascal default"
+
+#: lazarusidestrconsts:dlgcharcasefileact
+msgid "Save As - auto rename pascal files lower case"
+msgstr "Simpan Sebagai - otomatis mengganti nama file pascal ke huruf kecil"
+
+#: lazarusidestrconsts:dlgambigfileact
+msgid "Ambiguous file action:"
+msgstr "Aksi file tidak jelas:"
+
+#: lazarusidestrconsts:dlgenvask
+msgid "Ask"
+msgstr "Tanya"
+
+#: lazarusidestrconsts:dlgautodel
+msgid "Auto delete file"
+msgstr "Otomatis menghapus file"
+
+#: lazarusidestrconsts:dlgautoren
+msgid "Auto rename file lowercase"
+msgstr "Otomatis mengganti nama file ke huruf kecil"
+
+#: lazarusidestrconsts:dlgnoautomaticrenaming
+msgid "no automatic renaming"
+msgstr "Tanpa otomatis penggantian nama"
+
+#: lazarusidestrconsts:dlgambigwarn
+msgid "Warn on compile"
+msgstr "Peringatan saat kompilasi"
+
+#: lazarusidestrconsts:dlgignoreverb
+msgid "Ignore"
+msgstr "Abaikan"
+
+#: lazarusidestrconsts:dlgbackcolor
+msgid "Background"
+msgstr "Latar belakang"
+
+#: lazarusidestrconsts:dlgsubpropkcolor
+msgid "Subpropertes"
+msgstr "Sub properti"
+
+#: lazarusidestrconsts:dlgreferencecolor
+msgid "Reference"
+msgstr "Referensi"
+
+#: lazarusidestrconsts:dlgvaluecolor
+msgid "Value"
+msgstr "Nilai"
+
+#: lazarusidestrconsts:dlgdefvaluecolor
+msgid "Default value"
+msgstr "Nilai default"
+
+#: lazarusidestrconsts:dlgpropnamecolor
+msgid "Property name"
+msgstr "Nama properti"
+
+#: lazarusidestrconsts:dlgoimiscellaneous
+msgid "Miscellaneous"
+msgstr "Lain-lain"
+
+#: lazarusidestrconsts:dlgoiitemheight
+msgid "Item height"
+msgstr "Tinggi item"
+
+#: lazarusidestrconsts:lisshowhintsinobjectinspector
+msgid "Show hints in Object Inspector"
+msgstr "Tampilkan petunjuk dalam Inspektor Objek"
+
+#: lazarusidestrconsts:dlgenvcolors
+msgid "Colors"
+msgstr "Warna"
+
+#: lazarusidestrconsts:dlgenvbackuphelpnote
+msgid "Notes: Project files are all files in the project directory"
+msgstr "Catatan: File Proyek adalah semua file dalam direktori proyek"
+
+#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
+msgid "Invalid compiler filename"
+msgstr "Nama file kompilator tidak benar"
+
+#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
+msgid "The compiler file \"%s\" is not an executable."
+msgstr "File kompilator \"%s\" bukan eksekutabel."
+
+#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
+msgid "Invalid make filename"
+msgstr "Nama file make tidak benar"
+
+#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
+msgid "The make file \"%s\" is not an executable."
+msgstr "File make \"%s\" bukan eksekutabel."
+
+#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
+msgid "Invalid debugger filename"
+msgstr "Nama file debugger tidak benar"
+
+#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
+msgid "The debugger file \"%s\" is not an executable."
+msgstr "File debugger \"%s\" bukan eksekutabel."
+
+#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
+msgid "Directory not found"
+msgstr "Direktori tidak ditemukan"
+
+#: lazarusidestrconsts:lisinstallationfailed
+msgid "Installation failed"
+msgstr "Instalasi gagal"
+
+#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
+msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
+msgstr "Paket %s%s%s gagal dikompilasi.%sHapus dari daftar instalasi?"
+
+#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
+msgid "Lazarus directory \"%s\" not found."
+msgstr "Direktori Lazarus \"%s\" tidak ditemukan."
+
+#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
+msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
+msgstr "Direktori Lazarus \"%s\" sepertinya tidak benar. Biasanya berisi direktori seperti lcl, debugger, designer, components, ... ."
+
+#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
+msgid "FPC source directory \"%s\" not found."
+msgstr "Direktori sumber \"%s\" tidak ditemukan."
+
+#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
+msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ."
+msgstr "Direktori sumber FPC \"%s\" sepertinya tidak benar. Biasanya berisi direktori seperti rtl, fcl, packages, compiler, ... ."
+
+#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
+msgid "Test directory \"%s\" not found."
+msgstr "Direktori Tes \"%s\" tidak ditemukan."
+
+#: lazarusidestrconsts:dlgeddisplay
+msgid "Display"
+msgstr "Tampilan"
+
+#: lazarusidestrconsts:liseotabwidths
+msgid "Tab widths"
+msgstr "Panjang Tab"
+
+#: lazarusidestrconsts:dlgkeymapping
+msgid "Key Mappings"
+msgstr "Pemetaan Kunci"
+
+#: lazarusidestrconsts:dlgedcolor
+msgid "Color"
+msgstr "Warna"
+
+#: lazarusidestrconsts:dlgkeymappingerrors
+msgid "Key mapping errors"
+msgstr "Pemetaan kunci salah"
+
+#: lazarusidestrconsts:dlgedback
+msgid "Back"
+msgstr "Kembali"
+
+#: lazarusidestrconsts:dlgreport
+msgid "Report"
+msgstr "Laporan"
+
+#: lazarusidestrconsts:dlgednoerr
+msgid "No errors in key mapping found."
+msgstr "Tidak ditemukan kesalahan dalam pemetaan kunci."
+
+#: lazarusidestrconsts:dlgdeltemplate
+msgid "Delete template "
+msgstr "Hapus template"
+
+#: lazarusidestrconsts:dlgchscodetempl
+msgid "Choose code template file (*.dci)"
+msgstr "Pilih file template kode (*.dci)"
+
+#: lazarusidestrconsts:dlgallfiles
+msgid "All files"
+msgstr "Semua file"
+
+#: lazarusidestrconsts:lislazarusunit
+msgid "Lazarus unit"
+msgstr "Unit Lazarus"
+
+#: lazarusidestrconsts:lislazarusproject
+msgid "Lazarus project"
+msgstr "Proyek Lazarus"
+
+#: lazarusidestrconsts:lislazarusform
+msgid "Lazarus form"
+msgstr "Form Lazarus"
+
+#: lazarusidestrconsts:lislazaruspackage
+msgid "Lazarus package"
+msgstr "Paket Lazarus"
+
+#: lazarusidestrconsts:lislazarusprojectsource
+msgid "Lazarus project source"
+msgstr "Sumber proyek Lazarus"
+
+#: lazarusidestrconsts:dlgaltsetclmode
+msgid "Alt-Key sets column mode"
+msgstr "Mode kolom set Alt-Key"
+
+#: lazarusidestrconsts:dlgalwaysvisiblecaret
+msgid "Always visible caret"
+msgstr "Selalu menampilkan caret"
+
+#: lazarusidestrconsts:dlgautoident
+msgid "Auto indent"
+msgstr "Otomatis indent"
+
+#: lazarusidestrconsts:dlgbrachighlight
+msgid "Bracket highlighting"
+msgstr "Penandaan Kurung"
+
+#: lazarusidestrconsts:dlgdragdroped
+msgid "Drag Drop editing"
+msgstr "Pengeditan Drag Drop"
+
+#: lazarusidestrconsts:dlgdropfiles
+msgid "Drop files"
+msgstr "File Drop"
+
+#: lazarusidestrconsts:dlghalfpagescroll
+msgid "Half page scroll"
+msgstr "Gulung setengah halaman"
+
+#: lazarusidestrconsts:dlgkeepcaretx
+msgid "Keep caret X position"
+msgstr "Biarkan posisi caet X"
+
+#: lazarusidestrconsts:dlgpersistentcaret
+msgid "Persistent caret"
+msgstr "Caret tetap"
+
+#: lazarusidestrconsts:dlgcaretskipsselection
+msgid "Caret skips selection"
+msgstr "Pemilihan melewati caret"
+
+#: lazarusidestrconsts:dlgrightmousemovescursor
+msgid "Right mouse moves caret"
+msgstr "Kanan mouse memindahkan caret"
+
+#: lazarusidestrconsts:dlgscrollbyoneless
+msgid "Scroll by one less"
+msgstr "Gulung dengan kurang satu"
+
+#: lazarusidestrconsts:dlgscrollpastendfile
+msgid "Scroll past end of file"
+msgstr "Gulung ke akhir file"
+
+#: lazarusidestrconsts:dlgscrollpastendline
+msgid "Scroll past end of line"
+msgstr "Gulung ke akhir baris"
+
+#: lazarusidestrconsts:dlgclosebuttonsnotebook
+msgid "Show close buttons in notebook"
+msgstr "Tampilkan tombol tutup dalam notebook"
+
+#: lazarusidestrconsts:dlgshowscrollhint
+msgid "Show scroll hint"
+msgstr "Tampilkan petunjuk menggulung"
+
+#: lazarusidestrconsts:dlgmouselinks
+msgid "Mouse links"
+msgstr "Link mouse"
+
+#: lazarusidestrconsts:dlgshowgutterhints
+msgid "Show gutter hints"
+msgstr "Tampilkan petunjuk saluran"
+
+#: lazarusidestrconsts:dlgsmarttabs
+msgid "Smart tabs"
+msgstr "Tab pintar"
+
+#: lazarusidestrconsts:dlgtabstospaces
+msgid "Tabs to spaces"
+msgstr "Tab ke spasi"
+
+#: lazarusidestrconsts:dlgtabindent
+msgid "Tab indents blocks"
+msgstr "Tab memajukan blok"
+
+#: lazarusidestrconsts:dlgtrimtrailingspaces
+msgid "Trim trailing spaces"
+msgstr "Hapus sisa spasi"
+
+#: lazarusidestrconsts:dlgundoaftersave
+msgid "Undo after save"
+msgstr "Undo setelah menyimpan"
+
+#: lazarusidestrconsts:dlgdoubleclickline
+msgid "Double click line"
+msgstr "Klik ganda baris"
+
+#: lazarusidestrconsts:dlgfindtextatcursor
+msgid "Find text at cursor"
+msgstr "Cari teks di kursor"
+
+#: lazarusidestrconsts:dlgusesyntaxhighlight
+msgid "Use syntax highlight"
+msgstr "Gunakan penerangan sintaks"
+
+#: lazarusidestrconsts:dlgusecodefolding
+msgid "Code folding (experimental)"
+msgstr "Pelipatan kode (eksperimental)"
+
+#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
+msgid "Copy word on copy none"
+msgstr "Copy kata pada copy kosong"
+
+#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
+msgid "Home key jumps to nearest start"
+msgstr "Kunci Home melompat ke awal terdekat"
+
+#: lazarusidestrconsts:dlgblockindent
+msgid "Block indent"
+msgstr "Indent blok"
+
+#: lazarusidestrconsts:dlgundolimit
+msgid "Undo limit"
+msgstr "Batas Undo"
+
+#: lazarusidestrconsts:dlgtabwidths
+msgid "Tab widths"
+msgstr "Panjang tab"
+
+#: lazarusidestrconsts:dlgmargingutter
+msgid "Margin and gutter"
+msgstr "Margin dan saluran"
+
+#: lazarusidestrconsts:dlgvisiblerightmargin
+msgid "Visible right margin"
+msgstr "Nampak margin kanan"
+
+#: lazarusidestrconsts:dlgvisiblegutter
+msgid "Visible gutter"
+msgstr "Nampak saluran"
+
+#: lazarusidestrconsts:dlgshowlinenumbers
+msgid "Show line numbers"
+msgstr "Tampilkan nomor baris"
+
+#: lazarusidestrconsts:dlgshowcompilinglinenumbers
+msgid "Show line numbers"
+msgstr "Tampilkan nomor baris"
+
+#: lazarusidestrconsts:dlgrightmargin
+msgid "Right margin"
+msgstr "Margin kanan"
+
+#: lazarusidestrconsts:dlgrightmargincolor
+msgid "Right margin color"
+msgstr "Warna margin kanan"
+
+#: lazarusidestrconsts:dlggutterwidth
+msgid "Gutter width"
+msgstr "Panjang saluran"
+
+#: lazarusidestrconsts:dlgguttercolor
+msgid "Gutter color"
+msgstr "Warna saluran"
+
+#: lazarusidestrconsts:dlgeditorfont
+msgid "Editor font"
+msgstr "Font editor"
+
+#: lazarusidestrconsts:dlgdefaulteditorfont
+msgid "Default editor font"
+msgstr "Font editor default"
+
+#: lazarusidestrconsts:dlgeditorfontheight
+msgid "Editor font height"
+msgstr "Tinggi font editor"
+
+#: lazarusidestrconsts:dlgextralinespacing
+msgid "Extra line spacing"
+msgstr "baris spasi ekstra"
+
+#: lazarusidestrconsts:dlgkeymappingscheme
+msgid "Key Mapping Scheme"
+msgstr "Skema Pemetaan Kunci"
+
+#: lazarusidestrconsts:dlgcheckconsistency
+msgid "Check consistency"
+msgstr "Periksa konsistensi"
+
+#: lazarusidestrconsts:lisedoptschoosescheme
+msgid "Choose Scheme"
+msgstr "Pilih Skema"
+
+#: lazarusidestrconsts:dlgedhintcommand
+msgid "Hint: click on the command you want to edit"
+msgstr "Petunjuk: klik pada perintah yang ingin anda edit"
+
+#: lazarusidestrconsts:dlglang
+msgid "Language:"
+msgstr "Bahasa:"
+
+#: lazarusidestrconsts:dlgclrscheme
+msgid "Color Scheme:"
+msgstr "Skema Warna:"
+
+#: lazarusidestrconsts:dlgfileexts
+msgid "File extensions:"
+msgstr "Ekstensi File:"
+
+#: lazarusidestrconsts:dlgedelement
+msgid "Element"
+msgstr "Elemen"
+
+#: lazarusidestrconsts:dlgsetelementdefault
+msgid "Set element to default"
+msgstr "Set elemen ke default"
+
+#: lazarusidestrconsts:dlgsetallelementdefault
+msgid "Set all elements to default"
+msgstr "Set semua elemen ke default"
+
+#: lazarusidestrconsts:dlgforecolor
+msgid "Foreground color"
+msgstr "Warna latar depan"
+
+#: lazarusidestrconsts:dlgedusedefcolor
+msgid "Use default color"
+msgstr "Gunakan warna default"
+
+#: lazarusidestrconsts:dlgtextattributes
+msgid "Text attributes"
+msgstr "Atribut teks"
+
+#: lazarusidestrconsts:dlgedbold
+msgid "Bold"
+msgstr "Tebal"
+
+#: lazarusidestrconsts:dlgedital
+msgid "Italic"
+msgstr "Miring"
+
+#: lazarusidestrconsts:dlgedunder
+msgid "Underline"
+msgstr "Garis bawah"
+
+#: lazarusidestrconsts:dlgedidcomlet
+msgid "Identifier completion"
+msgstr "Pelengkapan pengenal"
+
+#: lazarusidestrconsts:dlgedcodeparams
+msgid "Code parameters"
+msgstr "Parameter kode"
+
+#: lazarusidestrconsts:dlgtooltipeval
+msgid "Tooltip expression evaluation"
+msgstr "Evaulasi ekspresi tooltip"
+
+#: lazarusidestrconsts:dlgtooltiptools
+msgid "Tooltip symbol Tools"
+msgstr "Piranti simbol tooltip"
+
+#: lazarusidestrconsts:dlgeddelay
+msgid "Delay"
+msgstr "Penangguhan"
+
+#: lazarusidestrconsts:dlgtimesecondunit
+msgid "sec"
+msgstr "det"
+
+#: lazarusidestrconsts:dlgedcodetempl
+msgid "Code templates"
+msgstr "Template kode"
+
+#: lazarusidestrconsts:dlgtplfname
+msgid "Template file name"
+msgstr "Nama file template"
+
+#: lazarusidestrconsts:dlgedadd
+msgid "Add..."
+msgstr "Tambah..."
+
+#: lazarusidestrconsts:dlgededit
+msgid "Edit..."
+msgstr "Edit..."
+
+#: lazarusidestrconsts:dlgeddelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: lazarusidestrconsts:dlgindentcodeto
+msgid "Indent code to"
+msgstr "Kode Indent ke"
+
+#: lazarusidestrconsts:dlgcodetoolstab
+msgid "Code Tools"
+msgstr "Piranti Kode"
+
+#: lazarusidestrconsts:lisautomaticfeatures
+msgid "Automatic features"
+msgstr "Fitur otomatis"
+
+#: lazarusidestrconsts:dlgcodetoolsopts
+msgid "CodeTools Options"
+msgstr "Opsi CodeTools"
+
+#: lazarusidestrconsts:dlgcodecreation
+msgid "Code Creation"
+msgstr "Pembuatan Kode"
+
+#: lazarusidestrconsts:dlgwordspolicies
+msgid "Words"
+msgstr "Kata"
+
+#: lazarusidestrconsts:dlglinesplitting
+msgid "Line Splitting"
+msgstr "Pemisahan Baris"
+
+#: lazarusidestrconsts:dlgspacenotcosmos
+msgid "Space"
+msgstr "Spasi"
+
+#: lazarusidestrconsts:dlgadditionalsrcpath
+msgid "Additional Source search path for all projects (.pp;.pas)"
+msgstr "Path pencarian Sumber Tambahan untuk semua proyek (.pp;.pas)"
+
+#: lazarusidestrconsts:dlgjumpingetc
+msgid "Jumping (e.g. Method Jumping)"
+msgstr "Lompatan (contoh Lompatan Metode)"
+
+#: lazarusidestrconsts:dlgadjusttopline
+msgid "Adjust top line due to comment in front"
+msgstr "Sesuaikan baris atas karena komentar di depan"
+
+#: lazarusidestrconsts:dlgcentercursorline
+msgid "Center Cursor Line"
+msgstr "Tengahkan Baris Kursor"
+
+#: lazarusidestrconsts:dlgcursorbeyondeol
+msgid "Cursor beyond EOL"
+msgstr "Kursor setelah EOL"
+
+#: lazarusidestrconsts:dlgclassinsertpolicy
+msgid "Class part insert policy"
+msgstr "Bagian Class menyisipkan kebijakan"
+
+#: lazarusidestrconsts:dlgalphabetically
+msgid "Alphabetically"
+msgstr "Secara alfabetik"
+
+#: lazarusidestrconsts:dlgcdtlast
+msgid "Last"
+msgstr "Terakhir"
+
+#: lazarusidestrconsts:dlgmixmethodsandproperties
+msgid "Mix methods and properties"
+msgstr "Campur metode dan properti"
+
+#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
+msgid "Procedure insert policy"
+msgstr "Kebijakan penyisipan Procedure"
+
+#: lazarusidestrconsts:dlglast
+msgid "Last (i.e. at end of source)"
+msgstr "Terakhir (contoh di akhir dari sumber)"
+
+#: lazarusidestrconsts:dlginfrontofmethods
+msgid "In front of methods"
+msgstr "Di depan metode"
+
+#: lazarusidestrconsts:dlgbehindmethods
+msgid "Behind methods"
+msgstr "Disamping metode"
+
+#: lazarusidestrconsts:dlgforwardprocskeeporder
+msgid "Keep order of procedures"
+msgstr "Biarkan urutan dari procedure"
+
+#: lazarusidestrconsts:dlgmethodinspolicy
+msgid "Method insert policy"
+msgstr "Kebijakan penyisipan Metode"
+
+#: lazarusidestrconsts:dlgcdtclassorder
+msgid "Class order"
+msgstr "Urutan Class"
+
+#: lazarusidestrconsts:dlgkeywordpolicy
+msgid "Keyword policy"
+msgstr "Kebijakan Kata kunci"
+
+#: lazarusidestrconsts:dlgcdtlower
+msgid "lowercase"
+msgstr "huruf kecil"
+
+#: lazarusidestrconsts:dlgcdtuppercase
+msgid "UPPERCASE"
+msgstr "HURUF BESAR"
+
+#: lazarusidestrconsts:dlg1up2low
+msgid "Lowercase, first letter up"
+msgstr "Huruf kecil, huruf pertama besar"
+
+#: lazarusidestrconsts:dlgidentifierpolicy
+msgid "Identifier policy"
+msgstr "Kebijakan pengenal"
+
+#: lazarusidestrconsts:dlgpropertycompletion
+msgid "Property completion"
+msgstr "Melengkapi properti"
+
+#: lazarusidestrconsts:lisheadercommentforclass
+msgid "Header comment for class"
+msgstr "Komentar header untuk class"
+
+#: lazarusidestrconsts:dlgcompleteproperties
+msgid "Complete properties"
+msgstr "Lengkapi properti"
+
+#: lazarusidestrconsts:dlgcdtreadprefix
+msgid "Read prefix"
+msgstr "Prefiks Read"
+
+#: lazarusidestrconsts:dlgcdtwriteprefix
+msgid "Write prefix"
+msgstr "Prefiks Write"
+
+#: lazarusidestrconsts:dlgcdtstoredpostfix
+msgid "Stored postfix"
+msgstr "Akhiran Stored"
+
+#: lazarusidestrconsts:dlgcdtvariableprefix
+msgid "Variable prefix"
+msgstr "Prefiks Variable"
+
+#: lazarusidestrconsts:dlgsetpropertyvariable
+msgid "Set property Variable"
+msgstr "Set property Variable"
+
+#: lazarusidestrconsts:dlgmaxlinelength
+msgid "Max line length:"
+msgstr "Maks panjang baris:"
+
+#: lazarusidestrconsts:dlgnotsplitlinefront
+msgid "Do not split line In front of:"
+msgstr "Jangan pisah baris Di depan dari:"
+
+#: lazarusidestrconsts:dlgnotsplitlineafter
+msgid "Do not split line after:"
+msgstr "Jangan pisah baris setelah:"
+
+#: lazarusidestrconsts:dlgcdtpreview
+msgid "Preview (Max line length = 1)"
+msgstr "Peninjauan (Maks panjang baris = 1)"
+
+#: lazarusidestrconsts:dlginsspacefront
+msgid "Insert space in front of"
+msgstr "Sisipkan spasi di depan"
+
+#: lazarusidestrconsts:dlginsspaceafter
+msgid "Insert space after"
+msgstr "Sisipkan spasi setelah"
+
+#: lazarusidestrconsts:dlgwrdpreview
+msgid "Preview"
+msgstr "Peninjauan"
+
+#: lazarusidestrconsts:locwndsrceditor
+msgid "Lazarus Source Editor"
+msgstr "Editor Sumber Lazarus"
+
+#: lazarusidestrconsts:dlgcompileroptions
+msgid "Compiler Options"
+msgstr "Opsi Kompilator"
+
+#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
+msgid "Online Help not yet implemented"
+msgstr "Panduan Online belum diimplementasikan"
+
+#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
+msgid "Right click on the items tree to get the popupmenu with all available package functions."
+msgstr "Klik kanan pada susunan item untuk mendapatkan menu popup dengan semua fungsi paket yang tersedia"
+
+#: lazarusidestrconsts:dlgsearchpaths
+msgid "Paths"
+msgstr "Path"
+
+#: lazarusidestrconsts:dlgcoparsing
+msgid "Parsing"
+msgstr "Penguraian"
+
+#: lazarusidestrconsts:dlgcodegeneration
+msgid "Code"
+msgstr "Kode"
+
+#: lazarusidestrconsts:dlgcolinking
+msgid "Linking"
+msgstr "Penggabungan"
+
+#: lazarusidestrconsts:dlgcomessages
+msgid "Messages"
+msgstr "Pesan"
+
+#: lazarusidestrconsts:dlgcoother
+msgid "Other"
+msgstr "Lainnya"
+
+#: lazarusidestrconsts:dlgcoinherited
+msgid "Inherited"
+msgstr "Diturunkan"
+
+#: lazarusidestrconsts:dlgcocompilation
+msgid "Compilation"
+msgstr "Kompilasi"
+
+#: lazarusidestrconsts:lisbrowseforcompiler
+msgid "Browse for Compiler (%s)"
+msgstr "Melihat Kompilator (%s)"
+
+#: lazarusidestrconsts:lisunitoutputdirectory
+msgid "Unit Output directory"
+msgstr "Direktori Output Unit"
+
+#: lazarusidestrconsts:lisselectanode
+msgid "Select a node"
+msgstr "Pilih node"
+
+#: lazarusidestrconsts:dlgshowcompileroptions
+msgid "Show compiler options"
+msgstr "Opsi tampilan kompilator"
+
+#: lazarusidestrconsts:dlgcoopts
+msgid "Options: "
+msgstr "Opsi:"
+
+#: lazarusidestrconsts:dlgcostyle
+msgid "Style:"
+msgstr "Gaya:"
+
+#: lazarusidestrconsts:lisnocompileroptionsinherited
+msgid "No compiler options inherited."
+msgstr "Tidak ada opsi kompilator diturunkan."
+
+#: lazarusidestrconsts:lisunitpath
+msgid "unit path"
+msgstr "path unit"
+
+#: lazarusidestrconsts:lisincludepath
+msgid "include path"
+msgstr "path include"
+
+#: lazarusidestrconsts:lisobjectpath
+msgid "object path"
+msgstr "path objek"
+
+#: lazarusidestrconsts:lislibrarypath
+msgid "library path"
+msgstr "path pustaka"
+
+#: lazarusidestrconsts:lislinkeroptions
+msgid "linker options"
+msgstr "opsi penggabung"
+
+#: lazarusidestrconsts:liscustomoptions
+msgid "custom options"
+msgstr "opsi kustom"
+
+#: lazarusidestrconsts:dlgcoasis
+msgid "As-Is"
+msgstr "Seadanya"
+
+#: lazarusidestrconsts:dlgsyntaxoptions
+msgid "Syntax options"
+msgstr "Opsi sintaks"
+
+#: lazarusidestrconsts:dlgdelphi2ext
+msgid "Delphi 2 Extensions"
+msgstr "Ekstensi Delphi 2"
+
+#: lazarusidestrconsts:dlgcocops
+msgid "C Style Operators (*=, +=, /= and -=)"
+msgstr "Operator Gaya C (*=, +=, /= and -=)"
+
+#: lazarusidestrconsts:dlgassertcode
+msgid "Include Assertion Code"
+msgstr "Sertakan Kode Assertion"
+
+#: lazarusidestrconsts:dlglabelgoto
+msgid "Allow LABEL and GOTO"
+msgstr "Ijinkan LABEL dan GOTO"
+
+#: lazarusidestrconsts:dlgcppinline
+msgid "C++ Styled INLINE"
+msgstr "Gaya C++ INLINE"
+
+#: lazarusidestrconsts:dlgcmacro
+msgid "C Style Macros (global)"
+msgstr "Gaya Makro C (global)"
+
+#: lazarusidestrconsts:dlgbp7cptb
+msgid "TP/BP 7.0 Compatible"
+msgstr "Kompatibel TP/BP 7.0"
+
+#: lazarusidestrconsts:dlginitdoneonly
+msgid "Constructor name must be 'init' (destructor must be 'done')"
+msgstr "Nama Constructor harus 'init' (destructor harus 'done')"
+
+#: lazarusidestrconsts:dlgstatickeyword
+msgid "Static Keyword in Objects"
+msgstr "Kata kunci statik dalam Objek"
+
+#: lazarusidestrconsts:dlgdeplhicomp
+msgid "Delphi Compatible"
+msgstr "Kompatibel Delphi"
+
+#: lazarusidestrconsts:dlgcoansistr
+msgid "Use Ansi Strings"
+msgstr "Gunakan Ansi Strings"
+
+#: lazarusidestrconsts:dlggpccomp
+msgid "GPC (GNU Pascal Compiler) Compatible"
+msgstr "Kompatibel GPC (GNU Pascal Compiler)"
+
+#: lazarusidestrconsts:dlgcounitstyle
+msgid "Unit Style:"
+msgstr "Gaya Unit:"
+
+#: lazarusidestrconsts:dlgcosmartlinkable
+msgid "Smart Linkable"
+msgstr "Linkable Pintar"
+
+#: lazarusidestrconsts:dlgcochecks
+msgid "Checks:"
+msgstr "Periksa:"
+
+#: lazarusidestrconsts:dlgcorange
+msgid "Range"
+msgstr "Jangkauan"
+
+#: lazarusidestrconsts:dlgcooverflow
+msgid "Overflow"
+msgstr "Kelebihan"
+
+#: lazarusidestrconsts:dlgcostack
+msgid "Stack"
+msgstr "Tumpukan"
+
+#: lazarusidestrconsts:dlgheapsize
+msgid "Heap Size"
+msgstr "Besar Heap"
+
+#: lazarusidestrconsts:dlgcogenerate
+msgid "Generate:"
+msgstr "Hasilkan:"
+
+#: lazarusidestrconsts:dlgconormal
+msgid "Normal Code"
+msgstr "Kode Normal"
+
+#: lazarusidestrconsts:dlgcofast
+msgid "Faster Code"
+msgstr "Kode Lebih Cepat"
+
+#: lazarusidestrconsts:dlgcosmaller
+msgid "Smaller Code"
+msgstr "Kode Lebih Kecil"
+
+#: lazarusidestrconsts:dlgtargetproc
+msgid "Target i386"
+msgstr "Target i386"
+
+#: lazarusidestrconsts:dlgtargetplatform
+msgid "Target Platform:"
+msgstr "Target Platform:"
+
+#: lazarusidestrconsts:dlgoptimiz
+msgid "Optimizations:"
+msgstr "Optimasi:"
+
+#: lazarusidestrconsts:dlgcokeepvarsreg
+msgid "Keep certain variables in registers"
+msgstr "Biarkan variabel tertentu dalam register"
+
+#: lazarusidestrconsts:dlguncertopt
+msgid "Uncertain Optimizations"
+msgstr "Optimasi Tidak pasti"
+
+#: lazarusidestrconsts:dlglevelnoneopt
+msgid "Level 0 (no extra Optimizations)"
+msgstr "Tingkat 0 (tidak ada Optimasi ekstra)"
+
+#: lazarusidestrconsts:dlglevel1opt
+msgid "Level 1 (Quick Optimizations)"
+msgstr "Tingkat 1 (Optimasi Cepat)"
+
+#: lazarusidestrconsts:dlglevel2opt
+msgid "Level 2 (Level 1 + Slower Optimizations)"
+msgstr "Tingkat 2 (Tingkat 1 + Optimasi Lebih Lambat)"
+
+#: lazarusidestrconsts:dlglevel3opt
+msgid "Level 3 (Level 2 + Uncertain)"
+msgstr "Tingkat 3 (Tingkat 2 + Tidak pasti)"
+
+#: lazarusidestrconsts:dlgtargetos
+msgid "Target OS"
+msgstr "Target OS"
+
+#: lazarusidestrconsts:dlgtargetcpu
+msgid "Target CPU"
+msgstr "Target CPU"
+
+#: lazarusidestrconsts:dlgcodebugging
+msgid "Debugging:"
+msgstr "Debugging:"
+
+#: lazarusidestrconsts:dlgcogdb
+msgid "Generate Debugging Info For GDB (Slows Compiling)"
+msgstr "hasilkan Info Debugging untuk GDB (Kompilasi Lambat)"
+
+#: lazarusidestrconsts:dlgcodbx
+msgid "Generate Debugging Info For DBX (Slows Compiling)"
+msgstr "Hasilkan Info Debugging untuk DBX (Kompilasi Lambat)"
+
+#: lazarusidestrconsts:dlglnumsbct
+msgid "Display Line Numbers in Run-time Error Backtraces"
+msgstr "Tampilkan Nomor Baris dalam Penelusuran Kesalahan Run-time"
+
+#: lazarusidestrconsts:dlgcoheaptrc
+msgid "Use Heaptrc Unit"
+msgstr "Gunakan Unit Heaptrc"
+
+#: lazarusidestrconsts:dlgcovalgrind
+msgid "Generate code for valgrind"
+msgstr "Hasilkan kode untuk valgrind"
+
+#: lazarusidestrconsts:dlggprof
+msgid "Generate code for gprof"
+msgstr "Hasilkan kode untuk gprof"
+
+#: lazarusidestrconsts:dlgcostrip
+msgid "Strip Symbols From Executable"
+msgstr "Hilangkan Simbol Dari Eksekutabel"
+
+#: lazarusidestrconsts:dlglinklibraries
+msgid "Link Style:"
+msgstr "Gaya Link:"
+
+#: lazarusidestrconsts:dlglinksmart
+msgid "Link Smart"
+msgstr "Link Pintar"
+
+#: lazarusidestrconsts:dlgpassoptslinker
+msgid "Pass Options To The Linker (Delimiter is space)"
+msgstr "Opsi Operan Ke Penggabung (Pemisah adalah spasi)"
+
+#: lazarusidestrconsts:liscotargetosspecificoptions
+msgid "Target OS specific options"
+msgstr "Opsi khusus Target OS"
+
+#: lazarusidestrconsts:dlgverbosity
+msgid "Verbosity during compilation:"
+msgstr "Perlihatkan selama kompilasi:"
+
+#: lazarusidestrconsts:dlgcoshowerr
+msgid "Show Errors"
+msgstr "Tampilkan Kesalahan"
+
+#: lazarusidestrconsts:dlgshowwarnings
+msgid "Show Warnings"
+msgstr "Tampilkan Peringatan"
+
+#: lazarusidestrconsts:dlgshownotes
+msgid "Show Notes"
+msgstr "Tampilkan Catatan"
+
+#: lazarusidestrconsts:dlgshowhint
+msgid "Show Hints"
+msgstr "Tampilkan Petunjuk"
+
+#: lazarusidestrconsts:dlgshowgeneralinfo
+msgid "Show general info"
+msgstr "Tampilkan info umum"
+
+#: lazarusidestrconsts:dlgshowprocserror
+msgid "Show all procs on error"
+msgstr "Tampilkan semua procs pada kecalahan"
+
+#: lazarusidestrconsts:dlgshoweverything
+msgid "Show everything"
+msgstr "Tampilkan apapun"
+
+#: lazarusidestrconsts:dlgshowsummary
+msgid "Show summary"
+msgstr "Tampilkan ringkasan"
+
+#: lazarusidestrconsts:dlgshowdebuginfo
+msgid "Show debug info"
+msgstr "Tampilkan info debug"
+
+#: lazarusidestrconsts:dlgshowusedfiles
+msgid "Show used files"
+msgstr "Tampilkan file yang digunakan"
+
+#: lazarusidestrconsts:dlgshowtriedfiles
+msgid "Show tried files"
+msgstr "Tampilkan file yang dicoba"
+
+#: lazarusidestrconsts:dlgshowdefinedmacros
+msgid "Show defined macros"
+msgstr "Tampilkan makro yang ditetapkan"
+
+#: lazarusidestrconsts:dlgshowcompiledprocedures
+msgid "Show compiled procedures"
+msgstr "Tampilkan procedure yang dikompilasi"
+
+#: lazarusidestrconsts:dlgshowconditionals
+msgid "Show conditionals"
+msgstr "Tampilkan kondisional"
+
+#: lazarusidestrconsts:dlgshowexecutableinfo
+msgid "Show executable info (Win32 only)"
+msgstr "Tampilkan info eksekutabel (hanya Win32)"
+
+#: lazarusidestrconsts:dlgshownothing
+msgid "Show nothing (only errors)"
+msgstr "Tidak menampilkan apapun (hanya kesalahan)"
+
+#: lazarusidestrconsts:dlgwritefpclogo
+msgid "Write an FPC logo"
+msgstr "Tulis logo FPC"
+
+#: lazarusidestrconsts:dlghintsunused
+msgid "Show Hints for unused units in main source"
+msgstr "Tampilkan Petunjuk untuk unit yang tidak digunakan dalam sumber utama"
+
+#: lazarusidestrconsts:dlghintsparametersendernotused
+msgid "Show Hints for parameter \"Sender\" not used"
+msgstr "Tampilkan Petunjuk untuk parameter \"Sender\" tidak digunakan"
+
+#: lazarusidestrconsts:dlgconfigfiles
+msgid "Config Files:"
+msgstr "File Konfig:"
+
+#: lazarusidestrconsts:dlgusefpccfg
+msgid "Use standard Compiler Config File (fpc.cfg)"
+msgstr "Gunakan File Konfig Kompilator standar (fpc.cfg)"
+
+#: lazarusidestrconsts:dlgusecustomconfig
+msgid "Use addional Compiler Config File"
+msgstr "Gunakan File Konfig Kompilator tambahan"
+
+#: lazarusidestrconsts:liscustomoptions2
+msgid "Custom options"
+msgstr "Opsi Kustom"
+
+#: lazarusidestrconsts:dlgstopafternrerr
+msgid "Stop after number of errors:"
+msgstr "Hentikan setelah sejumlah kesalahan:"
+
+#: lazarusidestrconsts:dlgotherunitfiles
+msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
+msgstr "File Unit Lain (-Fu) (Pemisah adalah titik koma):"
+
+#: lazarusidestrconsts:dlgcoincfiles
+msgid "Include Files (-Fi):"
+msgstr "File Include (-Fi):"
+
+#: lazarusidestrconsts:dlgcosources
+msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
+msgstr "Sumber Lain (file .pp/.pas, hanya digunakan oleh IDE bukan oleh kompilator)"
+
+#: lazarusidestrconsts:dlgcolibraries
+msgid "Libraries (-Fl):"
+msgstr "Pustaka (-Fl):"
+
+#: lazarusidestrconsts:dlgcodebugpath
+msgid "Debugger path addition (none):"
+msgstr "Tambahan path Debugger (tidak ada):"
+
+#: lazarusidestrconsts:liscompiler
+msgid "Compiler"
+msgstr "Kompilator"
+
+#: lazarusidestrconsts:listofpcpath
+msgid "Path:"
+msgstr "Path:"
+
+#: lazarusidestrconsts:liscoskipcallingcompiler
+msgid "Skip calling Compiler"
+msgstr "Lewati pemanggilan Kompilator"
+
+#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
+msgid "Ambiguous additional compiler config file"
+msgstr "File konfig kompilator tambahan tidak jelas"
+
+#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
+msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
+msgstr "Peringatan: file konfig kompilator tambahan mempunyai nama sama, seperti salah satu dari nama file konfig standar yang dicari kompilator FreePascal. Ini bisa berhasil HANYA penguraian konfig tambahan dan melewatkan konfig standar."
+
+#: lazarusidestrconsts:liscoclickokifaresuretodothat
+msgid "%s%sClick OK if you are sure to do that."
+msgstr "%s%sKlik OK jika anda yakin akan melakukannya."
+
+#: lazarusidestrconsts:liscocallon
+msgid "Call on:"
+msgstr "Panggilan pada:"
+
+#: lazarusidestrconsts:liscocalloncompile
+msgid "Compile"
+msgstr "Kompilasi"
+
+#: lazarusidestrconsts:liscocallonbuild
+msgid "Build"
+msgstr "Bangun"
+
+#: lazarusidestrconsts:liscocallonrun
+msgid "Run"
+msgstr "Jalankan"
+
+#: lazarusidestrconsts:liscoexecuteafter
+msgid "Execute after"
+msgstr "Jalankan setelah"
+
+#: lazarusidestrconsts:liscoexecutebefore
+msgid "Execute before"
+msgstr "Jalankan sebelum"
+
+#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
+msgid "Additional compiler options inherited from packages"
+msgstr "Opsi kompilator tambahan diturunkan dari paket"
+
+#: lazarusidestrconsts:liscocommand
+msgid "Command:"
+msgstr "Perintah:"
+
+#: lazarusidestrconsts:liscoscanforfpcmessages
+msgid "Scan for FPC messages"
+msgstr "Cari pesan FPC"
+
+#: lazarusidestrconsts:liscoscanformakemessages
+msgid "Scan for Make messages"
+msgstr "Cari pesan Make"
+
+#: lazarusidestrconsts:liscoshowallmessages
+msgid "Show all messages"
+msgstr "Tampilkan semua pesan"
+
+#: lazarusidestrconsts:dlgunitoutp
+msgid "Unit output directory (-FU):"
+msgstr "Direktori output unit (-FU):"
+
+#: lazarusidestrconsts:liscodefault
+msgid "default (%s)"
+msgstr "default (%s)"
+
+#: lazarusidestrconsts:dlgbutapply
+msgid "Apply"
+msgstr "Terapkan"
+
+#: lazarusidestrconsts:dlgcoshowoptions
+msgid "Show Options"
+msgstr "Tampilkan Opsi"
+
+#: lazarusidestrconsts:dlgcoloadsave
+msgid "Load/Save"
+msgstr "Ambil/Simpan"
+
+#: lazarusidestrconsts:dlgmainviewforms
+msgid "View project forms"
+msgstr "Lihat form proyek"
+
+#: lazarusidestrconsts:dlgmainviewunits
+msgid "View project units"
+msgstr "Lihat unit proyek"
+
+#: lazarusidestrconsts:dlgmultiselect
+msgid "Multi Select"
+msgstr "Pilihan Multi"
+
+#: lazarusidestrconsts:dlgprojectoptions
+msgid "Project Options"
+msgstr "Opsi Proyek"
+
+#: lazarusidestrconsts:dlgpoapplication
+msgid "Application"
+msgstr "Aplikasi"
+
+#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
+msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
+msgstr "Aplikasi%sProgram grafis lcl/freepascal. File program otomatis dipelihara oleh lazarus."
+
+#: lazarusidestrconsts:dlgpofroms
+msgid "Forms"
+msgstr "Forms"
+
+#: lazarusidestrconsts:dlgpomisc
+msgid "Miscellaneous"
+msgstr "Lain-lain"
+
+#: lazarusidestrconsts:dlgposavesession
+msgid "Session"
+msgstr "Sesi"
+
+#: lazarusidestrconsts:dlgapplicationsettings
+msgid "Application Settings"
+msgstr "Seting Aplikasi"
+
+#: lazarusidestrconsts:dlgpotitle
+msgid "Title:"
+msgstr "Judul:"
+
+#: lazarusidestrconsts:dlgpooutputsettings
+msgid "Output Settings"
+msgstr "Seting Output"
+
+#: lazarusidestrconsts:dlgpotargetfilename
+msgid "Target file name:"
+msgstr "Nama file target:"
+
+#: lazarusidestrconsts:dlgautocreateforms
+msgid "Auto-create forms:"
+msgstr "Otomatis-buat form:"
+
+#: lazarusidestrconsts:dlgavailableforms
+msgid "Available forms:"
+msgstr "Form tersedia:"
+
+#: lazarusidestrconsts:dlgautocreatenewforms
+msgid "When creating new forms, add them to auto-created forms"
+msgstr "ketika pembuatan form baru, tambahkan ke otomatis-buat form"
+
+#: lazarusidestrconsts:dlgsaveeditorinfo
+msgid "Save editor info for closed files"
+msgstr "Simpan info editor untuk file yang ditutup"
+
+#: lazarusidestrconsts:dlgsaveeditorinfoproject
+msgid "Save editor info only for project files"
+msgstr "Simpan info editor hanya untuk file proyek"
+
+#: lazarusidestrconsts:lismainunitispascalsource
+msgid "Main Unit is Pascal Source"
+msgstr "Unit Utama adalah Sumber Pascal"
+
+#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
+msgid "Main Unit has Uses Section containing all Units of project"
+msgstr "Unit Utama mempunyai Seksi Uses yang berisi semua Unit dari proyek"
+
+#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
+msgid "Main Unit has Application.CreateForm statements"
+msgstr "Unit Utama mempunyai pernyataan Application.CreateForm"
+
+#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
+msgid "Main Unit has Application.Title statements"
+msgstr "Unit Utama mempunyai pernyataan Application.Title"
+
+#: lazarusidestrconsts:lisprojectisrunnable
+msgid "Project is runnable"
+msgstr "Proyek bisa dijalankan"
+
+#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
+msgid "Always build (even if nothing changed)"
+msgstr "Selalu membangun (meskipun jika tidak ada yang berubah)"
+
+#: lazarusidestrconsts:dlgrunparameters
+msgid "Run parameters"
+msgstr "Parameter Menjalankan"
+
+#: lazarusidestrconsts:dlgrunolocal
+msgid "Local"
+msgstr "Lokal"
+
+#: lazarusidestrconsts:dlgrunoenvironment
+msgid "Environment"
+msgstr "Lingkungan"
+
+#: lazarusidestrconsts:dlghostapplication
+msgid "Host application"
+msgstr "Aplikasi Induk"
+
+#: lazarusidestrconsts:dlgcommandlineparams
+msgid "Command line parameters (without application name)"
+msgstr "Parameter baris perintah (tanpa nama aplikasi)"
+
+#: lazarusidestrconsts:dlguselaunchingapp
+msgid "Use launching application"
+msgstr "Gunakan aplikasi peluncuran"
+
+#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
+msgid "Launching application"
+msgstr "Meluncurkan aplikasi"
+
+#: lazarusidestrconsts:dlgroworkingdirectory
+msgid "Working directory"
+msgstr "Direktori Pekerjaan"
+
+#: lazarusidestrconsts:dlgrunodisplay
+msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
+msgstr "Tampilan (tidak untuk win32, contoh 198.112.45.11:0, x.org:1, hydra:0.1)"
+
+#: lazarusidestrconsts:dlgrunousedisplay
+msgid "Use display"
+msgstr "Gunakan tampilan"
+
+#: lazarusidestrconsts:dlgrunosystemvariables
+msgid "System variables"
+msgstr "Variabel sistem"
+
+#: lazarusidestrconsts:dlgrunovariable
+msgid "Variable"
+msgstr "Variabel"
+
+#: lazarusidestrconsts:dlgrunovalue
+msgid "Value"
+msgstr "Nilai"
+
+#: lazarusidestrconsts:dlgrunouseroverrides
+msgid "User overrides"
+msgstr "Penolakan pemakai"
+
+#: lazarusidestrconsts:dlgincludesystemvariables
+msgid "Include system variables"
+msgstr "Sertakan variabel sistem"
+
+#: lazarusidestrconsts:dlgdirectorydoesnotexist
+msgid "Directory does not exist"
+msgstr "Direktori tidak ada"
+
+#: lazarusidestrconsts:lisrunparamsfilenotexecutable
+msgid "File not executable"
+msgstr "File bukan eksekutabel"
+
+#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
+msgid "The host application %s%s%s is not executable."
+msgstr "Aplikasi induk %s%s%s bukan eksekutabel."
+
+#: lazarusidestrconsts:dlgthedirectory
+msgid "The directory \""
+msgstr "Direktori \""
+
+#: lazarusidestrconsts:dlgdoesnotexist
+msgid "\" does not exist."
+msgstr "\" tidak ada"
+
+#: lazarusidestrconsts:dlgtexttofing
+msgid "&Text to Find"
+msgstr "&Teks yang Dicari"
+
+#: lazarusidestrconsts:dlgreplacewith
+msgid "&Replace With"
+msgstr "&Ganti Dengan"
+
+#: lazarusidestrconsts:dlgfropts
+msgid "Options"
+msgstr "Opsi"
+
+#: lazarusidestrconsts:liscefilter
+msgid "(Filter)"
+msgstr "(Filter)"
+
+#: lazarusidestrconsts:dlgcasesensitive
+msgid "Case Sensitive"
+msgstr "Sensitif Huruf"
+
+#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
+msgid "Distinguish big and small letters e.g. A and a"
+msgstr "Bedakan huruf besar dan kecil contoh A dan a"
+
+#: lazarusidestrconsts:dlgwholewordsonly
+msgid "Whole Words Only"
+msgstr "Hanya Keseluruhan Kata"
+
+#: lazarusidestrconsts:lisonlysearchforwholewords
+msgid "Only search for whole words"
+msgstr "Hanya mencari seluruh kata"
+
+#: lazarusidestrconsts:dlgregularexpressions
+msgid "Regular Expressions"
+msgstr "Ekspresi Reguler"
+
+#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
+msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
+msgstr "Aktifkan aturan ekspresi reguler untuk teks dan penggantian (mirip sekali dengan perl)"
+
+#: lazarusidestrconsts:dlgmultiline
+msgid "Multi Line"
+msgstr "Multi Baris"
+
+#: lazarusidestrconsts:lisallowsearchingformultiplelines
+msgid "Allow searching for multiple lines"
+msgstr "Ijinkan pencarian untuk multipel baris"
+
+#: lazarusidestrconsts:dlgpromptonreplace
+msgid "Prompt On Replace"
+msgstr "Tanya Pada Penggantian"
+
+#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
+msgid "Ask before replacing each found text"
+msgstr "Tanya sebelum mengganti setiap teks yang ditemukan"
+
+#: lazarusidestrconsts:dlgsrorigin
+msgid "Origin"
+msgstr "Asalnya"
+
+#: lazarusidestrconsts:dlgfromcursor
+msgid "From Cursor"
+msgstr "Dari Kursor"
+
+#: lazarusidestrconsts:dlgentirescope
+msgid "Entire Scope"
+msgstr "Seluruh Cakupan"
+
+#: lazarusidestrconsts:dlgscope
+msgid "Scope"
+msgstr "Cakupan"
+
+#: lazarusidestrconsts:lisfriincurrentunit
+msgid "in current unit"
+msgstr "dalam unit saat ini"
+
+#: lazarusidestrconsts:lisfriinmainproject
+msgid "in main project"
+msgstr "dalam proyek utama"
+
+#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
+msgid "in project/package owning current unit"
+msgstr "dalam proyek/paket pemilik unit saat ini"
+
+#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
+msgid "in all open packages and projects"
+msgstr "dalam semua paket dan proyek terbuka"
+
+#: lazarusidestrconsts:lisfrirenameallreferences
+msgid "Rename all References"
+msgstr "Ganti nama semua Referensi"
+
+#: lazarusidestrconsts:dlgglobal
+msgid "Global"
+msgstr "Global"
+
+#: lazarusidestrconsts:dlgselectedtext
+msgid "Selected Text"
+msgstr "Teks Terpilih"
+
+#: lazarusidestrconsts:dlgdirection
+msgid "Direction"
+msgstr "Arah"
+
+#: lazarusidestrconsts:lisfrforwardsearch
+msgid "Forward search"
+msgstr "Pencarian maju"
+
+#: lazarusidestrconsts:lisfrbackwardsearch
+msgid "Backward search"
+msgstr "Pencarian mundur"
+
+#: lazarusidestrconsts:dlgupword
+msgid "Up"
+msgstr "Naik"
+
+#: lazarusidestrconsts:dlgdownword
+msgid "Down"
+msgstr "Turun"
+
+#: lazarusidestrconsts:dlgreplaceall
+msgid "Replace &All"
+msgstr "Ganti &Semua"
+
+#: lazarusidestrconsts:dlggetposition
+msgid "Get position"
+msgstr "Ambil posisi"
+
+#: lazarusidestrconsts:dlgleftpos
+msgid "Left:"
+msgstr "Kiri:"
+
+#: lazarusidestrconsts:dlgwidthpos
+msgid "Width:"
+msgstr "Panjang:"
+
+#: lazarusidestrconsts:dlgtoppos
+msgid "Top:"
+msgstr "Atas:"
+
+#: lazarusidestrconsts:dlgheightpos
+msgid "Height:"
+msgstr "Tinggi:"
+
+#: lazarusidestrconsts:rsiwpusewindowmanagersetting
+msgid "Use windowmanager setting"
+msgstr "Gunakan seting windowmanager"
+
+#: lazarusidestrconsts:rsiwpdefault
+msgid "Default"
+msgstr "Default"
+
+#: lazarusidestrconsts:rsiwprestorewindowgeometry
+msgid "Restore window geometry"
+msgstr "Simpan kembali geometri jendela"
+
+#: lazarusidestrconsts:rsiwpdocked
+msgid "Docked"
+msgstr "Menempel"
+
+#: lazarusidestrconsts:rsiwpcustomposition
+msgid "Custom position"
+msgstr "Posisi Kustom"
+
+#: lazarusidestrconsts:rsiwprestorewindowsize
+msgid "Restore window size"
+msgstr "Simpan kembali ukuran jendela"
+
+#: lazarusidestrconsts:liscodeexplorer
+msgid "Code Explorer"
+msgstr "Eksplorer Kode"
+
+#: lazarusidestrconsts:uemfinddeclaration
+msgid "&Find Declaration"
+msgstr "&Cari Deklarasi"
+
+#: lazarusidestrconsts:uemopenfileatcursor
+msgid "&Open file at cursor"
+msgstr "&Buka file di kursor"
+
+#: lazarusidestrconsts:uemclosepage
+msgid "&Close Page"
+msgstr "&Tutup Halaman"
+
+#: lazarusidestrconsts:uemcut
+msgid "Cut"
+msgstr "Cut"
+
+#: lazarusidestrconsts:uemcopy
+msgid "Copy"
+msgstr "Copy"
+
+#: lazarusidestrconsts:uempaste
+msgid "Paste"
+msgstr "Paste"
+
+#: lazarusidestrconsts:uemcopyfilename
+msgid "Copy filename"
+msgstr "Copy nama file"
+
+#: lazarusidestrconsts:uemgotobookmark
+msgid "&Goto Bookmark"
+msgstr "Per&gi ke penujuk"
+
+#: lazarusidestrconsts:uemsetfreebookmark
+msgid "Set a free Bookmark"
+msgstr "Set penunjuk bebas"
+
+#: lazarusidestrconsts:uemnextbookmark
+msgid "Goto next Bookmark"
+msgstr "Pergi ke Penunjuk berikutnya"
+
+#: lazarusidestrconsts:uemprevbookmark
+msgid "Goto previous Bookmark"
+msgstr "Pergi ke Penunjuk sebelumnya"
+
+#: lazarusidestrconsts:uembookmarkn
+msgid "Bookmark"
+msgstr "Penunjuk"
+
+#: lazarusidestrconsts:lisopenlfm
+msgid "Open %s"
+msgstr "Buka %s"
+
+#: lazarusidestrconsts:uemsetbookmark
+msgid "&Set Bookmark"
+msgstr "&Set Penunjuk"
+
+#: lazarusidestrconsts:uemreadonly
+msgid "Read Only"
+msgstr "Hanya Baca"
+
+#: lazarusidestrconsts:uemshowlinenumbers
+msgid "Show Line Numbers"
+msgstr "Tampilkan Niomor Baris"
+
+#: lazarusidestrconsts:uemshowunitinfo
+msgid "Unit Info"
+msgstr "Info Unit"
+
+#: lazarusidestrconsts:uemdebugword
+msgid "Debug"
+msgstr "Debug"
+
+#: lazarusidestrconsts:uemaddbreakpoint
+msgid "&Add Breakpoint"
+msgstr "&Tambah Breakpoint"
+
+#: lazarusidestrconsts:uemaddwatchatcursor
+msgid "Add &Watch At Cursor"
+msgstr "Tambah &Pengawasan Di Kursor"
+
+#: lazarusidestrconsts:uemruntocursor
+msgid "&Run to Cursor"
+msgstr "&Jalankan ke Kursor"
+
+#: lazarusidestrconsts:uemviewcallstack
+msgid "View Call Stack"
+msgstr "Lihat Panggilan Stack"
+
+#: lazarusidestrconsts:uemmoveeditorleft
+msgid "Move Editor Left"
+msgstr "Pindahkan Editor ke Kiri"
+
+#: lazarusidestrconsts:uemmoveeditorright
+msgid "Move Editor Right"
+msgstr "Pindahkan Editor ke Kanan"
+
+#: lazarusidestrconsts:uemrefactor
+msgid "Refactoring"
+msgstr "Refactoring"
+
+#: lazarusidestrconsts:uemcompletecode
+msgid "Complete Code"
+msgstr "Lengkapi Kode"
+
+#: lazarusidestrconsts:uemencloseselection
+msgid "Enclose Selection"
+msgstr "Tutup Pemilihan"
+
+#: lazarusidestrconsts:uemextractproc
+msgid "Extract Procedure"
+msgstr "Ekstrak Procedure"
+
+#: lazarusidestrconsts:ueminvertassignment
+msgid "Invert Assignment"
+msgstr "Balikkan Penempatan"
+
+#: lazarusidestrconsts:uemfindidentifierreferences
+msgid "Find Identifier References"
+msgstr "Cari Referensi Pengenal"
+
+#: lazarusidestrconsts:uemrenameidentifier
+msgid "Rename Identifier"
+msgstr "Ganti nama Pengenal"
+
+#: lazarusidestrconsts:uemeditorproperties
+msgid "Editor properties"
+msgstr "Properti Editor"
+
+#: lazarusidestrconsts:uenotimplcap
+msgid "Not implemented yet"
+msgstr "Belum Di Imlementasikan"
+
+#: lazarusidestrconsts:uenotimpltext
+msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
+msgstr "Jika anda bisa membantu kami untuk mengimplementasikan fitur ini, suratkan ke lazarus@miraclec.com"
+
+#: lazarusidestrconsts:uenotimplcapagain
+msgid "I told You: Not implemented yet"
+msgstr "Sudah saya bilang: Belum diimplementasikan"
+
+#: lazarusidestrconsts:uefilerocap
+msgid "File is readonly"
+msgstr "File adalah hanya-baca"
+
+#: lazarusidestrconsts:uefilerotext1
+msgid "The file \""
+msgstr "File \""
+
+#: lazarusidestrconsts:uefilerotext2
+msgid "\" is not writable."
+msgstr "\" tidak bisa ditulisi."
+
+#: lazarusidestrconsts:uemodified
+msgid "Modified"
+msgstr "Dimodifikasi"
+
+#: lazarusidestrconsts:uepreadonly
+msgid "Readonly"
+msgstr "Hanya-baca"
+
+#: lazarusidestrconsts:uepins
+msgid "INS"
+msgstr "INS"
+
+#: lazarusidestrconsts:uepovr
+msgid "OVR"
+msgstr "OVR"
+
+#: lazarusidestrconsts:lisuefontwith
+msgid "Font without UTF-8"
+msgstr "Font tanpa  UTF-8"
+
+#: lazarusidestrconsts:lisuethecurre
+msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
+msgstr "Font editor saat ini tidak mendukung UTF-8, tetapi sistem anda nampak menggunakannya. %sItu berarti karakter non ASCII mungkin akan ditampilk tidak benar. %sAnda bisa memilih font lain dalam opsi editor."
+
+#: lazarusidestrconsts:lisuedonotsho
+msgid "Do not show this message again."
+msgstr "Jangan tampilkan pesan ini lagi."
+
+#: lazarusidestrconsts:fdinvalidmutliselectioncap
+msgid "Invalid mutliselection"
+msgstr "Pemilihan multi tidak benar"
+
+#: lazarusidestrconsts:lisinvalidmultiselection
+msgid "Invalid multiselection"
+msgstr "Pemilihan multi tidak benar"
+
+#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
+msgid "Unable convert binary stream to text"
+msgstr "Tidak bisas mengubah stream biner ke teks"
+
+#: lazarusidestrconsts:lisunabletostreamselectedcomponents
+msgid "Unable to stream selected components"
+msgstr "Tidak bisas menyalurkan komponen yang dipilih"
+
+#: lazarusidestrconsts:liscannotcopytoplevelcomponent
+msgid "Can not copy top level component."
+msgstr "Tidak bisa meng-copy komponen tingkat teratas."
+
+#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
+msgid "Copying a whole form is not implemented."
+msgstr "Meng-copy seluruh form tidak diimplementasikan."
+
+#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
+msgid "There was an error during writing the selected component %s:%s:%s%s"
+msgstr "Ada kesalahan selama penulisan komponen yang dipilih %s:%s:%s%s"
+
+#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
+msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
+msgstr "Ada kesalahan ketika pengubahan stream biner dari komponen yang dipilih %s:%s:%s%s"
+
+#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
+msgid "Unable copy components to clipboard"
+msgstr "Tidak bisa meng-copy komponen ke clipboard"
+
+#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
+msgid "There was an error while copying the component stream to clipboard:%s%s"
+msgstr "Ada kesalahan ketikda meng-copy stream komponen ke clipboard:%s%s"
+
+#: lazarusidestrconsts:liserrorin
+msgid "Error in %s"
+msgstr "Kesalahan dalam %s"
+
+#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
+msgid "There is already another component with the name %s%s%s."
+msgstr "Sudah ada komponen lain dengan nama %s%s%s."
+
+#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
+msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
+msgstr "Editor komponen dari class%s%s%s%sditemukan dengan verb #%s %s%s%s%stelah menghasilkan kesalahan:%s%s%s%s"
+
+#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
+msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
+msgstr "Editor komponen dari class %s%s%smenghasilkan kesalahan:%s%s%s%s"
+
+#: lazarusidestrconsts:fdinvalidmutliselectiontext
+msgid "Multiselected components must be of a single form."
+msgstr "Pemilihan multi komponen harus dari form tunggal."
+
+#: lazarusidestrconsts:lisinvaliddelete
+msgid "Invalid delete"
+msgstr "Penghapusan tidak benar"
+
+#: lazarusidestrconsts:listherootcomponentcannotbedeleted
+msgid "The root component can not be deleted."
+msgstr "Komponen teratas tidak bisa dihapus."
+
+#: lazarusidestrconsts:fdmalignword
+msgid "Align"
+msgstr "Penjajaran"
+
+#: lazarusidestrconsts:fdmmirrorhorizontal
+msgid "Mirror horizontal"
+msgstr "Cerminkan horisontal"
+
+#: lazarusidestrconsts:fdmmirrorvertical
+msgid "Mirror vertical"
+msgstr "Cerminkan vertikal"
+
+#: lazarusidestrconsts:fdmscaleword
+msgid "Scale"
+msgstr "Skala"
+
+#: lazarusidestrconsts:fdmsizeword
+msgid "Size"
+msgstr "Ukuran"
+
+#: lazarusidestrconsts:fdmtaborder
+msgid "Tab order..."
+msgstr "Urutan tab..."
+
+#: lazarusidestrconsts:fdmorder
+msgid "Order"
+msgstr "Urutan"
+
+#: lazarusidestrconsts:fdmordermovetofront
+msgid "Move to front"
+msgstr "Pindahkan ke depan"
+
+#: lazarusidestrconsts:fdmordermovetoback
+msgid "Move to back"
+msgstr "Pindahkan ke belakang"
+
+#: lazarusidestrconsts:fdmorderforwardone
+msgid "Forward one"
+msgstr "Maju satu"
+
+#: lazarusidestrconsts:fdmorderbackone
+msgid "Back one"
+msgstr "Mundur satu"
+
+#: lazarusidestrconsts:fdmdeleteselection
+msgid "Delete selection"
+msgstr "Penilihan penghapusan"
+
+#: lazarusidestrconsts:lischangeclass
+msgid "Change Class"
+msgstr "Ubah Class"
+
+#: lazarusidestrconsts:fdmsnaptogridoption
+msgid "Option: Snap to grid"
+msgstr "Opsi: Menempel ke grid"
+
+#: lazarusidestrconsts:lisviewsourcelfm
+msgid "View Source (.lfm)"
+msgstr "Lihat Sumber (.lfm)"
+
+#: lazarusidestrconsts:fdmsnaptoguidelinesoption
+msgid "Option: Snap to guide lines"
+msgstr "Opsi: Menempel ke garis pemandu"
+
+#: lazarusidestrconsts:fdmshowoptions
+msgid "Show Options for form editing"
+msgstr "Tampilkan Opsi untuk pengeditan form"
+
+#: lazarusidestrconsts:srkmeditkeys
+msgid "Edit Keys"
+msgstr "Edit Kunci"
+
+#: lazarusidestrconsts:srkmcommand
+msgid "Command "
+msgstr "Perintah"
+
+#: lazarusidestrconsts:srkmconflic
+msgid "Conflict "
+msgstr "Konflik"
+
+#: lazarusidestrconsts:srkmconflicw
+msgid " conflicts with "
+msgstr "konflik dengan"
+
+#: lazarusidestrconsts:srkmcommand1
+msgid "    command1 \""
+msgstr "    perintah1 \""
+
+#: lazarusidestrconsts:srkmcommand2
+msgid "    command2 \""
+msgstr "    perintah2 \""
+
+#: lazarusidestrconsts:srkmeditforcmd
+msgid "Edit keys for command"
+msgstr "Edit kunci untuk perintah"
+
+#: lazarusidestrconsts:srkmkey
+msgid "Key"
+msgstr "Kunci"
+
+#: lazarusidestrconsts:srkmgrabkey
+msgid "Grab Key"
+msgstr "Ambil Kunci"
+
+#: lazarusidestrconsts:srkmpresskey
+msgid "Please press a key ..."
+msgstr "Silahkan tekan sebuah kunci ..."
+
+#: lazarusidestrconsts:srkmalternkey
+msgid "Alternative Key"
+msgstr "Kunci Alternatif"
+
+#: lazarusidestrconsts:srkmalreadyconnected
+msgid " The key \"%s\" is already connected to \"%s\"."
+msgstr "Kunci \"%s\" sudah terhubung ke \"%s\"."
+
+#: lazarusidestrconsts:srkmecwordleft
+msgid "Move cursor word left"
+msgstr "Pindahkan kursor sekata ke kiri"
+
+#: lazarusidestrconsts:srkmecwordright
+msgid "Move cursor word right"
+msgstr "Pindahkan kursor sekata ke kanan"
+
+#: lazarusidestrconsts:srkmeclinestart
+msgid "Move cursor to line start"
+msgstr "Pindahkan kursorke awal baris"
+
+#: lazarusidestrconsts:srkmeclineend
+msgid "Move cursor to line end"
+msgstr "Pindahkan kursor ke akhir baris"
+
+#: lazarusidestrconsts:srkmecpageup
+msgid "Move cursor up one page"
+msgstr "Pindahkan kursor naik satu halaman"
+
+#: lazarusidestrconsts:srkmecpagedown
+msgid "Move cursor down one page"
+msgstr "Pindahkan kursor turun satu halaman"
+
+#: lazarusidestrconsts:srkmecpageleft
+msgid "Move cursor left one page"
+msgstr "Pindahkan kursor ke kiri satu halaman"
+
+#: lazarusidestrconsts:srkmecpageright
+msgid "Move cursor right one page"
+msgstr "Pindahkan kursor ke kanan satu halaman"
+
+#: lazarusidestrconsts:srkmecpagetop
+msgid "Move cursor to top of page"
+msgstr "Pindahkan kursor ke atas halaman"
+
+#: lazarusidestrconsts:srkmecpagebottom
+msgid "Move cursor to bottom of page"
+msgstr "Pindahkan kursor ke bawah halaman"
+
+#: lazarusidestrconsts:srkmeceditortop
+msgid "Move cursor to absolute beginning"
+msgstr "Pindahkan kursor ke absolut awal"
+
+#: lazarusidestrconsts:srkmeceditorbottom
+msgid "Move cursor to absolute end"
+msgstr "Pindahkan kursor ke absolut akhir"
+
+#: lazarusidestrconsts:srkmecgotoxy
+msgid "Goto XY"
+msgstr "Pergi ke XY"
+
+#: lazarusidestrconsts:srkmecselleft
+msgid "SelLeft"
+msgstr "PilihKiri"
+
+#: lazarusidestrconsts:srkmecselright
+msgid "SelRight"
+msgstr "Pilih Kanan"
+
+#: lazarusidestrconsts:srkmecselup
+msgid "Select Up"
+msgstr "Pilih Naik"
+
+#: lazarusidestrconsts:srkmecseldown
+msgid "Select Down"
+msgstr "Pilih Turun"
+
+#: lazarusidestrconsts:srkmecselwordleft
+msgid "Select Word Left"
+msgstr "Pilih Sekata ke Kiri"
+
+#: lazarusidestrconsts:srkmecselwordright
+msgid "Select Word Right"
+msgstr "Pilih Sekata ke Kanan"
+
+#: lazarusidestrconsts:srkmecsellinestart
+msgid "Select Line Start"
+msgstr "Pilih Awal Baris"
+
+#: lazarusidestrconsts:srkmecsellineend
+msgid "Select Line End"
+msgstr "Pilih Akhir Baris"
+
+#: lazarusidestrconsts:srkmecselpageup
+msgid "Select Page Up"
+msgstr "Pilih Halaman Naik"
+
+#: lazarusidestrconsts:srkmecselpagedown
+msgid "Select Page Down"
+msgstr "Pilih Halaman Turun"
+
+#: lazarusidestrconsts:srkmecselpageleft
+msgid "Select Page Left"
+msgstr "Pilih Halaman ke Kiri"
+
+#: lazarusidestrconsts:srkmecselpageright
+msgid "Select Page Right"
+msgstr "Pilih Halaman ke Kanan"
+
+#: lazarusidestrconsts:srkmecselpagetop
+msgid "Select Page Top"
+msgstr "Pilih Halaman ke Atas"
+
+#: lazarusidestrconsts:srkmecselpagebottom
+msgid "Select Page Bottom"
+msgstr "Pilih Halaman ke Bawah"
+
+#: lazarusidestrconsts:srkmecseleditortop
+msgid "Select to absolute beginning"
+msgstr "Pilih ke absolut awal"
+
+#: lazarusidestrconsts:srkmecseleditorbottom
+msgid "Select to absolute end"
+msgstr "Pilih ke absolut akhir"
+
+#: lazarusidestrconsts:srkmecselgotoxy
+msgid "Select Goto XY"
+msgstr "Pilih Pergi ke XY"
+
+#: lazarusidestrconsts:srkmecselectall
+msgid "Select All"
+msgstr "Pilih Semua"
+
+#: lazarusidestrconsts:srkmecdeletelastchar
+msgid "Delete Last Char"
+msgstr "Hapus Karakter Terakhir"
+
+#: lazarusidestrconsts:srkmecdeletechar
+msgid "Delete char at cursor"
+msgstr "Hapus karakter di kursor"
+
+#: lazarusidestrconsts:srkmecdeleteword
+msgid "Delete to end of word"
+msgstr "Hapus sampai akhir kata"
+
+#: lazarusidestrconsts:srkmecdeletelastword
+msgid "Delete to start of word"
+msgstr "Hapus sampai awal kata"
+
+#: lazarusidestrconsts:srkmecdeletebol
+msgid "Delete to beginning of line"
+msgstr "Hapus sampai awal baris"
+
+#: lazarusidestrconsts:srkmecdeleteeol
+msgid "Delete to end of line"
+msgstr "Hapus sampai akhir baris"
+
+#: lazarusidestrconsts:srkmecdeleteline
+msgid "Delete current line"
+msgstr "Hapus baris saat ini"
+
+#: lazarusidestrconsts:srkmecclearall
+msgid "Delete whole text"
+msgstr "Hapus seluruh teks"
+
+#: lazarusidestrconsts:srkmeclinebreak
+msgid "Break line and move cursor"
+msgstr "Pisahkan baris dan pindahkan kursor"
+
+#: lazarusidestrconsts:srkmecinsertline
+msgid "Break line, leave cursor"
+msgstr "Pisahkan baris, biarkan kursor"
+
+#: lazarusidestrconsts:srkmecchar
+msgid "Char"
+msgstr "Karakter"
+
+#: lazarusidestrconsts:srkmecimestr
+msgid "Ime Str"
+msgstr "Ime Str"
+
+#: lazarusidestrconsts:srkmeccut
+msgid "Cut selection to clipboard"
+msgstr "Potong pilihan ke clipboard"
+
+#: lazarusidestrconsts:srkmeccopy
+msgid "Copy selection to clipboard"
+msgstr "Copy pilihan ke clipboard"
+
+#: lazarusidestrconsts:srkmecpaste
+msgid "Paste clipboard to current position"
+msgstr "Paste clipboard ke posisi saat ini"
+
+#: lazarusidestrconsts:srkmecscrollup
+msgid "Scroll up one line"
+msgstr "Gulung sebaris ke atas"
+
+#: lazarusidestrconsts:srkmecscrolldown
+msgid "Scroll down one line"
+msgstr "Gulung sebaris ke bawah"
+
+#: lazarusidestrconsts:srkmecscrollleft
+msgid "Scroll left one char"
+msgstr "Gulung satu karakter ke kiri"
+
+#: lazarusidestrconsts:srkmecscrollright
+msgid "Scroll right one char"
+msgstr "Gulung satu karakter ke kanan"
+
+#: lazarusidestrconsts:srkmecinsertmode
+msgid "Insert Mode"
+msgstr "Mode Sisipan"
+
+#: lazarusidestrconsts:srkmecoverwritemode
+msgid "Overwrite Mode"
+msgstr "Mode Menimpa"
+
+#: lazarusidestrconsts:srkmectogglemode
+msgid "Toggle Mode"
+msgstr "Toggle Mode"
+
+#: lazarusidestrconsts:srkmecblockindent
+msgid "Indent block"
+msgstr "Lekukan Blok"
+
+#: lazarusidestrconsts:srkmecblockunindent
+msgid "Unindent block"
+msgstr "Jangan lekukan blok"
+
+#: lazarusidestrconsts:srkmecshifttab
+msgid "Shift Tab"
+msgstr "Shift Tab"
+
+#: lazarusidestrconsts:srkmecmatchbracket
+msgid "Go to matching bracket"
+msgstr "Pergi ke kurung yang sama"
+
+#: lazarusidestrconsts:srkmecnormalselect
+msgid "Normal selection mode"
+msgstr "Mode pilihan normal"
+
+#: lazarusidestrconsts:srkmeccolumnselect
+msgid "Column selection mode"
+msgstr "Mode pemilihan kolom"
+
+#: lazarusidestrconsts:srkmeclineselect
+msgid "Line selection mode"
+msgstr "Mode pemilihan baris"
+
+#: lazarusidestrconsts:srkmecautocompletion
+msgid "Code template completion"
+msgstr "Penyempurnaan template kode"
+
+#: lazarusidestrconsts:srkmecuserfirst
+msgid "User First"
+msgstr "Pemakai Pertama"
+
+#: lazarusidestrconsts:srkmecsetfreebookmark
+msgid "Set a free Bookmark"
+msgstr "Set Penanda bebas"
+
+#: lazarusidestrconsts:srkmecprevbookmark
+msgid "Previous Bookmark"
+msgstr "Penanda sebelumnya"
+
+#: lazarusidestrconsts:srkmecnextbookmark
+msgid "Next Bookmark"
+msgstr "Penanda berikutnya"
+
+#: lazarusidestrconsts:srkmecgotomarker
+msgid "Go to Marker %d"
+msgstr "Pergi ke Penanda %d"
+
+#: lazarusidestrconsts:srkmecsetmarker
+msgid "Set Marker %d"
+msgstr "Set Penanda %d"
+
+#: lazarusidestrconsts:srkmecjumptoeditor
+msgid "Focus to source editor"
+msgstr "Fokus ke editor sumber"
+
+#: lazarusidestrconsts:srkmecnexteditor
+msgid "Go to next editor"
+msgstr "Pergi ke editor berikutnya"
+
+#: lazarusidestrconsts:srkmecpreveditor
+msgid "Go to prior editor"
+msgstr "Pergi ke editor sebelumnya"
+
+#: lazarusidestrconsts:srkmecmoveeditorleft
+msgid "Move editor left"
+msgstr "Pindahkan editor ke kiri"
+
+#: lazarusidestrconsts:srkmecmoveeditorright
+msgid "Move editor right"
+msgstr "Pindahkan editor ke kanan"
+
+#: lazarusidestrconsts:srkmecgotoeditor
+msgid "Go to editor %d"
+msgstr "Pergi ke editor %d"
+
+#: lazarusidestrconsts:srkmecnew
+msgid "New"
+msgstr "Baru"
+
+#: lazarusidestrconsts:srkmecnewunit
+msgid "New unit"
+msgstr "Unit baru"
+
+#: lazarusidestrconsts:srkmecnewform
+msgid "New form"
+msgstr "Form baru"
+
+#: lazarusidestrconsts:srkmecsaveas
+msgid "Save as"
+msgstr "Simpan sebagai"
+
+#: lazarusidestrconsts:srkmecsaveall
+msgid "Save all"
+msgstr "Simpan semua"
+
+#: lazarusidestrconsts:srkmeccloseall
+msgid "Close all"
+msgstr "Tutup semua"
+
+#: lazarusidestrconsts:srkmecselectiontabs2spaces
+msgid "Convert tabs to spaces in selection"
+msgstr "Ubah tab ke spasi dalam pilihan"
+
+#: lazarusidestrconsts:srkmecinsertcharacter
+msgid "Insert from Charactermap"
+msgstr "Sisipkan dari Charactermap"
+
+#: lazarusidestrconsts:srkmecinsertgplnotice
+msgid "Insert GPL notice"
+msgstr "Sisipkan catatan GPL"
+
+#: lazarusidestrconsts:srkmecinsertlgplnotice
+msgid "Insert LGPL notice"
+msgstr "Sisipkan catatan LGPL"
+
+#: lazarusidestrconsts:srkmecinsertusername
+msgid "Insert current username"
+msgstr "Sisipkan nama pemakai saat ini"
+
+#: lazarusidestrconsts:srkmecinsertdatetime
+msgid "Insert current date and time"
+msgstr "Sisipkan tanggal dan waktu saat ini"
+
+#: lazarusidestrconsts:srkmecinsertchangelogentry
+msgid "Insert ChangeLog entry"
+msgstr "Sisipkan entri ChangeLog"
+
+#: lazarusidestrconsts:srkmecinsertcvsauthor
+msgid "Insert CVS keyword Author"
+msgstr "Sisipkan Pembuat kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvsdate
+msgid "Insert CVS keyword Date"
+msgstr "Sisipkan Tanggal kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvsheader
+msgid "Insert CVS keyword Header"
+msgstr "Sisipkan Header kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvsid
+msgid "Insert CVS keyword ID"
+msgstr "Sisipkan ID kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvslog
+msgid "Insert CVS keyword Log"
+msgstr "Sisipkan Log kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvsname
+msgid "Insert CVS keyword Name"
+msgstr "Sisipkan Nama kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvsrevision
+msgid "Insert CVS keyword Revision"
+msgstr "Sisipkan Revisi kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecinsertcvssource
+msgid "Insert CVS keyword Source"
+msgstr "Sisipkan Sumber kata kunci CVS"
+
+#: lazarusidestrconsts:srkmecfind
+msgid "Find text"
+msgstr "Cari teks"
+
+#: lazarusidestrconsts:srkmecfindnext
+msgid "Find next"
+msgstr "Cari berikutnya"
+
+#: lazarusidestrconsts:srkmecfindprevious
+msgid "Find previous"
+msgstr "Cari sebelumnya"
+
+#: lazarusidestrconsts:srkmecfindinfiles
+msgid "Find in files"
+msgstr "Cari dalam file"
+
+#: lazarusidestrconsts:srkmecreplace
+msgid "Replace text"
+msgstr "Ganti teks"
+
+#: lazarusidestrconsts:srkmecfindproceduredefinition
+msgid "Find procedure definiton"
+msgstr "Cari definisi procedure"
+
+#: lazarusidestrconsts:srkmecfindproceduremethod
+msgid "Find procedure method"
+msgstr "Cari metode procedure"
+
+#: lazarusidestrconsts:srkmecgotolinenumber
+msgid "Go to line number"
+msgstr "Pergi ke nomor baris"
+
+#: lazarusidestrconsts:srkmecaddjumppoint
+msgid "Add jump point"
+msgstr "Tambahkan titik lompat"
+
+#: lazarusidestrconsts:srkmecopenfileatcursor
+msgid "Open file at cursor"
+msgstr "Buka file di kursor"
+
+#: lazarusidestrconsts:srkmecgotoincludedirective
+msgid "Go to to include directive of current include file"
+msgstr "Pergi ke direktif include dari file include saat ini"
+
+#: lazarusidestrconsts:srkmectoggleformunit
+msgid "Switch between form and unit"
+msgstr "Tukar antara form dan unit"
+
+#: lazarusidestrconsts:srkmectoggleobjectinsp
+msgid "View Object Inspector"
+msgstr "Lihat Inspektor Objek"
+
+#: lazarusidestrconsts:srkmectogglesourceeditor
+msgid "View Source Editor"
+msgstr "Lihat Editor Sumber"
+
+#: lazarusidestrconsts:srkmectogglecodeexpl
+msgid "View Code Explorer"
+msgstr "Lihat Eksplorer Kode"
+
+#: lazarusidestrconsts:srkmectogglemessages
+msgid "View messages"
+msgstr "Lihat pesan"
+
+#: lazarusidestrconsts:srkmectogglesearchresults
+msgid "View Search Results"
+msgstr "Lihat Hasil Pencarian"
+
+#: lazarusidestrconsts:srkmectogglewatches
+msgid "View watches"
+msgstr "Lihat pengawasan"
+
+#: lazarusidestrconsts:srkmectogglebreakpoints
+msgid "View breakpoints"
+msgstr "Lihat breakpoint"
+
+#: lazarusidestrconsts:srkmectoggledebuggerout
+msgid "View debugger output"
+msgstr "Lihat output debugger"
+
+#: lazarusidestrconsts:srkmectogglelocals
+msgid "View local variables"
+msgstr "Lihat variabel lokal"
+
+#: lazarusidestrconsts:srkmectogglecallstack
+msgid "View call stack"
+msgstr "Lihat pemanggilan stack"
+
+#: lazarusidestrconsts:srkmecviewunits
+msgid "View units"
+msgstr "Lihat unit"
+
+#: lazarusidestrconsts:srkmecviewforms
+msgid "View forms"
+msgstr "Lihat form"
+
+#: lazarusidestrconsts:srkmecviewunitdependencies
+msgid "View unit dependencies"
+msgstr "Lihat ketergantungan unit"
+
+#: lazarusidestrconsts:srkmecviewunitinfo
+msgid "View unit information"
+msgstr "Lihat informasi unit"
+
+#: lazarusidestrconsts:srkmecviewanchoreditor
+msgid "View anchor editor"
+msgstr "Lihat editor anchor"
+
+#: lazarusidestrconsts:srkmectogglecomppalette
+msgid "View component palette"
+msgstr "Lihat palet komponen"
+
+#: lazarusidestrconsts:srkmectoggleidespeedbtns
+msgid "View IDE speed buttons"
+msgstr "Lihat tombol cepat IDE"
+
+#: lazarusidestrconsts:srkmecwordcompletion
+msgid "Word completion"
+msgstr "Penyempurnaan kata"
+
+#: lazarusidestrconsts:srkmeccompletecode
+msgid "Complete code"
+msgstr "Lengkpai kode"
+
+#: lazarusidestrconsts:srkmecshowcodecontext
+msgid "Show code context"
+msgstr "Tampilkan konteks kode"
+
+#: lazarusidestrconsts:srkmecextractproc
+msgid "Extract procedure"
+msgstr "Ekstrak procedure"
+
+#: lazarusidestrconsts:srkmecfindidentifierrefs
+msgid "Find identifier references"
+msgstr "Cari referensi pengenal"
+
+#: lazarusidestrconsts:srkmecrenameidentifier
+msgid "Rename identifier"
+msgstr "Ganti nama pengenal"
+
+#: lazarusidestrconsts:srkmecinvertassignment
+msgid "Invert assignment"
+msgstr "Balikkan penempatan"
+
+#: lazarusidestrconsts:srkmecsyntaxcheck
+msgid "Syntax check"
+msgstr "Pemeriksaan Sintaks"
+
+#: lazarusidestrconsts:srkmecguessmisplacedifdef
+msgid "Guess misplaced $IFDEF"
+msgstr "Tebak $IFDEF salah tempat"
+
+#: lazarusidestrconsts:srkmecfinddeclaration
+msgid "Find declaration"
+msgstr "Cari deklarasi"
+
+#: lazarusidestrconsts:srkmecfindblockotherend
+msgid "Find block other end"
+msgstr "Cari akhir blok lain"
+
+#: lazarusidestrconsts:srkmecfindblockstart
+msgid "Find block start"
+msgstr "Cari awal blok"
+
+#: lazarusidestrconsts:srkmecbuild
+msgid "build program/project"
+msgstr "bangun program/proyek"
+
+#: lazarusidestrconsts:srkmecbuildall
+msgid "build all files of program/project"
+msgstr "bangun semua file dari program/proyek"
+
+#: lazarusidestrconsts:srkmecabortbuild
+msgid "abort build"
+msgstr "batalkan pembangunan"
+
+#: lazarusidestrconsts:srkmecrun
+msgid "run program"
+msgstr "jalankan program"
+
+#: lazarusidestrconsts:srkmecpause
+msgid "pause program"
+msgstr "pause program"
+
+#: lazarusidestrconsts:srkmecstopprogram
+msgid "stop program"
+msgstr "hentikan program"
+
+#: lazarusidestrconsts:srkmecresetdebugger
+msgid "reset debugger"
+msgstr "reset debugger"
+
+#: lazarusidestrconsts:srkmecaddbreakpoint
+msgid "add break point"
+msgstr "tambah break point"
+
+#: lazarusidestrconsts:srkmecremovebreakpoint
+msgid "remove break point"
+msgstr "hapus break point"
+
+#: lazarusidestrconsts:srkmecrunparameters
+msgid "run parameters"
+msgstr "parameter menjalankan"
+
+#: lazarusidestrconsts:srkmeccompileroptions
+msgid "compiler options"
+msgstr "opsi kompilator"
+
+#: lazarusidestrconsts:srkmecbuildfile
+msgid "build file"
+msgstr "bangun file"
+
+#: lazarusidestrconsts:srkmecrunfile
+msgid "run file"
+msgstr "jalankan file"
+
+#: lazarusidestrconsts:srkmecconfigbuildfile
+msgid "config build file"
+msgstr "file konfig pembangunan"
+
+#: lazarusidestrconsts:srkmecinspect
+msgid "inspect"
+msgstr "inspeksi"
+
+#: lazarusidestrconsts:srkmecevaluate
+msgid "evaluate/modify"
+msgstr "evaluasi/modifikasi"
+
+#: lazarusidestrconsts:srkmecaddwatch
+msgid "add watch"
+msgstr "tambah pengawasan"
+
+#: lazarusidestrconsts:srkmecexttoolsettings
+msgid "External tools settings"
+msgstr "Seting piranti eksternal"
+
+#: lazarusidestrconsts:srkmecbuildlazarus
+msgid "Build lazarus"
+msgstr "Bangun Lazarus"
+
+#: lazarusidestrconsts:srkmecexttool
+msgid "External tool %d"
+msgstr "Piranti eksternal %d"
+
+#: lazarusidestrconsts:srkmeccustomtool
+msgid "Custom tool %d"
+msgstr "Piranti Kustom %d"
+
+#: lazarusidestrconsts:srkmecenvironmentoptions
+msgid "General environment options"
+msgstr "Opsi lingkungan umum"
+
+#: lazarusidestrconsts:srkmeccodetoolsoptions
+msgid "Codetools options"
+msgstr "Opsi Codetools"
+
+#: lazarusidestrconsts:srkmeccodetoolsdefinesed
+msgid "Codetools defines editor"
+msgstr "Editor definisi Codetools"
+
+#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
+msgid "Rescan FPC source directory"
+msgstr "Cari lagi direktori sumber FPC"
+
+#: lazarusidestrconsts:srkmecmakeresourcestring
+msgid "Make resource string"
+msgstr "Buat string resource"
+
+#: lazarusidestrconsts:srkmecdiff
+msgid "Diff"
+msgstr "Diff"
+
+#: lazarusidestrconsts:srkmecunknown
+msgid "unknown editor command"
+msgstr "perintah editor tidak dikenal"
+
+#: lazarusidestrconsts:srvk_unknown
+msgid "Unknown"
+msgstr "Tidak dikenal"
+
+#: lazarusidestrconsts:srvk_lbutton
+msgid "Mouse Button Left"
+msgstr "Tombol Mouse Kiri"
+
+#: lazarusidestrconsts:srvk_rbutton
+msgid "Mouse Button Right"
+msgstr "Tombol Mouse Kanan"
+
+#: lazarusidestrconsts:srvk_mbutton
+msgid "Mouse Button Middle"
+msgstr "Tombol Mouse Tengah"
+
+#: lazarusidestrconsts:srvk_back
+msgid "Backspace"
+msgstr "Backspace"
+
+#: lazarusidestrconsts:srvk_tab
+msgid "Tab"
+msgstr "Tab"
+
+#: lazarusidestrconsts:srvk_clear
+msgid "Clear"
+msgstr "Clear"
+
+#: lazarusidestrconsts:srvk_return
+msgid "Return"
+msgstr "Return"
+
+#: lazarusidestrconsts:srvk_shift
+msgid "Shift"
+msgstr "Shift"
+
+#: lazarusidestrconsts:srvk_control
+msgid "Control"
+msgstr "Control"
+
+#: lazarusidestrconsts:srvk_menu
+msgid "Menu"
+msgstr "Menu"
+
+#: lazarusidestrconsts:srvk_pause
+msgid "Pause key"
+msgstr "Kunci Pause"
+
+#: lazarusidestrconsts:srvk_capital
+msgid "Capital"
+msgstr "Kapital"
+
+#: lazarusidestrconsts:srvk_kana
+msgid "Kana"
+msgstr "Kana"
+
+#: lazarusidestrconsts:srvk_junja
+msgid "Junja"
+msgstr "Junja"
+
+#: lazarusidestrconsts:srvk_final
+msgid "Final"
+msgstr "Final"
+
+#: lazarusidestrconsts:srvk_hanja
+msgid "Hanja"
+msgstr "Hanja"
+
+#: lazarusidestrconsts:srvk_escape
+msgid "Escape"
+msgstr "Escape"
+
+#: lazarusidestrconsts:srvk_convert
+msgid "Convert"
+msgstr "Konversi"
+
+#: lazarusidestrconsts:srvk_nonconvert
+msgid "Nonconvert"
+msgstr "Bukan konversi"
+
+#: lazarusidestrconsts:srvk_accept
+msgid "Accept"
+msgstr "Terima"
+
+#: lazarusidestrconsts:srvk_modechange
+msgid "Mode Change"
+msgstr "Mode Berubah"
+
+#: lazarusidestrconsts:srvk_space
+msgid "Space key"
+msgstr "Kunci spasi"
+
+#: lazarusidestrconsts:srvk_prior
+msgid "Prior"
+msgstr "Sebelumnya"
+
+#: lazarusidestrconsts:srvk_next
+msgid "Next"
+msgstr "Berikutnya"
+
+#: lazarusidestrconsts:srvk_end
+msgid "End"
+msgstr "End"
+
+#: lazarusidestrconsts:srvk_home
+msgid "Home"
+msgstr "Home"
+
+#: lazarusidestrconsts:srvk_left
+msgid "Left"
+msgstr "Left"
+
+#: lazarusidestrconsts:srvk_up
+msgid "Up"
+msgstr "Up"
+
+#: lazarusidestrconsts:srvk_right
+msgid "Right"
+msgstr "Right"
+
+#: lazarusidestrconsts:srvk_print
+msgid "Print"
+msgstr "Cetak"
+
+#: lazarusidestrconsts:srvk_execute
+msgid "Execute"
+msgstr "Eksekusi"
+
+#: lazarusidestrconsts:srvk_snapshot
+msgid "Snapshot"
+msgstr "Snapshot"
+
+#: lazarusidestrconsts:srvk_insert
+msgid "Insert"
+msgstr "Insert"
+
+#: lazarusidestrconsts:srvk_help
+msgid "Help"
+msgstr "Panduan"
+
+#: lazarusidestrconsts:srvk_lwin
+msgid "left windows key"
+msgstr "kunci jendela kiri"
+
+#: lazarusidestrconsts:srvk_rwin
+msgid "right windows key"
+msgstr "kunci jendela kanan"
+
+#: lazarusidestrconsts:srvk_apps
+msgid "application key"
+msgstr "kunci aplikasi"
+
+#: lazarusidestrconsts:srvk_numpad
+msgid "Numpad %d"
+msgstr "Numpad %d"
+
+#: lazarusidestrconsts:srvk_numlock
+msgid "Numlock"
+msgstr "Numlock"
+
+#: lazarusidestrconsts:srvk_scroll
+msgid "Scroll"
+msgstr "Gulung"
+
+#: lazarusidestrconsts:srvk_irregular
+msgid "Irregular "
+msgstr "Irregular "
+
+#: lazarusidestrconsts:srkmcatcursormoving
+msgid "Cursor moving commands"
+msgstr "Perintah pemindahan kursor"
+
+#: lazarusidestrconsts:srkmcatselection
+msgid "Text selection commands"
+msgstr "Perintah pemindahan teks"
+
+#: lazarusidestrconsts:srkmcatediting
+msgid "Text editing commands"
+msgstr "Perintah pengeditan teks"
+
+#: lazarusidestrconsts:srkmcatcmdcmd
+msgid "Command commands"
+msgstr "Perintah Perintah"
+
+#: lazarusidestrconsts:srkmcatsearchreplace
+msgid "Text search and replace commands"
+msgstr "Perintah pencarian dan penggantian teks"
+
+#: lazarusidestrconsts:srkmcatmarker
+msgid "Text marker commands"
+msgstr "Perintah penanda teks"
+
+#: lazarusidestrconsts:srkmcatcodetools
+msgid "CodeTools commands"
+msgstr "Perintah CodeTools"
+
+#: lazarusidestrconsts:srkmcatsrcnotebook
+msgid "Source Notebook commands"
+msgstr "Perintah Notebook Sumber"
+
+#: lazarusidestrconsts:srkmcatfilemenu
+msgid "File menu commands"
+msgstr "Perintah menu File"
+
+#: lazarusidestrconsts:srkmcatviewmenu
+msgid "View menu commands"
+msgstr "Perintah menu Lihat"
+
+#: lazarusidestrconsts:srkmcatprojectmenu
+msgid "Project menu commands"
+msgstr "Perintah menu Proyek"
+
+#: lazarusidestrconsts:srkmcatrunmenu
+msgid "Run menu commands"
+msgstr "Perintah menu Jalankan"
+
+#: lazarusidestrconsts:srkmcatcomponentsmenu
+msgid "Components menu commands"
+msgstr "Perintah menu Komponen"
+
+#: lazarusidestrconsts:srkmcattoolmenu
+msgid "Tools menu commands"
+msgstr "Perintah menu Piranti"
+
+#: lazarusidestrconsts:srkmcatenvmenu
+msgid "Environment menu commands"
+msgstr "Perintah menu Lingkungan"
+
+#: lazarusidestrconsts:srkmcarhelpmenu
+msgid "Help menu commands"
+msgstr "Perintah menu Panduan"
+
+#: lazarusidestrconsts:liskeycatdesigner
+msgid "Designer commands"
+msgstr "Perintah Desainer"
+
+#: lazarusidestrconsts:liskeycatobjinspector
+msgid "Object Inspector commands"
+msgstr "Perintah Inspektor Objek"
+
+#: lazarusidestrconsts:liskeycatcustom
+msgid "Custom commands"
+msgstr "Perintah Kustom"
+
+#: lazarusidestrconsts:rslanguageautomatic
+msgid "Automatic (or english)"
+msgstr "Otomatis (atau Inggris)"
+
+#: lazarusidestrconsts:rslanguageenglish
+msgid "English"
+msgstr "Inggris"
+
+#: lazarusidestrconsts:rslanguagegerman
+msgid "German"
+msgstr "Jerman"
+
+#: lazarusidestrconsts:rslanguagespanish
+msgid "Spanish"
+msgstr "SPanyol"
+
+#: lazarusidestrconsts:rslanguagefrench
+msgid "French"
+msgstr "Perancis"
+
+#: lazarusidestrconsts:rslanguagerussian
+msgid "Russian"
+msgstr "Rusia"
+
+#: lazarusidestrconsts:rslanguagepolish
+msgid "Polish"
+msgstr "Polandia"
+
+#: lazarusidestrconsts:rslanguagepolishiso
+msgid "Polish(ISO 8859-2)"
+msgstr "Polandia (ISO 8859-2)"
+
+#: lazarusidestrconsts:rslanguagepolishwin
+msgid "Polish(CP1250)"
+msgstr "Polandia (CP1250)"
+
+#: lazarusidestrconsts:rslanguageitalian
+msgid "Italian"
+msgstr "Italia"
+
+#: lazarusidestrconsts:rslanguagecatalan
+msgid "Catalan"
+msgstr "Catalian"
+
+#: lazarusidestrconsts:rslanguagefinnish
+msgid "Finnish"
+msgstr "Finlandia"
+
+#: lazarusidestrconsts:rslanguagehebrew
+msgid "Hebrew"
+msgstr "Hebrew"
+
+#: lazarusidestrconsts:rslanguagearabic
+msgid "Arabic"
+msgstr "Bahasa Arab"
+
+#: lazarusidestrconsts:rslanguageportugues
+msgid "Portuguese"
+msgstr "Portugis"
+
+#: lazarusidestrconsts:rslanguageukrainian
+msgid "Ukrainian"
+msgstr "Ukraina"
+
+#: lazarusidestrconsts:rslanguagedutch
+msgid "Dutch"
+msgstr "Belanda"
+
+#: lazarusidestrconsts:rslanguagejapanese
+msgid "Japanese"
+msgstr "Jepang"
+
+#: lazarusidestrconsts:dlgunitdepcaption
+msgid "Unit dependencies"
+msgstr "Ketergantungan unit"
+
+#: lazarusidestrconsts:dlgunitdepbrowse
+msgid "Open"
+msgstr "Buka"
+
+#: lazarusidestrconsts:dlgunitdeprefresh
+msgid "Refresh"
+msgstr "Segarkan"
+
+#: lazarusidestrconsts:lisdocumentationeditor
+msgid "Documentation Editor"
+msgstr "Editor Dokumentasi"
+
+#: lazarusidestrconsts:lisconfirmlazarusrebuild
+msgid "Do you want to rebuild Lazarus?"
+msgstr "Anda ingin membangun ulang Lazarus?"
+
+#: lazarusidestrconsts:liscleanlazarussource
+msgid "Clean Lazarus Source"
+msgstr "Bersihkan Sumber Lazarus"
+
+#: lazarusidestrconsts:lismakenotfound
+msgid "Make not found"
+msgstr "Make tidak ditemukan"
+
+#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
+msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
+msgstr "Program %smake%stidak ditemukan.%sPiranti ini diperlukan untuk membangun lazarus.%s"
+
+#: lazarusidestrconsts:liscompileidewithoutlinking
+msgid "Compile IDE (without linking)"
+msgstr "Kompilasi IDE (tanpa penggabungan)"
+
+#: lazarusidestrconsts:lisbuildlcl
+msgid "Build LCL"
+msgstr "Bangun LCL"
+
+#: lazarusidestrconsts:lisbuildcomponent
+msgid "Build Component"
+msgstr "Bangun Komponen"
+
+#: lazarusidestrconsts:lisbuildcodetools
+msgid "Build CodeTools"
+msgstr "Bangun CodeTools"
+
+#: lazarusidestrconsts:lisbuildsynedit
+msgid "Build SynEdit"
+msgstr "Bangun SynEdit"
+
+#: lazarusidestrconsts:lisbuildideintf
+msgid "Build IDE Interface"
+msgstr "Bangun Antarmuka IDE"
+
+#: lazarusidestrconsts:lisbuildjitform
+msgid "Build JIT Form"
+msgstr "Bangun Form JIT"
+
+#: lazarusidestrconsts:lisbuildpkgreg
+msgid "Build Package Registration"
+msgstr "Bangun Registrasi Paket"
+
+#: lazarusidestrconsts:lisbuildide
+msgid "Build IDE"
+msgstr "Bangun IDE"
+
+#: lazarusidestrconsts:lisbuildstarter
+msgid "Build Starter"
+msgstr "Bangun Starter"
+
+#: lazarusidestrconsts:lisbuildexamples
+msgid "Build Examples"
+msgstr "Bangun Contoh"
+
+#: lazarusidestrconsts:lisconfigurebuildlazarus
+msgid "Configure %sBuild Lazarus%s"
+msgstr "Konfigurasi %sBuild Lazarus%s"
+
+#: lazarusidestrconsts:lislazbuildcleanall
+msgid "Clean all"
+msgstr "Bersihkan semua"
+
+#: lazarusidestrconsts:lislazbuildsettobuildall
+msgid "Set to %sBuild All%s"
+msgstr "Set ke %sBangun Semua%s"
+
+#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
+msgid "Build Components (SynEdit, CodeTools)"
+msgstr "Bangun Komponen (SynEdit, CodeTools)"
+
+#: lazarusidestrconsts:lislazbuildbuildsynedit
+msgid "Build SynEdit"
+msgstr "Banngun SynEdit"
+
+#: lazarusidestrconsts:lislazbuildbuildcodetools
+msgid "Build CodeTools"
+msgstr "Bangun CodeTools"
+
+#: lazarusidestrconsts:lislazbuildbuildide
+msgid "Build IDE"
+msgstr "Bangun IDE"
+
+#: lazarusidestrconsts:lislazbuildbuildexamples
+msgid "Build Examples"
+msgstr "Bangun Contoh"
+
+#: lazarusidestrconsts:lislazbuildoptions
+msgid "Options:"
+msgstr "Opsi:"
+
+#: lazarusidestrconsts:lislazbuildtargetos
+msgid "Target OS:"
+msgstr "Target OS:"
+
+#: lazarusidestrconsts:lislazbuildtargetcpu
+msgid "Target CPU:"
+msgstr "Target CPU:"
+
+#: lazarusidestrconsts:lislazbuildtargetdirectory
+msgid "Target Directory:"
+msgstr "Target Direktori:"
+
+#: lazarusidestrconsts:lislazbuildlclinterface
+msgid "LCL interface"
+msgstr "Antarmuka LCL"
+
+#: lazarusidestrconsts:lislazbuildbuildjitform
+msgid "Build JITForm"
+msgstr "Bangun JITForm"
+
+#: lazarusidestrconsts:lislazbuildwithstaticpackages
+msgid "With Packages"
+msgstr "Dengan Paket"
+
+#: lazarusidestrconsts:lislazbuildrestartafterbuild
+msgid "Restart After Successfull Build"
+msgstr "Mulai lagi Setelah Pembangunan Sukses"
+
+#: lazarusidestrconsts:lislazbuildconfirmbuild
+msgid "Confirm Before ReBuild Lazarus"
+msgstr "Konfirmasi Sebelum Pembangunan Ulang Lazarus"
+
+#: lazarusidestrconsts:lislazbuildok
+msgid "Ok"
+msgstr "Ok"
+
+#: lazarusidestrconsts:lisctdtemplates
+msgid "Templates"
+msgstr "Template"
+
+#: lazarusidestrconsts:lissavesettings
+msgid "Save Settings"
+msgstr "Simpan Seting"
+
+#: lazarusidestrconsts:lislazbuildcancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lazarusidestrconsts:lislazbuildnone
+msgid "None"
+msgstr "Tidak ada"
+
+#: lazarusidestrconsts:lislazbuildbuild
+msgid "Build"
+msgstr "Bangun"
+
+#: lazarusidestrconsts:lislazbuildcleanbuild
+msgid "Clean+Build"
+msgstr "Bersihkan+Bangun"
+
+#: lazarusidestrconsts:liscompilererrorinvalidcompiler
+msgid "Error: invalid compiler: %s"
+msgstr "Salah: kompilator tidak benar: %s"
+
+#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
+msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
+msgstr "Petunjuk: anda bisa menset path kompilator dalam Lingkungan->Opsi Lingkungan->File->Path Kompilator"
+
+#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
+msgid "NOTE: loading old codetools options file: "
+msgstr "CATATAN: pengambilan file opsi codetools lama:"
+
+#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
+msgid "NOTE: codetools config file not found - using defaults"
+msgstr "CATATAN: file konfig codetools tidak ditemukan - menggunakan default"
+
+#: lazarusidestrconsts:liscodetoolsoptsok
+msgid "Ok"
+msgstr "Ok"
+
+#: lazarusidestrconsts:liscodetoolsoptsnone
+msgid "None"
+msgstr "Tidak ada"
+
+#: lazarusidestrconsts:liscodetoolsoptskeyword
+msgid "Keyword"
+msgstr "Kata kunci"
+
+#: lazarusidestrconsts:liscodetoolsoptsidentifier
+msgid "Identifier"
+msgstr "Pengenal"
+
+#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
+msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
+msgstr "File tambahan yang dicari (contoh /path/*.pas;/path2/*.pp)"
+
+#: lazarusidestrconsts:lisfrifindreferences
+msgid "Find References"
+msgstr "Cari Referensi"
+
+#: lazarusidestrconsts:lisfriinvalididentifier
+msgid "Invalid Identifier"
+msgstr "Pengenal tidak benar"
+
+#: lazarusidestrconsts:lisfrirenameto
+msgid "Rename to"
+msgstr "Ganti nama ke"
+
+#: lazarusidestrconsts:lisfrirename
+msgid "Rename"
+msgstr "Ganti nama"
+
+#: lazarusidestrconsts:lisfrisearchincommentstoo
+msgid "Search in comments too"
+msgstr "Cari dalam komentar juga"
+
+#: lazarusidestrconsts:lisfrisearchwhere
+msgid "Search where"
+msgstr "Cari dimana"
+
+#: lazarusidestrconsts:liscodetoolsoptscolon
+msgid "Colon"
+msgstr "Titik dua"
+
+#: lazarusidestrconsts:liscodetoolsoptssemicolon
+msgid "Semicolon"
+msgstr "Titik koma"
+
+#: lazarusidestrconsts:liscodetoolsoptscomma
+msgid "Comma"
+msgstr "Koma"
+
+#: lazarusidestrconsts:liscodetoolsoptspoint
+msgid "Point"
+msgstr "Titik"
+
+#: lazarusidestrconsts:liscodetoolsoptsat
+msgid "At"
+msgstr "Di"
+
+#: lazarusidestrconsts:liscodetoolsoptsnumber
+msgid "Number"
+msgstr "Nomor"
+
+#: lazarusidestrconsts:liscodetoolsoptsstringconst
+msgid "String constant"
+msgstr "Konstan string"
+
+#: lazarusidestrconsts:liscodetoolsoptsnewline
+msgid "Newline"
+msgstr "Baris baru"
+
+#: lazarusidestrconsts:liscodetoolsoptsspace
+msgid "Space"
+msgstr "Spasi"
+
+#: lazarusidestrconsts:liscodetoolsoptssymbol
+msgid "Symbol"
+msgstr "Simbol"
+
+#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
+msgid "CodeTools Defines Preview"
+msgstr "Peninjauan Definisi CodeTools"
+
+#: lazarusidestrconsts:liscodetoolsdefswriteerror
+msgid "Write error"
+msgstr "Penulisan salah"
+
+#: lazarusidestrconsts:lisstopdebugging2
+msgid "Stop debugging?"
+msgstr "Hentikan debugging?"
+
+#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
+msgid "Stop current debugging and rebuild project?"
+msgstr "Hentikan debugging saat ini dan bangun ulang proyek?"
+
+#: lazarusidestrconsts:liserrorwritingpackagelisttofile
+msgid "Error writing package list to file%s%s%s%s"
+msgstr "Kesalahan penulisan daftar paket ke file%s%s%s%s"
+
+#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
+msgid "Error while writing %s%s%s%s%s"
+msgstr "Kesalahan ketika penulisan %s%s%s%s%s"
+
+#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
+msgid "Error while writing project info file %s%s%s%s%s"
+msgstr "Kesalahan ketika penulisan file info proyek %s%s%s%s%s"
+
+#: lazarusidestrconsts:liscodetoolsdefsreaderror
+msgid "Read error"
+msgstr "Pembacaan salah"
+
+#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
+msgid "Error reading package list from file%s%s%s%s"
+msgstr "Pembacaan daftar paket salah dari file %s%s%s%s%s"
+
+#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
+msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
+msgstr "Path unit saat ini untuk file%s%s%s%s is%s%s%s%s.%s%sPath ke unit LCL %s%s%s tidak ada.%s%sPeunjuk untuk pemula:%sBuat aplikasi lazarus dan tempatkan file ke dalam direktori proyek."
+
+#: lazarusidestrconsts:lislclunitpathmissing
+msgid "LCL unit path missing"
+msgstr "Path unit LCL tidak ada"
+
+#: lazarusidestrconsts:lisnotadelphiunit
+msgid "Not a Delphi unit"
+msgstr "Bukan unit Delphi"
+
+#: lazarusidestrconsts:listhefileisnotadelphiunit
+msgid "The file %s%s%s is not a Delphi unit."
+msgstr "File %s%s%s bukan unit Delphi."
+
+#: lazarusidestrconsts:liscodetoolsdefserrorreading
+msgid "Error reading %s%s%s%s%s"
+msgstr "Kesalahan pembacaan %s%s%s%s%s"
+
+#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
+msgid "Error reading project info file %s%s%s%s%s"
+msgstr "Kesalahan pembacaan file info proyek %s%s%s%s%s"
+
+#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
+msgid "Node is readonly"
+msgstr "Node hanya-baca"
+
+#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
+msgid "Auto generated nodes can not be edited."
+msgstr "Node yang otomatis dibuat tidak bisa diedit."
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
+msgid "Invalid previous node"
+msgstr "Node sebelumnya tidak benar"
+
+#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
+msgid "Previous node can not contain child nodes."
+msgstr "Node sebelumnya tidak bisa berisi anak node."
+
+#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
+msgid "Create FPC Macros and paths for a fpc project directory"
+msgstr "Buat Makro FPC dan path untuk direktori proyek fpc"
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory
+msgid "Project directory"
+msgstr "Direktori Proyek"
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
+msgid "The Free Pascal project directory."
+msgstr "Direktori proyek Free Pascal."
+
+#: lazarusidestrconsts:liscodetoolsdefscompilerpath
+msgid "compiler path"
+msgstr "path kompilator"
+
+#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
+msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
+msgstr "Path ke kompilator free pascal. Hanya diperlukan jika anda menset sumber FPC SVN dibawah ini. Digunakan untuk pembuatan makro otomatis."
+
+#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
+msgid "FPC SVN source directory"
+msgstr "Direktori sumber FPC SVN"
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
+msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
+msgstr "Direktori sumber Free Pascal SVN. Tidak diperlukan. Ini akan meningkatkan pencarian deklarasi dan debugging."
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
+msgid "Create Defines for Free Pascal Compiler"
+msgstr "Buat Defines untuk Kompilator Free Pasal"
+
+#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
+msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
+msgstr "Path ke kompilator free pascal. %s Sebagai contoh %s/usr/bin/%s -n%s atau %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
+msgid "Create Defines for Free Pascal SVN Sources"
+msgstr "Buat Defines untuk Sumber Free Pascal SVN"
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
+msgid "The Free Pascal SVN source directory."
+msgstr "Direktori sumber Free Pascal SVN."
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
+msgid "Create Defines for Lazarus Directory"
+msgstr "Buat Defines untuk Direktori Lazarus"
+
+#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
+msgid "Lazarus Directory"
+msgstr "Direktori Lazarus"
+
+#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
+msgid "The Lazarus main directory."
+msgstr "Direktori utama Lazarus."
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
+msgid "Create Defines for %s Directory"
+msgstr "Buat Defines untuk Direktori %s"
+
+#: lazarusidestrconsts:liscodetoolsdefsdirectory
+msgid "%s directory"
+msgstr "direktori %s"
+
+#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
+msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
+msgstr "Direktori utama %s, %sdimana Borland telah menginstalasi semua sumber %s.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
+
+#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
+msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
+msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s.%sContoh: /home/user/kylix%s"
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
+msgid "Create Defines for %s Project"
+msgstr "Buat Defines untuk Proyek %s"
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
+msgid "%s project directory"
+msgstr "Direktori proyek %s"
+
+#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
+msgid "The %s project directory,%swhich contains the .dpr, dpk file."
+msgstr "Direktori proyek %s,%syang berisi file .dpr, dpk."
+
+#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
+msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
+msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
+
+#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
+msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
+msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: /home/user/kylix%s"
+
+#: lazarusidestrconsts:liscodetoolsdefsexit
+msgid "Exit"
+msgstr "Keluar"
+
+#: lazarusidestrconsts:liscodetoolsdefssaveandexit
+msgid "Save and Exit"
+msgstr "Simpan dan Keluar"
+
+#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
+msgid "Exit without Save"
+msgstr "Keluar tanpa Menyimpan"
+
+#: lazarusidestrconsts:liscodetoolsdefsedit
+msgid "Edit"
+msgstr "Edit"
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
+msgid "Move node up"
+msgstr "Naikkan node"
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
+msgid "Move node down"
+msgstr "Turunkan node"
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
+msgid "Move node one level up"
+msgstr "Naikkan node selangkah"
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
+msgid "Move node one level down"
+msgstr "Turunkan node selangkah"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
+msgid "Insert node below"
+msgstr "Sisipkan node dibawah"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
+msgid "Insert node as child"
+msgstr "Sisipkan node sebagai anak"
+
+#: lazarusidestrconsts:liscodetoolsdefsdeletenode
+msgid "Delete node"
+msgstr "Hapus node"
+
+#: lazarusidestrconsts:liscodetoolsdefsconvertnode
+msgid "Convert node"
+msgstr "Konversi node"
+
+#: lazarusidestrconsts:liscodetoolsdefsdefine
+msgid "Define"
+msgstr "Definiskan"
+
+#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
+msgid "Define Recurse"
+msgstr "Definisikan Berulang"
+
+#: lazarusidestrconsts:liscodetoolsdefsundefine
+msgid "Undefine"
+msgstr "Tidak didefiniskan"
+
+#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
+msgid "Undefine Recurse"
+msgstr "Tidak didefinisikan Berulang"
+
+#: lazarusidestrconsts:liscodetoolsdefsundefineall
+msgid "Undefine All"
+msgstr "Tidak didefinisikan Semua"
+
+#: lazarusidestrconsts:liscodetoolsdefsblock
+msgid "Block"
+msgstr "Blok"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
+msgid "Directory"
+msgstr "Direktori"
+
+#: lazarusidestrconsts:liscodetoolsdefsif
+msgid "If"
+msgstr "If"
+
+#: lazarusidestrconsts:liscodetoolsdefsifdef
+msgid "IfDef"
+msgstr "IfDef"
+
+#: lazarusidestrconsts:liscodetoolsdefsifndef
+msgid "IfNDef"
+msgstr "IfNDef"
+
+#: lazarusidestrconsts:liscodetoolsdefselseif
+msgid "ElseIf"
+msgstr "ElseIf"
+
+#: lazarusidestrconsts:liscodetoolsdefselse
+msgid "Else"
+msgstr "Else"
+
+#: lazarusidestrconsts:lisctdefstools
+msgid "Tools"
+msgstr "Piranti"
+
+#: lazarusidestrconsts:lisctdefsopenpreview
+msgid "Open Preview"
+msgstr "Buka Peninjauan"
+
+#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
+msgid "Insert Template"
+msgstr "Sisipkan Template"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
+msgid "Insert Free Pascal Project Template"
+msgstr "Sisipkan Template Proyek Free Pascal"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
+msgid "Insert Free Pascal Compiler Template"
+msgstr "Sisipkan Template Kompilator Free Pascal"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
+msgid "Insert Free Pascal SVN Source Template"
+msgstr "Sisipkan Template Sumber SVN Free Pascal"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
+msgid "Insert Lazarus Directory Template"
+msgstr "Sisipkan Template Direktori Lazarus"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
+msgid "Insert Delphi 5 Compiler Template"
+msgstr "Sisipkan Template Kompilator Delphi 5"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
+msgid "Insert Delphi 5 Directory Template"
+msgstr "Sisipkan Template Direktori Delphi 5"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
+msgid "Insert Delphi 5 Project Template"
+msgstr "Sisipkan Template Proyek Delphi 5"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
+msgid "Insert Delphi 6 Compiler Template"
+msgstr "Sisipkan Template Kompilator Delphi 6"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
+msgid "Insert Delphi 6 Directory Template"
+msgstr "Sisipkan Template Direktori Delphi 6"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
+msgid "Insert Delphi 6 Project Template"
+msgstr "Sisipkan Template Proyek Delphi 6"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
+msgid "Insert Delphi 7 Compiler Template"
+msgstr "Sisipkan Template Kompilator Delphi 7"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
+msgid "Insert Delphi 7 Directory Template"
+msgstr "Sisipkan Template Direktori Delphi 7"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
+msgid "Insert Delphi 7 Project Template"
+msgstr "Sisipkan Template Proyek Delphi 7"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
+msgid "Insert Kylix 3 Compiler Template"
+msgstr "Sisipkan Template Kompilator Kylix 3"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
+msgid "Insert Kylix 3 Directory Template"
+msgstr "Sisipkan Template Direktori Kylix 3"
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
+msgid "Insert Kylix 3 Project Template"
+msgstr "Sisipkan Template Proyek Kylix 3"
+
+#: lazarusidestrconsts:liscodetoolsdefsselectednode
+msgid "Selected Node:"
+msgstr "Node Terpilih:"
+
+#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
+msgid "Node and its children are only valid for this project"
+msgstr "Node dan anaknya hanya berlaku untuk proyek ini"
+
+#: lazarusidestrconsts:liscodetoolsdefsname
+msgid "Name:"
+msgstr "Nama:"
+
+#: lazarusidestrconsts:liscodetoolsdefsdescription
+msgid "Description:"
+msgstr "Deskripsi:"
+
+#: lazarusidestrconsts:liscodetoolsdefsvariable
+msgid "Variable:"
+msgstr "Variabel:"
+
+#: lazarusidestrconsts:liscodetoolsdefsvalueastext
+msgid "Value as Text"
+msgstr "Nilai sebagai Teks"
+
+#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
+msgid "Value as File Paths"
+msgstr "Nilai sebagai Path File"
+
+#: lazarusidestrconsts:liscodetoolsdefsaction
+msgid "Action: %s"
+msgstr "Aksi: %s"
+
+#: lazarusidestrconsts:liscodetoolsdefsautogenerated
+msgid "%s, auto generated"
+msgstr "%s, otomatis dibuat"
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
+msgid "%s, project specific"
+msgstr "%s, spesifik proyek"
+
+#: lazarusidestrconsts:liscodetoolsdefsnoneselected
+msgid "none selected"
+msgstr "tidak ada yang dipilih"
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
+msgid "Invalid parent"
+msgstr "Induk tidak benar"
+
+#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
+msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
+msgstr "%s tidak bisa menampung TControls.%sAnda hanya bisa menaruh komponen visual diatasnya."
+
+#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
+msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
+msgstr "Node otomatis dibuat tidak bisa diedit,%stidak juga mempunyai node anak yang tidak otomatis dibuat."
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
+msgid "Invalid parent node"
+msgstr "Node induk tidak benar"
+
+#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
+msgid "Parent node can not contain child nodes."
+msgstr "Node induk tidak bisa berisi node anak."
+
+#: lazarusidestrconsts:liscodetoolsdefsnewnode
+msgid "NewNode"
+msgstr "NodeBaru"
+
+#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
+msgid "CodeTools Defines Editor"
+msgstr "Editor Definisi CodeTools"
+
+#: lazarusidestrconsts:liscodetempladdcodetemplate
+msgid "Add code template"
+msgstr "Tambah template kode"
+
+#: lazarusidestrconsts:liscodetempladd
+msgid "Add"
+msgstr "Tambah"
+
+#: lazarusidestrconsts:liscodetempleditcodetemplate
+msgid "Edit code template"
+msgstr "Edit template kode"
+
+#: lazarusidestrconsts:liscodetemplchange
+msgid "Change"
+msgstr "Ubah"
+
+#: lazarusidestrconsts:liscodetempltoken
+msgid "Token:"
+msgstr "Token:"
+
+#: lazarusidestrconsts:liscodetemplcomment
+msgid "Comment:"
+msgstr "Komentar:"
+
+#: lazarusidestrconsts:liscodetemplatokenalreadyexists
+msgid " A token %s%s%s already exists! "
+msgstr " Token %s%s%s sudah ada! "
+
+#: lazarusidestrconsts:liscodetemplerror
+msgid "Error"
+msgstr "Salah"
+
+#: lazarusidestrconsts:lishelpdatabasenotfound
+msgid "Help Database not found"
+msgstr "Database Panduan tidak ditemukan"
+
+#: lazarusidestrconsts:lishelpcontextnotfound
+msgid "Help Context not found"
+msgstr "Konteks Panduan tidak ditemukan"
+
+#: lazarusidestrconsts:lishelpviewernotfound
+msgid "Help Viewer not found"
+msgstr "Viewer Panduan tidak ditemukan"
+
+#: lazarusidestrconsts:lishelpnotfound
+msgid "Help not found"
+msgstr "Panduan tidak ditemukan"
+
+#: lazarusidestrconsts:lishelpviewererror
+msgid "Help Viewer Error"
+msgstr "Viewer Panduan Salah"
+
+#: lazarusidestrconsts:lishelpselectorerror
+msgid "Help Selector Error"
+msgstr "Selektor Panduan Salah"
+
+#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug
+msgid "Unknown Error, please report this bug"
+msgstr "Tidak Dikenal. Salah, silahkan laporkan bug ini"
+
+#: lazarusidestrconsts:lismakeresourcestring
+msgid "Make ResourceString"
+msgstr "Buat ResourceString"
+
+#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
+msgid "Invalid Resourcestring section"
+msgstr "Bagian ResourceString tidak benar"
+
+#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
+msgid "Please choose a resourstring section from the list."
+msgstr "Silahkan pilih bagian resourcestring dari daftar."
+
+#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
+msgid "Resourcestring already exists"
+msgstr "Resourcestring sudah ada"
+
+#: lazarusidestrconsts:lismakeresstrchooseanothername
+msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
+msgstr "Resourcestring %s%s%s sudah ada.%sSilahkan pilih nama lain.%sGunakan Abaikan untuk tetap menambahkan juga."
+
+#: lazarusidestrconsts:lismakeresstrstringconstantinsource
+msgid "String Constant in source"
+msgstr "Konstan String dalam sumber"
+
+#: lazarusidestrconsts:lismakeresstrconversionoptions
+msgid "Conversion Options"
+msgstr "Opsi Konversi"
+
+#: lazarusidestrconsts:lismakeresstridentifierprefix
+msgid "Identifier Prefix:"
+msgstr "Prefiks Pengenal:"
+
+#: lazarusidestrconsts:lismakeresstridentifierlength
+msgid "Identifier Length:"
+msgstr "Panjang Pengenal:"
+
+#: lazarusidestrconsts:lismakeresstrcustomidentifier
+msgid "Custom Identifier"
+msgstr "Pengenal Kustom:"
+
+#: lazarusidestrconsts:lismakeresstrresourcestringsection
+msgid "Resourcestring Section:"
+msgstr "Bagian Resourcestring:"
+
+#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
+msgid "Strings with same value:"
+msgstr "String dengan nilai sama:"
+
+#: lazarusidestrconsts:lismakeresstrappendtosection
+msgid "Append to section"
+msgstr "Tambahkan ke bagian"
+
+#: lazarusidestrconsts:lismakeresstrinsertalphabetically
+msgid "Insert alphabetically"
+msgstr "Sisipkan secara alfabetik"
+
+#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
+msgid "Insert context sensitive"
+msgstr "Sisipkan sensitif konteks"
+
+#: lazarusidestrconsts:lismakeresstrsourcepreview
+msgid "Source preview"
+msgstr "Peninjauan Sumber"
+
+#: lazarusidestrconsts:lisnostringconstantfound
+msgid "No String Constant Found"
+msgstr "Tidak ada Konstan String Ditemukan"
+
+#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
+msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again."
+msgstr "Petunjuk:  Fungsi Buat Resourcestring mengharapkan konstan string.%sSilahkan pilih ekspresi dan coba lagi."
+
+#: lazarusidestrconsts:lisdiffdlgtext1
+msgid "Text1"
+msgstr "Teks1"
+
+#: lazarusidestrconsts:lisdiffdlgonlyselection
+msgid "Only selection"
+msgstr "Hanya pilihan"
+
+#: lazarusidestrconsts:lisdiffdlgtext2
+msgid "Text2"
+msgstr "Teks2"
+
+#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
+msgid "Case Insensitive"
+msgstr "Huruf Diabaikan"
+
+#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
+msgid "Ignore if empty lines were added or removed"
+msgstr "Abaikan jika baris kosong saat ditambahkan atau dihapus"
+
+#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
+msgid "Ignore spaces at start of line"
+msgstr "Abaikan spasi diawal baris"
+
+#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
+msgid "Ignore spaces at end of line"
+msgstr "Abaikan spasi diakhir baris"
+
+#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
+msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
+msgstr "Abaikan perbedaan dalam akhir baris (contoh. #10 = #13#10)"
+
+#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
+msgid "Ignore amount of space chars"
+msgstr "Abaikan besar dari karakter spasi"
+
+#: lazarusidestrconsts:lisdiffdlgignorespaces
+msgid "Ignore spaces (newline chars not included)"
+msgstr "Abaikan spasi (karakter baris baru tidak disertakan)."
+
+#: lazarusidestrconsts:lisdiffdlgopendiffineditor
+msgid "Open Diff in editor"
+msgstr "Buka Diff dalam editor"
+
+#: lazarusidestrconsts:listodolistcaption
+msgid "ToDo List"
+msgstr "Daftar ToDo"
+
+#: lazarusidestrconsts:listodolistrefresh
+msgid "Refresh todo items"
+msgstr "Segarkan item todo"
+
+#: lazarusidestrconsts:listodolistgotoline
+msgid "Goto selected source line"
+msgstr "Pergi ke baris sumber yang dipilih"
+
+#: lazarusidestrconsts:listodolistprintlist
+msgid "Print todo items"
+msgstr "Cetak item todo"
+
+#: lazarusidestrconsts:listodolistoptions
+msgid "ToDo options..."
+msgstr "Opsi ToDo..."
+
+#: lazarusidestrconsts:listodoldescription
+msgid "Description"
+msgstr "Deskripsi"
+
+#: lazarusidestrconsts:lisctinsertmacro
+msgid "Insert Macro"
+msgstr "Sisipkan Makro"
+
+#: lazarusidestrconsts:listodolfile
+msgid "File"
+msgstr "File"
+
+#: lazarusidestrconsts:listodolline
+msgid "Line"
+msgstr "Baris"
+
+#: lazarusidestrconsts:lispkgfiletypeunit
+msgid "Unit"
+msgstr "Unit"
+
+#: lazarusidestrconsts:lispkgfiletypevirtualunit
+msgid "Virtual Unit"
+msgstr "Unit Virtual"
+
+#: lazarusidestrconsts:lispkgfiletypelfm
+msgid "LFM - Lazarus form text"
+msgstr "LFM - Teks form Lazarus"
+
+#: lazarusidestrconsts:lispkgfiletypelrs
+msgid "LRS - Lazarus resource"
+msgstr "LRS - Lazarus resource"
+
+#: lazarusidestrconsts:lispkgfiletypeinclude
+msgid "Include file"
+msgstr "File Include"
+
+#: lazarusidestrconsts:lispkgfiletypetext
+msgid "Text"
+msgstr "Teks"
+
+#: lazarusidestrconsts:lispkgfiletypebinary
+msgid "Binary"
+msgstr "Biner"
+
+#: lazarusidestrconsts:lisviewprojectunits
+msgid "View Project Units"
+msgstr "Lihat Unit Proyek"
+
+#: lazarusidestrconsts:lisinformationaboutunit
+msgid "Information about %s"
+msgstr "Informasi tentang %s"
+
+#: lazarusidestrconsts:lisuidyes
+msgid "yes"
+msgstr "ya"
+
+#: lazarusidestrconsts:lisuidno
+msgid "no"
+msgstr "tidak"
+
+#: lazarusidestrconsts:lisuidbytes
+msgid "%s bytes"
+msgstr "%s byte"
+
+#: lazarusidestrconsts:lisuidname
+msgid "Name:"
+msgstr "Nama:"
+
+#: lazarusidestrconsts:lisuidtype
+msgid "Type:"
+msgstr "TipeL"
+
+#: lazarusidestrconsts:lisuidinproject
+msgid "in Project:"
+msgstr "dalam Proyek:"
+
+#: lazarusidestrconsts:lisuidincludedby
+msgid "Included by:"
+msgstr "Disertakan oleh:"
+
+#: lazarusidestrconsts:lisuidclear
+msgid "Clear"
+msgstr "Bersihkan"
+
+#: lazarusidestrconsts:lisuidpathsreadonly
+msgid "Paths (Read Only)"
+msgstr "Path (Hanya Baca)"
+
+#: lazarusidestrconsts:lisuidunit
+msgid "Unit"
+msgstr "Unit"
+
+#: lazarusidestrconsts:lisuidsrc
+msgid "Src"
+msgstr "Src"
+
+#: lazarusidestrconsts:lisuidok
+msgid "Ok"
+msgstr "Ok"
+
+#: lazarusidestrconsts:lisuidsize
+msgid "Size:"
+msgstr "Ukuran:"
+
+#: lazarusidestrconsts:lisuidlines
+msgid "Lines:"
+msgstr "Baris:"
+
+#: lazarusidestrconsts:lisuishowcodetoolsvalues
+msgid "Show CodeTools Values"
+msgstr "Tampilkan Nilai CodeTools"
+
+#: lazarusidestrconsts:lisueerrorinregularexpression
+msgid "Error in regular expression"
+msgstr "Kesalahan dalam ekspresi reguler"
+
+#: lazarusidestrconsts:lissearchfor
+msgid "Search For "
+msgstr "Mencari"
+
+#: lazarusidestrconsts:lisuenotfound
+msgid "Not found"
+msgstr "Tidak ditemukan"
+
+#: lazarusidestrconsts:lisuesearchstringnotfound
+msgid "Search string '%s' not found!"
+msgstr "Pencarian string '%s' tidak ditemukan!"
+
+#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
+msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
+msgstr "Ganti %s%s%s%s yang ditemukan ini dengan %s%s%s?"
+
+#: lazarusidestrconsts:lisuesearching
+msgid "Searching: %s"
+msgstr "Pencarian: %s"
+
+#: lazarusidestrconsts:lisuereadonly
+msgid "%s/ReadOnly"
+msgstr "%s/HanyaBaca"
+
+#: lazarusidestrconsts:lisuegotoline
+msgid "Goto line :"
+msgstr "Pergi ke baris :"
+
+#: lazarusidestrconsts:listmfunctionextractfileextension
+msgid "Function: extract file extension"
+msgstr "Fungsi: ekstrak ekstensi file"
+
+#: lazarusidestrconsts:listmfunctionextractfilepath
+msgid "Function: extract file path"
+msgstr "Fungsi: ekstrak path file"
+
+#: lazarusidestrconsts:listmfunctionextractfilenameextension
+msgid "Function: extract file name+extension"
+msgstr "Fungsi: ekstrak nama+ekstensi file"
+
+#: lazarusidestrconsts:listmfunctionextractfilenameonly
+msgid "Function: extract file name only"
+msgstr "Fungsi: ekstrak hanya nama file"
+
+#: lazarusidestrconsts:listmfunctionappendpathdelimiter
+msgid "Function: append path delimiter"
+msgstr "Fungsi: tambah delimiter path"
+
+#: lazarusidestrconsts:listmfunctionchomppathdelimiter
+msgid "Function: chomp path delimiter"
+msgstr "Fungsi: chomp delimiter path"
+
+#: lazarusidestrconsts:listmunknownmacro
+msgid "(unknown macro: %s)"
+msgstr "(makro tidak dikenal: %s)"
+
+#: lazarusidestrconsts:lissvuoinvalidvariablename
+msgid "Invalid variable name"
+msgstr "Nama variabel tidak benar"
+
+#: lazarusidestrconsts:lissvuoisnotavalididentifier
+msgid "%s%s%s is not a valid identifier."
+msgstr "%s%s%s bukan pengenal yang benar."
+
+#: lazarusidestrconsts:lisfriidentifier
+msgid "Identifier: %s"
+msgstr "Pengenal: %s"
+
+#: lazarusidestrconsts:lissvuooverridesystemvariable
+msgid "Override system variable"
+msgstr "Timpa variabel sistem"
+
+#: lazarusidestrconsts:lissvuook
+msgid "Ok"
+msgstr "Ok"
+
+#: lazarusidestrconsts:lissortselsortselection
+msgid "Sort selection"
+msgstr "Urut pilihan"
+
+#: lazarusidestrconsts:lissortselpreview
+msgid "Preview"
+msgstr "Peninjauan"
+
+#: lazarusidestrconsts:lissortselascending
+msgid "Ascending"
+msgstr "Membesar"
+
+#: lazarusidestrconsts:lissortseldescending
+msgid "Descending"
+msgstr "Mengecil"
+
+#: lazarusidestrconsts:lissortseldomain
+msgid "Domain"
+msgstr "Domain"
+
+#: lazarusidestrconsts:lissortsellines
+msgid "Lines"
+msgstr "Baris"
+
+#: lazarusidestrconsts:lissortselwords
+msgid "Words"
+msgstr "Kata"
+
+#: lazarusidestrconsts:lissortselparagraphs
+msgid "Paragraphs"
+msgstr "Paragraf"
+
+#: lazarusidestrconsts:lissortseloptions
+msgid "Options"
+msgstr "Opsi"
+
+#: lazarusidestrconsts:lissortselcasesensitive
+msgid "Case Sensitive"
+msgstr "Sensitif Huruf"
+
+#: lazarusidestrconsts:lissortselignorespace
+msgid "Ignore Space"
+msgstr "Abaikan Spasi"
+
+#: lazarusidestrconsts:lissortselsort
+msgid "Accept"
+msgstr "Terima"
+
+#: lazarusidestrconsts:lissortselcancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lazarusidestrconsts:lispublprojinvalidincludefilter
+msgid "Invalid Include filter"
+msgstr "Filter Include tidak benar"
+
+#: lazarusidestrconsts:lispublprojinvalidexcludefilter
+msgid "Invalid Exclude filter"
+msgstr "Filter Exclude tidak benar"
+
+#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
+msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first."
+msgstr "Tidak bisas mengubah form otomatis dibuat dalam sumber program.%Silahkan betulkan kesalahan terlebih dahulu."
+
+#: lazarusidestrconsts:lisprojoptserror
+msgid "Error"
+msgstr "Salah"
+
+#: lazarusidestrconsts:lispatheditselectdirectory
+msgid "Select directory"
+msgstr "Pilih direktori"
+
+#: lazarusidestrconsts:lispatheditsearchpaths
+msgid "Search paths:"
+msgstr "Path Pencarian:"
+
+#: lazarusidestrconsts:lispatheditmovepathdown
+msgid "Move path down"
+msgstr "Turunkan path"
+
+#: lazarusidestrconsts:lispatheditmovepathup
+msgid "Move path up"
+msgstr "Naikkan path"
+
+#: lazarusidestrconsts:lispatheditbrowse
+msgid "Browse"
+msgstr "Browse"
+
+#: lazarusidestrconsts:lispatheditpathtemplates
+msgid "Path templates"
+msgstr "Template Path"
+
+#: lazarusidestrconsts:lisnewdlgnoitemselected
+msgid "No item selected"
+msgstr "Tidak ada item dipilih"
+
+#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
+msgid "Please select an item first."
+msgstr "Silahkan pilih item terlebih dulu."
+
+#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
+msgid "Create a new editor file.%sChoose a type."
+msgstr "Buat file editor baru.%sPilih jenis."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
+msgid "Create a new project.%sChoose a type."
+msgstr "Buat proyek baru.%Pilih jenis."
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
+msgid "Choose one of these items to create a new File"
+msgstr "Pilih satu dari item-item ini untuk membuat File baru"
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
+msgid "Choose one of these items to create a new Project"
+msgstr "Pilih satu dari item-item ini untuk membuat Proyek baru"
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
+msgid "Choose one of these items to create a new Package"
+msgstr "Pilih satu dari item-item ini untuk membuat Paket baru"
+
+#: lazarusidestrconsts:lispackage
+msgid "Package"
+msgstr "Paket"
+
+#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
+msgid "Create a new pascal unit."
+msgstr "Buat unit pascal baru"
+
+#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
+msgid "Create a new unit with a LCL form."
+msgstr "Buat unit baru dengan form LCL."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
+msgid "Create a new unit with a datamodule."
+msgstr "Buat unit baru dengan modul data."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
+msgid "Create a new empty text file."
+msgstr "Buat file teks kosong baru."
+
+#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
+msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
+msgstr "File Program Pascal sederhana.%sIni bisa digunakan untuk pengujian cepat dan kasar.%Lebih baik buat proyek baru."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
+msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
+msgstr "Buat aplikasi grafis baru.%sFile program dipelihara olelh Lazarus."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewprogram
+msgid "Create a new program.%sThe program file is maintained by Lazarus."
+msgstr "Buat program baru.%sFile program diperlihara oleh Lazarus."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
+msgid "Create a new program."
+msgstr "Buat program baru."
+
+#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
+msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
+msgstr "Buat aplikasi cgi baru.%sFile program dipelihara oleh Lazarus."
+
+#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
+msgid "Create a new standard package.%sA package is a collection of units and components."
+msgstr "Buat paket standar baru.%Paket adalah koleksi dari unit dan komponen."
+
+#: lazarusidestrconsts:lisunabletocreatefile
+msgid "Unable to create file"
+msgstr "Tidak bisa membuat file"
+
+#: lazarusidestrconsts:liscannotcreatefile
+msgid "Can not create file %s%s%s"
+msgstr "Tidak bisa membuat file %s%s%s"
+
+#: lazarusidestrconsts:lisextendunitpath
+msgid "Extend unit path?"
+msgstr "Lebarkan path unit?"
+
+#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
+msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
+msgstr "Direktori %s%s%s belum ada dalam path unit.%sTambahkan?"
+
+#: lazarusidestrconsts:lisunabletocreatefilename
+msgid "Unable to create file %s%s%s."
+msgstr "Tidak bisa membuat file %s%s%s."
+
+#: lazarusidestrconsts:lisunabletowritefile
+msgid "Unable to write file"
+msgstr "Tidak bisa menuliskan file"
+
+#: lazarusidestrconsts:lisunabletowritefile2
+msgid "Unable to write file %s%s%s"
+msgstr "Tidak bisa menuliskan file %s%s%s"
+
+#: lazarusidestrconsts:lisfileisnotwritable
+msgid "File is not writable"
+msgstr "File tidak bisa diulisi"
+
+#: lazarusidestrconsts:lisunabletowritetofile2
+msgid "Unable to write to file %s%s%s"
+msgstr "Tidak bisa menulis ke file %s%s%s"
+
+#: lazarusidestrconsts:lisunabletowritefilename
+msgid "Unable to write file %s%s%s."
+msgstr "Tidak bisa menulis file %s%s%s."
+
+#: lazarusidestrconsts:lisunabletoreadfile
+msgid "Unable to read file"
+msgstr "Tidak bisa membaca file"
+
+#: lazarusidestrconsts:lisunabletoreadfilename
+msgid "Unable to read file %s%s%s."
+msgstr "Tidak bisa membaca file %s%s%s."
+
+#: lazarusidestrconsts:liserrordeletingfile
+msgid "Error deleting file"
+msgstr "Kesalahan penghapusan file"
+
+#: lazarusidestrconsts:lisunabletodeleteambiguousfile
+msgid "Unable to delete ambiguous file %s%s%s"
+msgstr "Tidak bisa menghapus file dwimakna %s%s%s"
+
+#: lazarusidestrconsts:liserrorrenamingfile
+msgid "Error renaming file"
+msgstr "Kesalahan penggantian nama file"
+
+#: lazarusidestrconsts:lisunabletorenameambiguousfileto
+msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
+msgstr "Tidak bisa mengganti nama file dwimakna %s%s%s%ske %s%s%s"
+
+#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
+msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
+msgstr "Peringatan: file dwimakna ditemukan: %s%s%s. File Sumber adalah: %s%s%s"
+
+#: lazarusidestrconsts:lisambiguousfilefound
+msgid "Ambiguous file found"
+msgstr "File dwimakna ditemukan"
+
+#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
+msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
+msgstr "Ada file dengan nama sama dan ekstensi mirip pada disk%File: %s%s%sHapus file dwimakna?"
+
+#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
+msgid "Invalid Min-Max version"
+msgstr "Versi Min-Max tidak benar"
+
+#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
+msgid "The Maximum Version is lower than the Minimim Version."
+msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."
+
+#: lazarusidestrconsts:lisprojaddinvalidpackagename
+msgid "Invalid packagename"
+msgstr "Namapaket tidak benar"
+
+#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
+msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
+msgstr "Nama paket %s%s%s tidak benar.%sSilahkan pilih paket yang ada."
+
+#: lazarusidestrconsts:lisprojadddependencyalreadyexists
+msgid "Dependency already exists"
+msgstr "Dependensi sudah ada"
+
+#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
+msgid "The project has already a dependency for the package %s%s%s."
+msgstr "Proyek sudah mempunyai dependensi untuk paket %s%s%s."
+
+#: lazarusidestrconsts:lisprojaddpackagenotfound
+msgid "Package not found"
+msgstr "Paket tidak ditemukan"
+
+#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
+msgid "This file is not in any loaded package."
+msgstr "File tidak dalam paket yang diaktifkan."
+
+#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
+msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
+msgstr "Dependensi %s%s%s tidak ditemukan.%sSilahkan pilih paket yang ada."
+
+#: lazarusidestrconsts:lisprojaddinvalidversion
+msgid "Invalid version"
+msgstr "Versi tidak benar"
+
+#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
+msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr "Versi Minimum %s%s%s tidak benar.%sSilahkan gunakan format mayor mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
+
+#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
+msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr "Versi Maksimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
+
+#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
+msgid "Invalid pascal unit name"
+msgstr "Nama unit pascal tidak benar"
+
+#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
+msgid "The unit name %s%s%s is not a valid pascal identifier."
+msgstr "Nama unit %s%s%s bukan pengenal pascal yang benar."
+
+#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
+msgid "Unit name already exists"
+msgstr "Nama unit sudah ada"
+
+#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
+msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
+msgstr "Nama unit %s%s%s sudah ada dalam proyek%sdengan file: %s%s%s."
+
+#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
+msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
+msgstr "Nama unit %s%s%s sudah ada dalam pilihan%sdengan file: %s%s%s."
+
+#: lazarusidestrconsts:lisprojaddtoproject
+msgid "Add to project"
+msgstr "Tambah ke proyek"
+
+#: lazarusidestrconsts:lisprojaddnewrequirement
+msgid "New Requirement"
+msgstr "Kebutuhan Baru"
+
+#: lazarusidestrconsts:lisprojaddfiles
+msgid "Add files"
+msgstr "Tambah file"
+
+#: lazarusidestrconsts:lisprojaddeditorfile
+msgid "Add editor files"
+msgstr "Tambah file editor"
+
+#: lazarusidestrconsts:lisprojaddaddfiletoproject
+msgid "Add file to project:"
+msgstr "Tambah file ke proyek:"
+
+#: lazarusidestrconsts:lisprojaddpackagename
+msgid "Package Name:"
+msgstr "Nama Paket:"
+
+#: lazarusidestrconsts:lisprojaddminimumversionoptional
+msgid "Minimum Version (optional):"
+msgstr "Versi Minimum (opsional):"
+
+#: lazarusidestrconsts:lisprojaddmaximumversionoptional
+msgid "Maximum Version (optional):"
+msgstr "Versi Maksimum (opsional):"
+
+#: lazarusidestrconsts:liscomppalopenpackage
+msgid "Open package"
+msgstr "Buka paket"
+
+#: lazarusidestrconsts:liscomppalopenunit
+msgid "Open unit"
+msgstr "Buka unit"
+
+#: lazarusidestrconsts:lismacropromptenterdata
+msgid "Enter data"
+msgstr "Masukkan data"
+
+#: lazarusidestrconsts:lismacropromptenterrunparameters
+msgid "Enter run parameters"
+msgstr "Masukkan parameter menjalankan"
+
+#: lazarusidestrconsts:lisdebuggererror
+msgid "Debugger error"
+msgstr "Kesalahan Debugger"
+
+#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
+msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
+msgstr "Kesalahan Debugger%sOoops, debugger masuk ke keadaan salah%sSimpan pekerjaan anda sekarang !%sTekan Hentikan, dan harapan terbaik, kami mencabut colokan."
+
+#: lazarusidestrconsts:lisexecutionstopped
+msgid "Execution stopped"
+msgstr "Eksekusi dihentikan"
+
+#: lazarusidestrconsts:lisexecutionstoppedon
+msgid "Execution stopped%s"
+msgstr "Eksekusi dihentikan%s"
+
+#: lazarusidestrconsts:lisexecutionpaused
+msgid "Execution paused"
+msgstr "Eksekusi diistirahatkan"
+
+#: lazarusidestrconsts:lisexecutionpausedadress
+msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
+msgstr "Eksekusi diistirahatkan%s  Alamat: $%s%s  Prosedur: %s%s  File: %s%s(Suatu hari jendela assembler mungkin muncul disini :)%s"
+
+#: lazarusidestrconsts:lisfilenotfound
+msgid "File not found"
+msgstr "File tidak ditemukan"
+
+#: lazarusidestrconsts:liscleanupunitpath
+msgid "Clean up unit path?"
+msgstr "bersihkan path unit?"
+
+#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
+msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
+msgstr "Direktori %s%s%s tidak dibutuhkan lagi dalam path unit.%sHapus?"
+
+#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
+msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
+msgstr "File %s%s%s%stidak ditemukan.%sAnda ingin mencarinya sendiri?%s"
+
+#: lazarusidestrconsts:lisruntofailed
+msgid "Run-to failed"
+msgstr "Jalankan-sampai gagal"
+
+#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
+msgid "No debugger specified"
+msgstr "Debugger tidak ditetapkan"
+
+#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
+msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
+msgstr "Tidak ada debugger ditetapkan.%sSeting titikpisah tidak berpengaruh sampai anda menyiapkan Debugger dalam opsi dialog debugger dalam menu."
+
+#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
+msgid "Set the breakpoint anyway"
+msgstr "Tetap set titikpisah"
+
+#: lazarusidestrconsts:lislaunchingapplicationinvalid
+msgid "Launching application invalid"
+msgstr "Menjalankan aplikasi tidak benar"
+
+#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
+msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
+msgstr "Menjalankan aplikasi %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Jalankan -> Parameter menjalankan -> Lokal"
+
+#: lazarusidestrconsts:lisdebuggerinvalid
+msgid "Debugger invalid"
+msgstr "Debugger tidak benar"
+
+#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
+msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
+msgstr "Debugger %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Lingkungan -> Opsi Debugger"
+
+#: lazarusidestrconsts:lispleaseopenaunitbeforerun
+msgid "Please open a unit before run."
+msgstr "Silahkan buka unit sebelum menjalankan"
+
+#: lazarusidestrconsts:lisdiskdifferrorreadingfile
+msgid "Error reading file: %s"
+msgstr "Kesalahan pembacaan file: %s"
+
+#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
+msgid "Some files have changed on disk:"
+msgstr "Beberapa file telah berubah pada disk:"
+
+#: lazarusidestrconsts:lisdiskdiffchangedfiles
+msgid "Changed files:"
+msgstr "File yang berubah:"
+
+#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
+msgid "Click on one of the above items to see the diff"
+msgstr "Klik pada salah satu item diatas untuk melihat perbedaan"
+
+#: lazarusidestrconsts:lisdiskdiffrevertall
+msgid "Reload from disk"
+msgstr "Ambil lagi dari disk"
+
+#: lazarusidestrconsts:lisdiskdiffignorediskchanges
+msgid "Ignore disk changes"
+msgstr "Abaikan perubahan disk"
+
+#: lazarusidestrconsts:lisedtdefcurrentproject
+msgid "Current Project"
+msgstr "Proyek Saat Ini"
+
+#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
+msgid "Current Project Directory"
+msgstr "Direktori Proyek Saat Ini"
+
+#: lazarusidestrconsts:lisedtdefprojectsrcpath
+msgid "Project SrcPath"
+msgstr "SrcPath Proyek"
+
+#: lazarusidestrconsts:lisedtdefprojectincpath
+msgid "Project IncPath"
+msgstr "IncPath Proyek"
+
+#: lazarusidestrconsts:lisedtdefprojectunitpath
+msgid "Project UnitPath"
+msgstr "UnitPath Proyek"
+
+#: lazarusidestrconsts:lisedtdefallpackages
+msgid "All packages"
+msgstr "Semua paket"
+
+#: lazarusidestrconsts:lisedtdefsallprojects
+msgid "All projects"
+msgstr "Semua proyek"
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
+msgid "set FPC mode to DELPHI"
+msgstr "set mode  FPC ke DELPHI"
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
+msgid "set FPC mode to TP"
+msgstr "set mode FPC ke TP"
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
+msgid "set FPC mode to GPC"
+msgstr "set mode FPC ke GPC"
+
+#: lazarusidestrconsts:lisedtdefsetiocheckson
+msgid "set IOCHECKS on"
+msgstr "set IOCHECKS on"
+
+#: lazarusidestrconsts:lisedtdefsetrangecheckson
+msgid "set RANGECHECKS on"
+msgstr "set RANGECHECKS on"
+
+#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
+msgid "set OVERFLOWCHECKS on"
+msgstr "set OVERFLOWCHECKS on"
+
+#: lazarusidestrconsts:lisedtdefuselineinfounit
+msgid "use LineInfo unit"
+msgstr "gunakan unit LineInfo"
+
+#: lazarusidestrconsts:lisedtdefuseheaptrcunit
+msgid "use HeapTrc unit"
+msgstr "gunakan unit HeapTrc"
+
+#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
+msgid "Global Source Path addition"
+msgstr "tambahan Path Sumber Global"
+
+#: lazarusidestrconsts:lisexttoolfailedtoruntool
+msgid "Failed to run tool"
+msgstr "Gagal untuk menjalankan piranti"
+
+#: lazarusidestrconsts:lisexttoolunabletorunthetool
+msgid "Unable to run the tool %s%s%s:%s%s"
+msgstr "Tidak bisa menjalankan piranti %s%s%s:%s%s"
+
+#: lazarusidestrconsts:lisexttoolexternaltools
+msgid "External tools"
+msgstr "Piranti eksternal"
+
+#: lazarusidestrconsts:lisexttoolremove
+msgid "Remove"
+msgstr "Hapus"
+
+#: lazarusidestrconsts:lisexttoolmoveup
+msgid "Up"
+msgstr "Naik"
+
+#: lazarusidestrconsts:lisexttoolmovedown
+msgid "Down"
+msgstr "Turun"
+
+#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
+msgid "Maximum Tools reached"
+msgstr "Piranti Maksimum tercapai"
+
+#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
+msgid "There is a maximum of %s tools."
+msgstr "Terdapat jumlah maksimum %s piranti."
+
+#: lazarusidestrconsts:lisedtexttooledittool
+msgid "Edit Tool"
+msgstr "Edit Piranti"
+
+#: lazarusidestrconsts:lisedtexttoolprogramfilename
+msgid "Programfilename:"
+msgstr "Namafileprogram:"
+
+#: lazarusidestrconsts:lisedtexttoolparameters
+msgid "Parameters:"
+msgstr "Parameters:"
+
+#: lazarusidestrconsts:lisedtexttoolworkingdirectory
+msgid "Working Directory:"
+msgstr "Direktori Kerja:"
+
+#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
+msgid "Scan output for Free Pascal Compiler messages"
+msgstr "Pindai output untuk pesan Kompilator Free Pascal"
+
+#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
+msgid "Scan output for make messages"
+msgstr "Pindai output untuk pesan make"
+
+#: lazarusidestrconsts:lisedtexttoolkey
+msgid "Key"
+msgstr "Tombol"
+
+#: lazarusidestrconsts:lisedtexttoolctrl
+msgid "Ctrl"
+msgstr "Ctrl"
+
+#: lazarusidestrconsts:lisedtexttoolalt
+msgid "Alt"
+msgstr "Alt"
+
+#: lazarusidestrconsts:lisedtexttoolshift
+msgid "Shift"
+msgstr "Shift"
+
+#: lazarusidestrconsts:lisedtexttoolmacros
+msgid "Macros"
+msgstr "Makro"
+
+#: lazarusidestrconsts:lisedtexttoolinsert
+msgid "Insert"
+msgstr "Sisipkan"
+
+#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
+msgid "Title and Filename required"
+msgstr "Dibutuhkan Nama file dan Judul"
+
+#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
+msgid "A valid tool needs at least a title and a filename."
+msgstr "Piranti yang benar membutuhkan setidaknya judul dan nama file."
+
+#: lazarusidestrconsts:lisfindfiletexttofind
+msgid "Text to find:"
+msgstr "Teks yang dicari:"
+
+#: lazarusidestrconsts:lisfindfilecasesensitive
+msgid "Case sensitive"
+msgstr "Sensitif huruf"
+
+#: lazarusidestrconsts:lisfindfilewholewordsonly
+msgid "Whole words only"
+msgstr "Hanya seluruh kata"
+
+#: lazarusidestrconsts:lisfindfileregularexpressions
+msgid "Regular expressions"
+msgstr "Ekspresi reguler"
+
+#: lazarusidestrconsts:lisfindfilewhere
+msgid "Where"
+msgstr "Dimana"
+
+#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
+msgid "search all files in project"
+msgstr "cari semua file dalam proyek"
+
+#: lazarusidestrconsts:lisfindfilesearchallopenfiles
+msgid "search all open files"
+msgstr "cari semua file terbuka"
+
+#: lazarusidestrconsts:lisfindfilesearchindirectories
+msgid "search in directories"
+msgstr "cari dalam direktori"
+
+#: lazarusidestrconsts:lisfindfiledirectoryoptions
+msgid "Directory options"
+msgstr "Opsi direktori"
+
+#: lazarusidestrconsts:lisfindfilefilemaskbak
+msgid "File mask (*;*.*;*.bak?)"
+msgstr "File mask (*;*.*;*.bak?)"
+
+#: lazarusidestrconsts:lisfindfileincludesubdirectories
+msgid "Include sub directories"
+msgstr "Sertakan sub direktori"
+
+#: lazarusidestrconsts:lisfindfileonlytextfiles
+msgid "Only text files"
+msgstr "Hanya file teks"
+
+#: lazarusidestrconsts:lispkgmangpackage
+msgid "Package: %s"
+msgstr "Paket: %s"
+
+#: lazarusidestrconsts:lispkgmangproject
+msgid "Project: %s"
+msgstr "Proyek: %s"
+
+#: lazarusidestrconsts:lispkgmanglazarus
+msgid "Lazarus"
+msgstr "Lazarus"
+
+#: lazarusidestrconsts:lispkgmangdependencywithoutowner
+msgid "Dependency without Owner: %s"
+msgstr "Dependensi tapa Pemilik: %s"
+
+#: lazarusidestrconsts:lispkgmangsavepackagelpk
+msgid "Save Package %s (*.lpk)"
+msgstr "Simpan Paket %s (*.lpk)"
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
+msgid "Invalid package file extension"
+msgstr "Ekstensi file paket tidak benar"
+
+#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
+msgid "Packages must have the extension .lpk"
+msgstr "Paket harus mempunyai ekstensi .lpk"
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagename
+msgid "Invalid package name"
+msgstr "Nama paket tidak benar"
+
+#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
+msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
+msgstr "Nama paket %s%s%s bukan nama paket yang benar%sSilahkan pilih nama lain (contoh. paket1.lpk)"
+
+#: lazarusidestrconsts:lispkgmangrenamefilelowercase
+msgid "Rename File lowercase?"
+msgstr "Ganti nama File ke huruf kecil?"
+
+#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
+msgid "Should the file be renamed lowercase to%s%s%s%s?"
+msgstr "Haruskah file diganti nama huruf kecil ke %s%s%s%s?"
+
+#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
+msgid "Package name already exists"
+msgstr "Nama paket sudah ada"
+
+#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
+msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
+msgstr "Sudah ada nama paket lain dengan nama %s%s%s.%sPaket konflik: %s%s%s%sFile: %s%s%s"
+
+#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
+msgid "Filename is used by project"
+msgstr "Nama file sedang digunakan oleh proyek"
+
+#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
+msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
+msgstr "Nama file %s%s%s adalah bagian dari proyek saat ini.%sProyek dan Paket seharusnya bukan file berbagi."
+
+#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
+msgid "Filename is used by other package"
+msgstr "Nama file sedang digunakan oleh paket lain"
+
+#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
+msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
+msgstr "Nama file %s%s%s digunakan oleh%spaket %s%s%s%sdalam file %s%s%s."
+
+#: lazarusidestrconsts:lispkgmangreplacefile
+msgid "Replace File"
+msgstr "Timpa File"
+
+#: lazarusidestrconsts:lispkgmangreplaceexistingfile
+msgid "Replace existing file %s%s%s?"
+msgstr "Timpa file yang sudah ada %s%s%s?"
+
+#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
+msgid "Delete Old Package File?"
+msgstr "Hapus File Paket Lama?"
+
+#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
+msgid "Delete old package file %s%s%s?"
+msgstr "Hapus file paket %s%s%s?"
+
+#: lazarusidestrconsts:lispkgmangdeletefailed
+msgid "Delete failed"
+msgstr "Penghapusan gagal"
+
+#: lazarusidestrconsts:lisambiguousunitfound
+msgid "Ambiguous Unit found"
+msgstr "Unit Dwimakna ditemukan"
+
+#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
+msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
+msgstr "File %s%s%s%sditemukan dalam direktori sumber dari paket %s dan sepertinya unit dikompilasi. Unit yang dikompilasi harus berada dalam direktori output paket, jika tidak paket lain akan mendapatkan masalah menggunakan paket ini.%s%sHapus file dwimakna?"
+
+#: lazarusidestrconsts:lispkgmangunabletodeletefile
+msgid "Unable to delete file %s%s%s."
+msgstr "Tidak bisa menghapus file %s%s%s."
+
+#: lazarusidestrconsts:lisdeleteallthesefiles
+msgid "Delete all these files?"
+msgstr "Hapus semua file ini?"
+
+#: lazarusidestrconsts:lispkgmangunsavedpackage
+msgid "Unsaved package"
+msgstr "Paket tidak disimpan"
+
+#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
+msgid "There is an unsaved package in the required packages. See package graph."
+msgstr "Ada paket tidak disimpan dalam paket yang diperlukan. Lihat grafik paket."
+
+#: lazarusidestrconsts:lispkgmangbrokendependency
+msgid "Broken dependency"
+msgstr "Dependensi Rusak"
+
+#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
+msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
+msgstr "Proyek memerlukan paket %s%s%s.%sTetapi tidak ditemukan. Lihat Proyek -> Inspektor Proyek."
+
+#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
+msgid "A required packages was not found. See package graph."
+msgstr "Paket yang dibutuhkan tidak ditemukan. Lihat grafik paket."
+
+#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
+msgid "Circle in package dependencies"
+msgstr "Berputar dalam dependensi paket"
+
+#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
+msgid "There is a circle in the required packages. See package graph."
+msgstr "Ada lingkaran dalam paket yang diperlukan. Lihat grafik paket."
+
+#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
+msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
+msgstr "Ada dua unit dengan nama sama:%s%s1. %s%s%s dari %s%s2. %s%s%s dari %s%s%s"
+
+#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
+msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
+msgstr "Ada unit dengan nama yang sama dengan paket:%s%s1. %s%s%s dari %s%s2. %s%s%s%s"
+
+#: lazarusidestrconsts:lispkgmangambiguousunitsfound
+msgid "Ambiguous units found"
+msgstr "Unit dwimakna ditemukan"
+
+#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
+msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
+msgstr "%sKedua paket tersambung. Ini berarti, This means, either one package uses the other, or they are both used by a third package."
+
+#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
+msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
+msgstr "Ada unit FPC dengan nama yang sama dengan: %s%s%s%s%s dari %s%s%s"
+
+#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
+msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
+msgstr "Ada unit  FPC dengan nama yang sama dengan paket::%s%s%s%s%s%s"
+
+#: lazarusidestrconsts:lispkgmangerrorwritingfile
+msgid "Error writing file"
+msgstr "Kesalahan penulisan file"
+
+#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
+msgid "Unable to write state file for project %s%sError: %s"
+msgstr "Tidak bisa menuliskan file kondisi untuk proyek %s%sKesalahanr: %s"
+
+#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
+msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
+msgstr "Tidak bisa menulis file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"
+
+#: lazarusidestrconsts:lispkgmangerrorreadingfile
+msgid "Error reading file"
+msgstr "Kesalahan pembacaan file"
+
+#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
+msgid "Unable to read state file %s of project %s%sError: %s"
+msgstr "Tidak bisa membaca file kondisi %s dari proyek %s%sKesalahan: %s"
+
+#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
+msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
+msgstr "Tidak bisa membaca file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"
+
+#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
+msgid "Unable to create directory"
+msgstr "Tidak bisa membuat direktori"
+
+#: lazarusidestrconsts:lisunabletocreatedirectory2
+msgid "Unable to create directory %s%s%s"
+msgstr "Tidak bisa membuat direktori %s%s%s"
+
+#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
+msgid "Unable to create output directory %s%s%s%sfor package %s."
+msgstr "Tidak bisa membuat direktori output %s%s%s%suntuk paket %s."
+
+#: lazarusidestrconsts:lispkgmangunabletodeletefilename
+msgid "Unable to delete file"
+msgstr "Tidak bisa menghapus file"
+
+#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
+msgid "Unable to delete old state file %s%s%s%sfor package %s."
+msgstr "Tidak bisa menghapus file kondisi yang lama %s%s%s%suntuk paket %s."
+
+#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
+msgid "Unable to create package source directory %s%s%s%sfor package %s."
+msgstr "Tidak bisa membuat direktori sumber paket %s%s%s%suntuk paket %s."
+
+#: lazarusidestrconsts:lispkgmangunabletoloadpackage
+msgid "Unable to load package"
+msgstr "Tidak bisa mengambil paket"
+
+#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
+msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
+msgstr "Tidak bisa membuka paket %s%s%s.%sPaket ini ditandai untuk instalasi."
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagename2
+msgid "Invalid Package Name"
+msgstr "Nama Paket Tidak Benar"
+
+#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
+msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
+msgstr "Nama paket %s%s%s dari%sfile %s%s%s tidak benar."
+
+#: lazarusidestrconsts:lispkgmangpackageconflicts
+msgid "Package conflicts"
+msgstr "Paket konflik"
+
+#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
+msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
+msgstr "Sudah ada paket %s%s%s diambil%sdari file %s%s%s.%sLihat Komponen -> Grafik Paket.%sPenimpaan tidak mungkin."
+
+#: lazarusidestrconsts:lispkgmangsavepackage
+msgid "Save Package?"
+msgstr "Simpan Paket?"
+
+#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
+msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
+msgstr "Pengambilan paket %s akan menimpa paket %s%sdari file %s.%sPaket lama diubah.%s%sSimpan paket lama %s?"
+
+#: lazarusidestrconsts:lispkgmangnewpackage
+msgid "NewPackage"
+msgstr "PaketBaru"
+
+#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
+msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
+msgstr "Mungkin anda perlu menginstalasi beberapa paket sebelum melanjutkan. %s%sPerhatian:%sProyek tergantung pada beberapa paket, yang berisi unit dengan prosedur Register. Prosedur Register biasanya digunakan untuk menginstalasi komponen dalam IDE. Tetapi unit berikut milik paket yang belum diinstalasi dalam IDE. Jika anda ingin mencoba membuka form dalam IDE, yang menggunakan komponen tersebut, anda akan mendapatkan kesalahan mengenai komponen yang tidak ada dan pengambilan form akan membuat hasil yang tidak menyenangkan.%s%sIni tidak berpengaruh pada pembukaan proyek atau sumbernya.%s%sIni hanya berarti: Adalah ide yang buruk untuk membuka form untuk desain, sebelum menginstalasi paket yang tidak ada.%s%s"
+
+#: lazarusidestrconsts:lispackageneedsinstallation
+msgid "Package needs installation"
+msgstr "Paket perlu diinstalasi"
+
+#: lazarusidestrconsts:lispkgmanginvalidfileextension
+msgid "Invalid file extension"
+msgstr "Ekstensi file tidak benar"
+
+#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
+msgid "The file %s%s%s is not a lazarus package."
+msgstr "File %s%s%s ibukan paket Lazarus."
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
+msgid "Invalid package filename"
+msgstr "Nama file paket tidak benar"
+
+#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
+msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
+msgstr "Nama file paket %s%s%s in%s%s%s%s bukan nama paket Lazarus yang benar."
+
+#: lazarusidestrconsts:lispkgmangfilenotfound
+msgid "File %s%s%s not found."
+msgstr "File %s%s%s tidak ditemukan."
+
+#: lazarusidestrconsts:lispkgmangerrorreadingpackage
+msgid "Error Reading Package"
+msgstr "Kesalahan Pembacaan Paket"
+
+#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
+msgid "Unable to read package file %s%s%s.%sError: %s"
+msgstr "Tidak bisa membaca file paket %s%s%s.%sKesalahan: %s"
+
+#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
+msgid "Filename differs from Packagename"
+msgstr "Nama file berbeda dari Namapaket"
+
+#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
+msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
+msgstr "Nama file %s%s%s tidak terkait ke nama paket %s%s%s dalam file.%sUbah nama paket ke %s%s%s?"
+
+#: lazarusidestrconsts:lispkgmangsavepackage2
+msgid "Save package?"
+msgstr "Simpan paket?"
+
+#: lazarusidestrconsts:lispkgmangpackagechangedsave
+msgid "Package %s%s%s changed. Save?"
+msgstr "Paket %s%s%s diubah. Simpan?"
+
+#: lazarusidestrconsts:lispkgmangerrorwritingpackage
+msgid "Error Writing Package"
+msgstr "Kesalahan Penulisan Paket"
+
+#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
+msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
+msgstr "Tidak bisa menulis paket %s%s%s%ske file %s%s%s.%sKesalahan: %s"
+
+#: lazarusidestrconsts:lisseeprojectprojectinspector
+msgid "%sSee Project -> Project Inspector"
+msgstr "%sLihat Proyek -> Inspektor Proyek"
+
+#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
+msgid "The following package failed to load:"
+msgstr "Paket berikut gagal diambil:"
+
+#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
+msgid "The following packages failed to load:"
+msgstr "Paket berikut gagal diambil:"
+
+#: lazarusidestrconsts:lismissingpackages
+msgid "Missing Packages"
+msgstr "Paket Tidak Ada"
+
+#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
+msgid "invalid Compiler filename"
+msgstr "Nama file Kompilator tidak benar"
+
+#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
+msgid "The compiler file for package %s is not a valid executable:%s%s"
+msgstr "File kompilator  untuk paket %s bukan eksekutabel yang benar: %s%s"
+
+#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
+msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
+msgstr "Paket %s%s%s tidak mempunyai direktori output yang benar:%s%s%s%s"
+
+#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
+msgid "package main source file"
+msgstr "file sumber utama paket"
+
+#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
+msgid "This file was automatically created by Lazarus. Do not edit!"
+msgstr "File ini dibuat secara otomatis oleh Lazarus. Jangan diedit"
+
+#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
+msgid "This source is only used to compile and install the package."
+msgstr "Sumber ini hanya digunakan untuk kompilasi dan instalasi paket."
+
+#: lazarusidestrconsts:lispkgmangrenamefileinpackage
+msgid "Rename file in package?"
+msgstr "Ganti nama file dalam paket?"
+
+#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
+msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
+msgstr "Paket %s memiliki file%s%s%s%s.%sHaruskah file diganti nama didalam paket juga?"
+
+#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
+msgid "%sAdding new Dependency for project %s: package %s%s"
+msgstr "%sPenambahan Dependensi baru untuk proyek %s: paket %s%s"
+
+#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
+msgid "%sAdding new Dependency for package %s: package %s%s"
+msgstr "%sPenambahan Dependensi baru untuk paket %s: paket %s%s"
+
+#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
+msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
+msgstr "%sUnit berikut akan ditambahkan ke bagian uses dari%s%s:%s%s%s"
+
+#: lazarusidestrconsts:lisconfirmchanges
+msgid "Confirm changes"
+msgstr "Konfirmasi perubahan"
+
+#: lazarusidestrconsts:lispkgmangfilenotsaved
+msgid "File not saved"
+msgstr "File tidak disimpan"
+
+#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
+msgid "Please save the file before adding it to a package."
+msgstr "Silahkan simpan file sebelum menambahkannya ke paket."
+
+#: lazarusidestrconsts:lispkgmangfileisinproject
+msgid "File is in Project"
+msgstr "File dalam Proyek"
+
+#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
+msgid "Warning: The file %s%s%s%sbelongs to the current project."
+msgstr "Perhatian: File %s%s%s%smilik proyek saat ini."
+
+#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
+msgid "File is already in package"
+msgstr "File sudah ada dalam paket"
+
+#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
+msgid "The file %s%s%s%sis already in the package %s."
+msgstr "File %s%s%s%ssudah berada dalam paket %s."
+
+#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
+msgid "Package is no designtime package"
+msgstr "Paket bukan paket waktu desain"
+
+#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
+msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
+msgstr "Paket %s adalah hanya paket runtime.%sPaket hanya runtime tidak bisa diinstalasi dalam IDE."
+
+#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
+msgid "Automatically installed packages"
+msgstr "Otomatis menginstalasi paket"
+
+#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
+msgid "Installing the package %s will automatically install the packages:"
+msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
+
+#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
+msgid "Installing the package %s will automatically install the package:"
+msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
+
+#: lazarusidestrconsts:lispkgmangrebuildlazarus
+msgid "Rebuild Lazarus?"
+msgstr "Bangun ulang Lazarus?"
+
+#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
+msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
+msgstr "Paket %s%s%s  ditandai untuk instalasi.%sSaat ini Lazarus hanya mendukung paket static linked. Instalasi sebenarnya memerlukan pembangunan ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
+
+#: lazarusidestrconsts:lispkgmangpackageisrequired
+msgid "Package is required"
+msgstr "Paket dibutuhkan"
+
+#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
+msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
+msgstr "Paket %s diperlukan oleh %s, yang ditandai untuk instalasi.%sLihat grafik paket."
+
+#: lazarusidestrconsts:lispkgmanguninstallpackage
+msgid "Uninstall package?"
+msgstr "Batalkan instalasi paket?"
+
+#: lazarusidestrconsts:lispkgmanguninstallpackage2
+msgid "Uninstall package %s?"
+msgstr "Batalkan instalasi paket %s?"
+
+#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
+msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
+msgstr "Paket %s%s%s sudah ditandai.%sSaat ini Lazarus hanya mendukung paket static linked. Pembatalan instalasi sebenarnya perlu membangun ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
+
+#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
+msgid "This is a virtual package. It has no source yet. Please save the package first."
+msgstr "Ini adalah paket virtual. belum mempunyai sumber. Silahkan simpan paket terlebih dulu."
+
+#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
+msgid "Please save the package first."
+msgstr "Silahkan simpan terlebih dulu."
+
+#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
+msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
+msgstr "Paket %s%s%s ditandai untuk instalasi, tetapi tidak ditemukan.%sHapus dependensi dari daftar instalasi paket?"
+
+#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
+msgid "static packages config file"
+msgstr "file konfigurasi paket statik"
+
+#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
+msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
+msgstr "Tidak bisa membuat direktori target untuk lazarus:%s%s%s%s.%sDirektori ini dibutuhkan untuk Lazarus IDE baru yang diubah dengan paket kustom anda."
+
+#: lazarusidestrconsts:lispkgsysinvalidunitname
+msgid "Invalid Unitname: %s"
+msgstr "Nama unit tidak benar: %s"
+
+#: lazarusidestrconsts:lispkgsysunitnotfound
+msgid "Unit not found: %s%s%s"
+msgstr "Unit tidak ditemukan: %s%s%s"
+
+#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
+msgid "Unit %s%s%s was removed from package"
+msgstr "Unit %s%s%s sudah dihapus dari paket"
+
+#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
+msgid "Can not register components without unit"
+msgstr "Tidak bisa mendaftarkan komponen tanpa unit"
+
+#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
+msgid "Invalid component class"
+msgstr "Kelas komponen tidak benar"
+
+#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
+msgid "Component Class %s%s%s already defined"
+msgstr "Kelas Komponen %s%s%s sudah didefinisikan"
+
+#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
+msgid "RegisterUnit was called, but no package is registering."
+msgstr "RegisterUnit dipanggil, tetapi tidak ada paket yang terdaftar."
+
+#: lazarusidestrconsts:lispkgsysunitname
+msgid "%s%sUnit Name: %s%s%s"
+msgstr "%s%sNama Unit: %s%s%s"
+
+#: lazarusidestrconsts:lispkgsysfilename
+msgid "%s%sFile Name: %s%s%s"
+msgstr "%s%sNama File: %s%s%s"
+
+#: lazarusidestrconsts:lispkgsysregistrationerror
+msgid "Registration Error"
+msgstr "Registrasi Salah"
+
+#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
+msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
+msgstr "RTL - Run-Tima Library adalah dasar dari semua program Free Pascal."
+
+#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
+msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
+msgstr "FCL - FreePascal Component Library menyediakan dasar kelas untuk objek pascal."
+
+#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
+msgid "The LCL - Lazarus Component Library contains all base components for form editing."
+msgstr "LCL - Lazarus Component Library berisi semua dasar komponen untuk pengeditan form."
+
+#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
+msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
+msgstr "SynEdit - komponen editor yang digunakan oleh Lazarus. http://sourceforge.net/projects/synedit/"
+
+#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
+msgid "This is the default package. Used only for components without a package. These components are outdated."
+msgstr "Ini adalah paket default. Digunakan hanya untuk komponen tanpa paket. Komponen ini kadaluarsa."
+
+#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
+msgid "Register procedure is nil"
+msgstr "Register procedure kosong"
+
+#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
+msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
+msgstr "Paket diinstalasi, tetapi file lpk tidak ditemukan. Semua komponennya di-non aktifkan. Silahkan betulkan ini."
+
+#: lazarusidestrconsts:lispkgsyspackagefilenotfound
+msgid "Package file not found"
+msgstr "File paket tidak ditemukan"
+
+#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
+msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
+msgstr "Paket ini %s%s%s diinstalasi, tetapi tanpa file paket (.lpk) yang ditemukan.%spaket sementara yang rusak dibuat."
+
+#: lazarusidestrconsts:lispkgdefsoutputdirectory
+msgid "Output directory"
+msgstr "Direktori output"
+
+#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
+msgid "CompiledSrcPath addition"
+msgstr "Tambahan CompiledSrcPath"
+
+#: lazarusidestrconsts:lispkgdefsunitpath
+msgid "Unit Path"
+msgstr "Path Unit"
+
+#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
+msgid "Project Source Directory Mark"
+msgstr "Tanda Direktori Sumber Proyek"
+
+#: lazarusidestrconsts:lispkgdefssrcdirmark
+msgid "Package Source Directory Mark"
+msgstr "Tanda Direktori Sumber Proyek"
+
+#: lazarusidestrconsts:lisaf2pinvalidpackage
+msgid "Invalid Package"
+msgstr "Paket Tidak benar"
+
+#: lazarusidestrconsts:lisaf2pinvalidpackageid
+msgid "Invalid package ID: %s%s%s"
+msgstr "ID paket tidak benar: %s%s%s"
+
+#: lazarusidestrconsts:lisaf2ppackagenotfound
+msgid "Package %s%s%s not found."
+msgstr "Paket %s%s%s tidak ditemukan."
+
+#: lazarusidestrconsts:lisaf2ppackageisreadonly
+msgid "Package is read only"
+msgstr "Paket hanya baca"
+
+#: lazarusidestrconsts:lisaf2pthepackageisreadonly
+msgid "The package %s is read only."
+msgstr "Paket %s hanya baca."
+
+#: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage
+msgid "The file %s%s%s%sis already in the package %s."
+msgstr "File %s%s%s%ssudah dalam paket %s."
+
+#: lazarusidestrconsts:lisaf2punitname
+msgid "Unit Name: "
+msgstr "Nama Unit:"
+
+#: lazarusidestrconsts:lisaf2phasregisterprocedure
+msgid "Has Register procedure"
+msgstr "Mempunyai prosedur Register"
+
+#: lazarusidestrconsts:lisaf2pisvirtualunit
+msgid "Virtual unit (source is not in package)"
+msgstr "Unit virtual (sumber tidak dalam paket)"
+
+#: lazarusidestrconsts:lisaf2pfiletype
+msgid "File Type"
+msgstr "Tipe File"
+
+#: lazarusidestrconsts:lisaf2pdestinationpackage
+msgid "Destination Package"
+msgstr "Paket Tujuan"
+
+#: lazarusidestrconsts:lisaf2pshowall
+msgid "Show All"
+msgstr "Tampilkan Semua"
+
+#: lazarusidestrconsts:lisaf2paddfiletoapackage
+msgid "Add file to a package"
+msgstr "Tambah file ke paket"
+
+#: lazarusidestrconsts:lisa2pinvalidfilename
+msgid "Invalid filename"
+msgstr "Nama file tidak benar"
+
+#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
+msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
+msgstr "Nama file %s%s%s dwimakna, karena paket belum mempunyai direktori default. %sSilahkan tetapkan nama file dengan path penuh."
+
+#: lazarusidestrconsts:lisa2pfilenotunit
+msgid "File not unit"
+msgstr "File bukan unit"
+
+#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
+msgid "Pascal units must have the extension .pp or .pas"
+msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"
+
+#: lazarusidestrconsts:lisa2pisnotavalidunitname
+msgid "%s%s%s is not a valid unit name."
+msgstr "%s%s%s bukan nama unit yang benar."
+
+#: lazarusidestrconsts:lisa2punitnamealreadyexists
+msgid "Unitname already exists"
+msgstr "Nama unit sudah ada"
+
+#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
+msgid "The unitname %s%s%s already exists in this package."
+msgstr "Nama unit %s%s%s sudah ada dalam paket ini."
+
+#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
+msgid "The unitname %s%s%s already exists in the package:%s%s"
+msgstr "Nama unit %s%s%s sudah ada dalam paket:%s%s"
+
+#: lazarusidestrconsts:lisa2pambiguousunitname
+msgid "Ambiguous Unit Name"
+msgstr "Nama Unit Dwimakna"
+
+#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
+msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
+msgstr "Nama unit %s%s%s sama dengan komponen terdaftar.%sMenggunakan ini bisa menyebabkan pesan kesalahan aneh."
+
+#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
+msgid "File %s%s%s already exists in the project."
+msgstr "File %s%s%ssudah ada dalam proyek."
+
+#: lazarusidestrconsts:lisa2pexistingfile
+msgid "%sExisting file: %s%s%s"
+msgstr "%sFile yang sudah ada: %s%s%s"
+
+#: lazarusidestrconsts:lisa2pfilealreadyexists
+msgid "File already exists"
+msgstr "File sudah ada"
+
+#: lazarusidestrconsts:lisa2pfileisused
+msgid "File is used"
+msgstr "File sudah digunakan"
+
+#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
+msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
+msgstr "File %s%s%s adalah bagian dari proyek saat ini.%sAdalah ide buruk untuk membagi file diantara proyek dan paket."
+
+#: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion
+msgid "The Maximum Version is lower than the Minimim Version."
+msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."
+
+#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
+msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
+msgstr "Nama paket  %s%s%s tidak benar.%sSilahkan pilih paket yang sudah ada."
+
+#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
+msgid "The package has already a dependency for the package %s%s%s."
+msgstr "Paket sudah mempunyai dependensi untuk paket %s%s%s."
+
+#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
+msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
+msgstr "Tidak ada paket ditemukan untuk dependensi %s%s%s.%sSilahkan pilih paket yang sudah ada."
+
+#: lazarusidestrconsts:lisa2pinvalidunitname
+msgid "Invalid Unit Name"
+msgstr "Nama Unit tidak benar"
+
+#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
+msgid "The unit name %s%s%s%sand filename %s%s%s differ."
+msgstr "Nama unit %s%s%s dan nama file %s%s%s berbeda."
+
+#: lazarusidestrconsts:lisa2pfilealreadyinpackage
+msgid "File already in package"
+msgstr "File sudah dalam paket"
+
+#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
+msgid "The file %s%s%s is already in the package."
+msgstr "File %s%s%s sudah dalam paket."
+
+#: lazarusidestrconsts:lisa2pinvalidfile
+msgid "Invalid file"
+msgstr "File tidak benar"
+
+#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas
+msgid "A pascal unit must have the extension .pp or .pas"
+msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"
+
+#: lazarusidestrconsts:lisa2pinvalidancestortype
+msgid "Invalid Ancestor Type"
+msgstr "Tipe Karuhun tidak benar"
+
+#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
+msgid "The ancestor type %s%s%s is not a valid pascal identifier."
+msgstr "Tipe karuhun %s%s%s bukan pengenal pascal yang benar."
+
+#: lazarusidestrconsts:lisa2ppagenametoolong
+msgid "Page Name too long"
+msgstr "Nama Halaman terlalu panjang"
+
+#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
+msgid "The page name %s%s%s is too long (max 100 chars)."
+msgstr "Nama halaman %s%s%s terlalu panjang (maks 100 karakter)."
+
+#: lazarusidestrconsts:lisa2punitnameinvalid
+msgid "Unit Name Invalid"
+msgstr "Nama Unit tidak benar"
+
+#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
+msgid "The unit name %s%s%s does not correspond to the filename."
+msgstr "Nama unit %s%s%s tidak terkait ke nama file."
+
+#: lazarusidestrconsts:lisa2pinvalidclassname
+msgid "Invalid Class Name"
+msgstr "Nama Class tidak benar"
+
+#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
+msgid "The class name %s%s%s is not a valid pascal identifier."
+msgstr "Nama class %s%s%s bukan pengenal pascal yang benar."
+
+#: lazarusidestrconsts:lisa2pinvalidcircle
+msgid "Invalid Circle"
+msgstr "Lingkaran tidak benar"
+
+#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
+msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
+msgstr "Nama class %s%s%s dan tipe karuhun %s%s%s sama."
+
+#: lazarusidestrconsts:lisa2pambiguousancestortype
+msgid "Ambiguous Ancestor Type"
+msgstr "Tipe Karuhun Dwimakna"
+
+#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
+msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
+msgstr "Tipe karuhun %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
+
+#: lazarusidestrconsts:lisa2pambiguousclassname
+msgid "Ambiguous Class Name"
+msgstr "Nama Class Dwimakna"
+
+#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
+msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
+msgstr "Nama class %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
+
+#: lazarusidestrconsts:lisa2pclassnamealreadyexists
+msgid "Class Name already exists"
+msgstr "Nama Class sudah ada"
+
+#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
+msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
+msgstr "Nama class %s%s%s sudah ada dalam%sPaket %s%s%sFile: %s%s%s"
+
+#: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
+msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr "Versi Minimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
+
+#: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
+msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr "Versi Maksimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
+
+#: lazarusidestrconsts:lisa2paddunit
+msgid "Add Unit"
+msgstr "Tambah Unit"
+
+#: lazarusidestrconsts:lisa2pnewfile
+msgid "New File"
+msgstr "File Baru"
+
+#: lazarusidestrconsts:lisa2pnewcomponent
+msgid "New Component"
+msgstr "Komponen Baru"
+
+#: lazarusidestrconsts:lisa2paddfile
+msgid "Add File"
+msgstr "Tambah File"
+
+#: lazarusidestrconsts:lisa2paddfiles
+msgid "Add Files"
+msgstr "Tambah File"
+
+#: lazarusidestrconsts:lisa2punitfilename
+msgid "Unit file name:"
+msgstr "Nama file unit:"
+
+#: lazarusidestrconsts:lisa2pchooseanexistingfile
+msgid "<choose an existing file>"
+msgstr "<pilih file yang sudah ada>"
+
+#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
+msgid "Add LFM, LRS files, if they exist"
+msgstr "Tambah file LFM, LRS, jika ada"
+
+#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
+msgid "Scan Unit for Unit Name and Register procedure"
+msgstr "Pindai Unit untuk Nama Unit dan prosedur Register"
+
+#: lazarusidestrconsts:lisa2pancestortype
+msgid "Ancestor Type"
+msgstr "Tipe Karuhun"
+
+#: lazarusidestrconsts:lisa2pshowall
+msgid "Show all"
+msgstr "Tampilkan semua"
+
+#: lazarusidestrconsts:lisa2pnewclassname
+msgid "New class name:"
+msgstr "Nama class baru:"
+
+#: lazarusidestrconsts:lisa2ppalettepage
+msgid "Palette Page:"
+msgstr "Halaman Palet:"
+
+#: lazarusidestrconsts:lisa2punitfilename2
+msgid "Unit File Name:"
+msgstr "Nama File Unit:"
+
+#: lazarusidestrconsts:lisa2punitname
+msgid "Unit Name:"
+msgstr "Nama Unit:"
+
+#: lazarusidestrconsts:lisa2pshortenorexpandfilename
+msgid "Shorten or expand filename"
+msgstr "Nama file pendek atau panjang"
+
+#: lazarusidestrconsts:lisa2psavefiledialog
+msgid "Save file dialog"
+msgstr "Simpan dialog file"
+
+#: lazarusidestrconsts:lisa2pfilename
+msgid "File name:"
+msgstr "Nama file:"
+
+#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
+msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
+msgstr "Pengubahan nama paket atau versi memisahkan dependensi. Apakah dependensi ini diubah juga?%sPilih Ya untuk mengubah semua dependensi terdaftar.%sPilih Abaikan untuk memisahkan dependensi dan melanjutkan."
+
+#: lazarusidestrconsts:lisa2pdependency
+msgid "Dependency"
+msgstr "Dependensi"
+
+#: lazarusidestrconsts:lisa2pbrokendependencies
+msgid "Broken Dependencies"
+msgstr "Dependensi Rusak"
+
+#: lazarusidestrconsts:lisoipfilename
+msgid "Filename:  %s"
+msgstr "Nama file: %s"
+
+#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
+msgid "%sThis package was automatically created"
+msgstr "%sPaket ini otomatis dibuat"
+
+#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
+msgid "%sThis package is installed, but the lpk file was not found"
+msgstr "%sPaket ini diinstalasi, tetapi file lpk tidak ditemukan"
+
+#: lazarusidestrconsts:lisoipdescriptiondescription
+msgid "%sDescription:  %s"
+msgstr "%sDeskripsi:  %s"
+
+#: lazarusidestrconsts:lisoipdescription
+msgid "Description:  "
+msgstr "Deskripsi:  "
+
+#: lazarusidestrconsts:lisoippleaseselectapackage
+msgid "Please select a package"
+msgstr "Silahkan pilih paket"
+
+#: lazarusidestrconsts:lisoipnopackageselected
+msgid "No package selected"
+msgstr "Tidak ada paket yang dipilih"
+
+#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
+msgid "Please select a package to open"
+msgstr "Silahkan pilih paket yang dibuka"
+
+#: lazarusidestrconsts:lisoippackagename
+msgid "Package Name"
+msgstr "Nama Paket"
+
+#: lazarusidestrconsts:lisoipstate
+msgid "State"
+msgstr "Kondisi"
+
+#: lazarusidestrconsts:lisoipmodified
+msgid "modified"
+msgstr "diubah"
+
+#: lazarusidestrconsts:lisoipmissing
+msgid "missing"
+msgstr "tidak ada"
+
+#: lazarusidestrconsts:lisoipinstalledstatic
+msgid "installed static"
+msgstr "diinstalasi statis"
+
+#: lazarusidestrconsts:lisoipinstalleddynamic
+msgid "installed dynamic"
+msgstr "diinstalasi dinamis"
+
+#: lazarusidestrconsts:lisoipautoinstallstatic
+msgid "auto install static"
+msgstr "otomatis menginstalasi statis"
+
+#: lazarusidestrconsts:lisoipautoinstalldynamic
+msgid "auto install dynamic"
+msgstr "otomatis menginstalasi dinamis"
+
+#: lazarusidestrconsts:lisoipreadonly
+msgid "readonly"
+msgstr "hanya baca"
+
+#: lazarusidestrconsts:lisoipopenloadedpackage
+msgid "Open loaded package"
+msgstr "Buka paket yang diambil"
+
+#: lazarusidestrconsts:lispckeditremovefile
+msgid "Remove file"
+msgstr "Hapus file"
+
+#: lazarusidestrconsts:lispckeditreaddfile
+msgid "Re-Add file"
+msgstr "Tambah-Ulang file"
+
+#: lazarusidestrconsts:lispckeditremovedependency
+msgid "Remove dependency"
+msgstr "Hapus dependensi"
+
+#: lazarusidestrconsts:lispckeditmovedependencyup
+msgid "Move dependency up"
+msgstr "Naikkan dependensi"
+
+#: lazarusidestrconsts:lispckeditmovedependencydown
+msgid "Move dependency down"
+msgstr "Turunkan dependensi"
+
+#: lazarusidestrconsts:lispckeditreadddependency
+msgid "Re-Add dependency"
+msgstr "Tambah-Ulang dependensi"
+
+#: lazarusidestrconsts:lispckeditcompile
+msgid "Compile"
+msgstr "Kompilasi"
+
+#: lazarusidestrconsts:lispckeditrecompileclean
+msgid "Recompile clean"
+msgstr "Kompilasi ulang bersih"
+
+#: lazarusidestrconsts:lispckeditrecompileallrequired
+msgid "Recompile all required"
+msgstr "Kompilasi ulang semua yang dibutuhkan"
+
+#: lazarusidestrconsts:lispckeditcreatemakefile
+msgid "Create Makefile"
+msgstr "Buat Makefile"
+
+#: lazarusidestrconsts:lispckeditaddtoproject
+msgid "Add to project"
+msgstr "Tambah ke proyek"
+
+#: lazarusidestrconsts:lispckeditinstall
+msgid "Install"
+msgstr "Instalasi"
+
+#: lazarusidestrconsts:lispckedituninstall
+msgid "Uninstall"
+msgstr "Uninstalasi"
+
+#: lazarusidestrconsts:lispckeditviewpackgesource
+msgid "View Package Source"
+msgstr "Lihat Sumber Paket"
+
+#: lazarusidestrconsts:lispckeditgeneraloptions
+msgid "General Options"
+msgstr "Opsi Umum"
+
+#: lazarusidestrconsts:lispckeditsavechanges
+msgid "Save Changes?"
+msgstr "Simpan Perubahan?"
+
+#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
+msgid "Package %s%s%s has changed.%sSave package?"
+msgstr "Paket %s%s%s sudah diubah.%sSimpan paket?"
+
+#: lazarusidestrconsts:lispckeditpage
+msgid "%s, Page: %s"
+msgstr "%s, Halaman: %s"
+
+#: lazarusidestrconsts:lispckeditremovefile2
+msgid "Remove file?"
+msgstr "Hapus file?"
+
+#: lazarusidestrconsts:lispckeditremovefilefrompackage
+msgid "Remove file %s%s%s%sfrom package %s%s%s?"
+msgstr "Hapus file %s%s%s%sdari paket %s%s%s?"
+
+#: lazarusidestrconsts:lispckeditremovedependency2
+msgid "Remove Dependency?"
+msgstr "Hapus Dependensi?"
+
+#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
+msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
+msgstr "Hapus dependensi %s%s%s%sdari paket %s%s%s?"
+
+#: lazarusidestrconsts:lispckeditinvalidminimumversion
+msgid "Invalid minimum version"
+msgstr "Versi minimum tidak benar"
+
+#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
+msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
+msgstr "Versi minimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
+
+#: lazarusidestrconsts:lispckeditinvalidmaximumversion
+msgid "Invalid maximum version"
+msgstr "Versi maksimum tidak benar"
+
+#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
+msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
+msgstr "Versi maksimum  %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
+
+#: lazarusidestrconsts:lispckeditcompileeverything
+msgid "Compile everything?"
+msgstr "Kompilasi semuanya?"
+
+#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
+msgid "Re-Compile this and all required packages?"
+msgstr "Rekompilasi ini dan semua paket yang dibutuhkan?"
+
+#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
+msgid "Compiler Options for Package %s"
+msgstr "Opsi Kompilator untuk Paket %s"
+
+#: lazarusidestrconsts:lispckeditsavepackage
+msgid "Save package"
+msgstr "Simpan paket"
+
+#: lazarusidestrconsts:lispckeditcompilepackage
+msgid "Compile package"
+msgstr "Kompilasi paket"
+
+#: lazarusidestrconsts:lispckeditaddanitem
+msgid "Add an item"
+msgstr "Tambah item"
+
+#: lazarusidestrconsts:lispckeditremoveselecteditem
+msgid "Remove selected item"
+msgstr "Hapus item yang dipilih"
+
+#: lazarusidestrconsts:lispckeditinstallpackageintheide
+msgid "Install package in the IDE"
+msgstr "Instalasi paket dalam IDE"
+
+#: lazarusidestrconsts:lispckediteditgeneraloptions
+msgid "Edit General Options"
+msgstr "Edit Opsi Umum"
+
+#: lazarusidestrconsts:lispckeditcompopts
+msgid "Compiler Options"
+msgstr "Opsi Kompilator"
+
+#: lazarusidestrconsts:lispckedithelp
+msgid "Help"
+msgstr "Panduan"
+
+#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
+msgid "There are more functions in the popupmenu"
+msgstr "Ada fungsi lebih banyak dalam menu popup"
+
+#: lazarusidestrconsts:lispckeditmore
+msgid "More ..."
+msgstr "Selengkapnya ..."
+
+#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
+msgid "Edit Options to compile package"
+msgstr "Opsi edit untuk kompilasi paket"
+
+#: lazarusidestrconsts:lispckeditrequiredpackages
+msgid "Required Packages"
+msgstr "Paket yang Dibutuhkan"
+
+#: lazarusidestrconsts:lispckeditfileproperties
+msgid "File Properties"
+msgstr "Properti File"
+
+#: lazarusidestrconsts:lispckeditregisterunit
+msgid "Register unit"
+msgstr "Register unit"
+
+#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
+msgid "Call %sRegister%s procedure of selected unit"
+msgstr "Panggil %sRegister%s procedure dari unit yang dipilih"
+
+#: lazarusidestrconsts:lispckeditregisteredplugins
+msgid "Registered plugins"
+msgstr "Plugins terdaftar"
+
+#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
+msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
+msgstr "Tambah unit ke klausul uses dari paket. Matikan ini hanya untuk unit yang seharusnya tidak dikompilasi dalam semua kasus."
+
+#: lazarusidestrconsts:lispkgmanguseunit
+msgid "Use unit"
+msgstr "Gunakan unit"
+
+#: lazarusidestrconsts:lispckeditminimumversion
+msgid "Minimum Version:"
+msgstr "Versi Minimum:"
+
+#: lazarusidestrconsts:lispckeditmaximumversion
+msgid "Maximum Version:"
+msgstr "Versi Maksimum:"
+
+#: lazarusidestrconsts:lispckeditapplychanges
+msgid "Apply changes"
+msgstr "Terapkan perubahan"
+
+#: lazarusidestrconsts:lispckeditpackage
+msgid "Package %s"
+msgstr "Paket %s"
+
+#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
+msgid "Removed Files (these entries are not saved to the lpk file)"
+msgstr "Hapus File (entri ini tidak disimpan ke file lpk)"
+
+#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
+msgid "Removed required packages (these entries are not saved to the lpk file)"
+msgstr "Hapus paket yang diperlukan (entri ini tidak disimpan ke file lpk)"
+
+#: lazarusidestrconsts:lispckeditdependencyproperties
+msgid "Dependency Properties"
+msgstr "Properti Dependensi"
+
+#: lazarusidestrconsts:lispckeditpackagenotsaved
+msgid "package %s not saved"
+msgstr "paket %s tidak dismpan"
+
+#: lazarusidestrconsts:lispckeditreadonly
+msgid "Read Only: %s"
+msgstr "Hanya Baca: %s"
+
+#: lazarusidestrconsts:lispckeditmodified
+msgid "Modified: %s"
+msgstr "Diubah: %s"
+
+#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
+msgid "New unit not in unitpath"
+msgstr "Unit baru tidak dalam unitpath"
+
+#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
+msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
+msgstr "File %s%s%s%ssaat ini tidak dalam unitpath dari paket.%s%sTambah %s%s%s ke UnitPath?"
+
+#: lazarusidestrconsts:lispkgeditrevertpackage
+msgid "Revert package?"
+msgstr "Kembalikan paket?"
+
+#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
+msgid "Do you really want to forget all changes to package %s and reload it from file?"
+msgstr "Anda benar-benar ingin melupakan semua perubahan terhadap paket %s dan mengambil ulang dari file?"
+
+#: lazarusidestrconsts:lispckoptsusage
+msgid "Usage"
+msgstr "Penggunaan"
+
+#: lazarusidestrconsts:lispckoptsideintegration
+msgid "IDE Integration"
+msgstr "Integrasi IDE"
+
+#: lazarusidestrconsts:lispckoptsdescriptionabstract
+msgid "Description/Abstract"
+msgstr "Deskripsi/Abstrak"
+
+#: lazarusidestrconsts:lispckoptsauthor
+msgid "Author:"
+msgstr "Pembuat:"
+
+#: lazarusidestrconsts:lispckoptslicense
+msgid "License:"
+msgstr "Lisensi:"
+
+#: lazarusidestrconsts:lispckoptsmajor
+msgid "Major"
+msgstr "Mayor"
+
+#: lazarusidestrconsts:lispckoptsminor
+msgid "Minor"
+msgstr "Minor"
+
+#: lazarusidestrconsts:lispckoptsrelease
+msgid "Release"
+msgstr "Rilis"
+
+#: lazarusidestrconsts:lisbuildnumber
+msgid "Build Number"
+msgstr "Angka Buatan"
+
+#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
+msgid "Automatically increment version on build"
+msgstr "Otomatis menaikan versi pada buatan"
+
+#: lazarusidestrconsts:lispckoptspackagetype
+msgid "PackageType"
+msgstr "TipePaket"
+
+#: lazarusidestrconsts:lispckoptsdesigntimeonly
+msgid "Designtime only"
+msgstr "Hanya waktu desain"
+
+#: lazarusidestrconsts:lispckoptsruntimeonly
+msgid "Runtime only"
+msgstr "Hanya Runtime"
+
+#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
+msgid "Designtime and Runtime"
+msgstr "Waktu desain dan Runtime"
+
+#: lazarusidestrconsts:lispckoptsupdaterebuild
+msgid "Update/Rebuild"
+msgstr "Pemutakhiran/Bangun ulang"
+
+#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
+msgid "Automatically rebuild as needed"
+msgstr "Otomatis membangun ulang jika diperlukan"
+
+#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
+msgid "Auto rebuild when rebuilding all"
+msgstr "Otomatis membangun ulang ketika pembangunan ulang semua"
+
+#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
+msgid "Manual compilation (never automatically)"
+msgstr "Kompilasi manual (tidak secara otomatis)"
+
+#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
+msgid "Add paths to dependent packages/projects"
+msgstr "Tambah path ke paket dependen/proyek"
+
+#: lazarusidestrconsts:lispckoptsinclude
+msgid "Include"
+msgstr "Include"
+
+#: lazarusidestrconsts:lispckoptsobject
+msgid "Object"
+msgstr "Objek"
+
+#: lazarusidestrconsts:lispckoptslibrary
+msgid "Library"
+msgstr "Librari"
+
+#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
+msgid "Add options to dependent packages and projects"
+msgstr "Tambah opsi untuk paket dependen dan proyek"
+
+#: lazarusidestrconsts:lispckoptslinker
+msgid "Linker"
+msgstr "Linker"
+
+#: lazarusidestrconsts:lispckoptscustom
+msgid "Custom"
+msgstr "Kustom"
+
+#: lazarusidestrconsts:lispckoptsinvalidpackagetype
+msgid "Invalid package type"
+msgstr "Tipe paket tidak benar"
+
+#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
+msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
+msgstr "Paket %s%s%s mempunyai tanda otomatis instalasi.%sIni berarti akan diinstalasi dalam IDE. Paket instalasi%sharus Paket waktu desain."
+
+#: lazarusidestrconsts:lispckoptspackageoptions
+msgid "Package Options"
+msgstr "Opsi Paket"
+
+#: lazarusidestrconsts:lispckexplloadedpackages
+msgid "Loaded Packages:"
+msgstr "Paket yang Diambil:"
+
+#: lazarusidestrconsts:lispckexplisrequiredby
+msgid "Selected package is required by:"
+msgstr "Paket yang dipilih dibutuhkan oleh:"
+
+#: lazarusidestrconsts:lispckexplpackagenotfound
+msgid "Package %s not found"
+msgstr "Paket %s tidak ditemukan"
+
+#: lazarusidestrconsts:lispckexplstate
+msgid "%sState: "
+msgstr "%sKondisi: "
+
+#: lazarusidestrconsts:lispckexplautocreated
+msgid "AutoCreated"
+msgstr "AutoCreated"
+
+#: lazarusidestrconsts:lispckexplinstalled
+msgid "Installed"
+msgstr "Diinstalasi"
+
+#: lazarusidestrconsts:lispckexplinstallonnextstart
+msgid "Install on next start"
+msgstr "Instalasi saat mulai nanti"
+
+#: lazarusidestrconsts:lispckexpluninstallonnextstart
+msgid "Uninstall on next start"
+msgstr "Jangan instalasi saat mulai nanti"
+
+#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
+msgid "Confirm deleting dependency"
+msgstr "Konfirmasi penghapusan dependensi"
+
+#: lazarusidestrconsts:lisprojinspconfirmremovingfile
+msgid "Confirm removing file"
+msgstr "Konfirmasi penghapusan file"
+
+#: lazarusidestrconsts:lisprojinspdeletedependencyfor
+msgid "Delete dependency for %s?"
+msgstr "Hapus dependensi untuk %s?"
+
+#: lazarusidestrconsts:lisprojinspremovefilefromproject
+msgid "Remove file %s from project?"
+msgstr "Hapus file %s dari proyek?"
+
+#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
+msgid "Removed required packages"
+msgstr "Hapus paket yang diperlukan"
+
+#: lazarusidestrconsts:lisprojinspprojectinspector
+msgid "Project Inspector - %s"
+msgstr "Inspektor Proyek - %s"
+
+#: lazarusidestrconsts:lismenueditormenueditor
+msgid "Menu Editor"
+msgstr "Editor Menu"
+
+#: lazarusidestrconsts:lismenueditorselectmenu
+msgid "Select Menu:"
+msgstr "Pilih Menu:"
+
+#: lazarusidestrconsts:lismenueditorselecttemplate
+msgid "Select Template:"
+msgstr "Pilih Template:"
+
+#: lazarusidestrconsts:lismenueditortemplatepreview
+msgid "Template Preview"
+msgstr "Peninjauan Template"
+
+#: lazarusidestrconsts:lismenueditornewtemplatedescription
+msgid "New Template Description..."
+msgstr "Deskripsi Template Baru..."
+
+#: lazarusidestrconsts:lismenueditorcancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lazarusidestrconsts:lismenueditorinsertnewitemafter
+msgid "Insert New Item (after)"
+msgstr "Sisipkan Item baru (setelah)"
+
+#: lazarusidestrconsts:lismenueditorinsertnewitembefore
+msgid "Insert New Item (before)"
+msgstr "Sisipkan Item Baru (sebelum)"
+
+#: lazarusidestrconsts:lismenueditordeleteitem
+msgid "Delete Item"
+msgstr "Hapus Item"
+
+#: lazarusidestrconsts:lismenueditorcreatesubmenu
+msgid "Create Submenu"
+msgstr "Buat Submenu"
+
+#: lazarusidestrconsts:lismenueditorhandleonclickevent
+msgid "Handle OnClick Event"
+msgstr "Pegangan Event OnClick"
+
+#: lazarusidestrconsts:lismenueditormoveup
+msgid "Move Up (or left)"
+msgstr "Naik (atau kiri)"
+
+#: lazarusidestrconsts:lismenueditormovedown
+msgid "Move Down (or right)"
+msgstr "Turun (atau kanan)"
+
+#: lazarusidestrconsts:lismenueditorinsertfromtemplate
+msgid "Insert From Template..."
+msgstr "Sisipkan Dari Template..."
+
+#: lazarusidestrconsts:lismenueditorsaveastemplate
+msgid "Save As Template..."
+msgstr "Simpan Sebagai Template..."
+
+#: lazarusidestrconsts:lismenueditordeletefromtemplate
+msgid "Delete From Template..."
+msgstr "Hapus Dari Template..."
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
+msgid "Standard File Menu"
+msgstr "Menu File Standar"
+
+#: lazarusidestrconsts:lismenutemplatefile
+msgid "File"
+msgstr "File"
+
+#: lazarusidestrconsts:lismenutemplatenew
+msgid "New"
+msgstr "Baru"
+
+#: lazarusidestrconsts:lismenutemplateopen
+msgid "Open"
+msgstr "Buka"
+
+#: lazarusidestrconsts:lismenutemplateopenrecent
+msgid "Open Recent"
+msgstr "Buka yang Terbaru"
+
+#: lazarusidestrconsts:lismenutemplatesave
+msgid "Save"
+msgstr "Simpan"
+
+#: lazarusidestrconsts:lismenutemplatesaveas
+msgid "Save As"
+msgstr "Simpan Sebagai"
+
+#: lazarusidestrconsts:lismenutemplateclose
+msgid "Close"
+msgstr "Tutup"
+
+#: lazarusidestrconsts:lismenutemplateexit
+msgid "Exit"
+msgstr "Keluar"
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
+msgid "Standard Edit Menu"
+msgstr "Menu Edit Standar"
+
+#: lazarusidestrconsts:lismenutemplateedit
+msgid "Edit"
+msgstr "Edit"
+
+#: lazarusidestrconsts:lismenutemplateundo
+msgid "Undo"
+msgstr "Undo"
+
+#: lazarusidestrconsts:lismenutemplateredo
+msgid "Redo"
+msgstr "Redo"
+
+#: lazarusidestrconsts:lismenutemplatecut
+msgid "Cut"
+msgstr "Cut"
+
+#: lazarusidestrconsts:lismenutemplatecopy
+msgid "Copy"
+msgstr "Copy"
+
+#: lazarusidestrconsts:lismenutemplatepaste
+msgid "Paste"
+msgstr "Paste"
+
+#: lazarusidestrconsts:lismenutemplatefind
+msgid "Find"
+msgstr "Cari"
+
+#: lazarusidestrconsts:lismenutemplatefindnext
+msgid "Find Next"
+msgstr "Cari Berikutnya"
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
+msgid "Standard Help Menu"
+msgstr "Menu Panduan Standar"
+
+#: lazarusidestrconsts:lismenutemplatehelp
+msgid "Help"
+msgstr "Panduan"
+
+#: lazarusidestrconsts:lismenutemplatecontents
+msgid "Contents"
+msgstr "Isi"
+
+#: lazarusidestrconsts:lismenutemplatetutorial
+msgid "Tutorial"
+msgstr "Tutorial"
+
+#: lazarusidestrconsts:lismenutemplateabout
+msgid "About"
+msgstr "Tentang"
+
+#: lazarusidestrconsts:liscontributors
+msgid "Contributors"
+msgstr "Kontributor"
+
+#: lazarusidestrconsts:lischaractermap
+msgid "Character Map"
+msgstr "Peta Karakter"
+
+#: lazarusidestrconsts:lisctdefchoosedirectory
+msgid "Choose Directory"
+msgstr "Pilih Direktori"
+
+#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
+msgid "CodeTools Directory Values"
+msgstr "Nilai Direktori CodeTools"
+
+#: lazarusidestrconsts:lisctdefvariable
+msgid "Variable: %s"
+msgstr "Variabel: %s"
+
+#: lazarusidestrconsts:lisctdefnovariableselected
+msgid "<no variable selected>"
+msgstr "<tidak ada variabel dipilih>"
+
+#: lazarusidestrconsts:lisctdefvariablename
+msgid "Variable Name"
+msgstr "Nama Variabel"
+
+#: lazarusidestrconsts:liscldircleansubdirectories
+msgid "Clean sub directories"
+msgstr "Bersihkan sub direktori"
+
+#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
+msgid "Remove files matching filter"
+msgstr "Hapus file yang memenuhi filter"
+
+#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
+msgid "Simple Syntax (e.g. * instead of .*)"
+msgstr "Sintaks Sederhana (contoh. * instead of .*)"
+
+#: lazarusidestrconsts:liscldirkeepalltextfiles
+msgid "Keep all text files"
+msgstr "Biarkan semua file teks"
+
+#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
+msgid "Keep files matching filter"
+msgstr "Biarkan file yang memenuhi filter"
+
+#: lazarusidestrconsts:liscldircleandirectory
+msgid "Clean Directory"
+msgstr "Bersihkan Direktori"
+
+#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
+msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
+msgstr "File LFM (form Lazarus) berisi properti tidak benar. Ini berarti sebagai contoh berisi beberapa properti/kelas, yang tidak ada dalam LCL saat ini. Pembetulan normal adalah menghapus properti ini dari lfm dan membetulkan kode pascal secara manual."
+
+#: lazarusidestrconsts:lisfixlfmfile
+msgid "Fix LFM file"
+msgstr "Betulkan file LFM"
+
+#: lazarusidestrconsts:lisnocodeselected
+msgid "No code selected"
+msgstr "Tidak ada kode dipilih"
+
+#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
+msgid "Please select some code to extract a new procedure/method."
+msgstr "Silahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
+
+#: lazarusidestrconsts:lisinvalidselection
+msgid "Invalid selection"
+msgstr "Pilihan tidak benar"
+
+#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
+msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
+msgstr "Pernyataan ini tidak bisa diekstrak.%sSilahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
+
+#: lazarusidestrconsts:lisextractprocedure
+msgid "Extract Procedure"
+msgstr "Ekstrak Procedure"
+
+#: lazarusidestrconsts:lisnameofnewprocedure
+msgid "Name of new procedure"
+msgstr "Nama dari procedure baru"
+
+#: lazarusidestrconsts:lisextract
+msgid "Extract"
+msgstr "Ekstrak"
+
+#: lazarusidestrconsts:lisinvalidprocname
+msgid "Invalid proc name"
+msgstr "nama proc tidak benar"
+
+#: lazarusidestrconsts:lispublicmethod
+msgid "Public Method"
+msgstr "Metode Public"
+
+#: lazarusidestrconsts:lisprivatemethod
+msgid "Private Method"
+msgstr "Metode Private"
+
+#: lazarusidestrconsts:lisprotectedmethod
+msgid "Protected Method"
+msgstr "Metode Protected"
+
+#: lazarusidestrconsts:lispublishedmethod
+msgid "Published Method"
+msgstr "Metode Published"
+
+#: lazarusidestrconsts:lisprocedure
+msgid "Procedure"
+msgstr "Procedure"
+
+#: lazarusidestrconsts:lisprocedurewithinterface
+msgid "Procedure with interface"
+msgstr "Proseduir dengan interface"
+
+#: lazarusidestrconsts:lissubprocedure
+msgid "Sub Procedure"
+msgstr "Sub Prosedur"
+
+#: lazarusidestrconsts:lissubprocedureonsamelevel
+msgid "Sub Procedure on same level"
+msgstr "Sub Prosedur pada tingkat yang sama"
+
+#: lazarusidestrconsts:lisfreepascalcompilernotfound
+msgid "Free Pascal Compiler not found"
+msgstr "Kompilator Free Pascal tidak ditemukan"
+
+#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
+msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
+msgstr "Kompilator Free Pascal (nama file: %s) tidak ditemukan. %sDirekomendasikan anda menginstalasi fpc."
+
+#: lazarusidestrconsts:lisinvalidcompilerfilename
+msgid "Invalid Compiler Filename"
+msgstr "Nama file Kompilator tidak benar"
+
+#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz
+msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files"
+msgstr "Nama file kompilator saat ini %s%s%s%sbukan eksekutable yang benar.%sSilahkan periksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:lisfreepascalsourcesnotfound
+msgid "Free Pascal Sources not found"
+msgstr "Sumber Free Pascal tidak ditemukan"
+
+#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
+msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
+msgstr "Direktori sumber Free Pascal tidak ditemukan.%sBeberapa fungsi kode tidak akan bekerja.%sDirekomendasikan anda menginstalasinya dan men-set path%sLingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
+msgid "Invalid Free Pascal source directory"
+msgstr "Direktori sumber Free Pascal tidak benar"
+
+#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
+msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
+msgstr "Direktori sumber Free Pascal saat ini %s%s%s%stidak benar.%sPeriksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:lislazarusdirectorynotfound
+msgid "Lazarus directory not found"
+msgstr "Direktori Lazarus tidak ditemukan"
+
+#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
+msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
+msgstr "Direktori Lazarus saat ini %s%s%s%stidak benar.%sTanpa itu Anda tidak akan bisa membuat aplikasi LCL.%sPeriksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
+msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr "Direktori Lazarus saat ini  %s%s%s%stidak benar.%sTanpa itu Anda tidak akan bisa membuat aplikasi LCL.%sPilih Ok untuk memilih default %s%s%s.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
+msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files"
+msgstr "Direktori Lazarus tidak ditemukan.%sAnda tidak akan bisa membuat aplikasi LCL.%sSilahkan periksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
+msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr "Direktori sumber Free Pascal saat ini %s%s%stidak benar.%sPilih Ok untuk memilih default %s%s%s.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
+msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr "Nama file kompilator saat ini %s%s%sbukan eksekutabel yang benar.%sPilih Ok untuk memilih %s%s%s default.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"
+
+#: lazarusidestrconsts:lishlpoptshelpoptions
+msgid "Help Options"
+msgstr "Opsi Panduan"
+
+#: lazarusidestrconsts:lishlpoptsviewers
+msgid "Viewers"
+msgstr "Peninjauan"
+
+#: lazarusidestrconsts:lishlpoptsproperties
+msgid "Properties:"
+msgstr "Properti:"
+
+#: lazarusidestrconsts:lishlpoptsdatabases
+msgid "Databases"
+msgstr "Database"
+
+#: lazarusidestrconsts:lisencloseselection
+msgid "Enclose Selection"
+msgstr "Sertakan Pilihan"
+
+#: lazarusidestrconsts:lisenclose
+msgid "Enclose"
+msgstr "Sertakan"
+
+#: lazarusidestrconsts:lischoosestructuretoencloseselection
+msgid "Choose structure to enclose selection"
+msgstr "Pilih struktur untuk menyertakan pilihan"
+
+#: lazarusidestrconsts:liserrors
+msgid "Errors"
+msgstr "Salah"
+
+#: lazarusidestrconsts:lislfmfile
+msgid "LFM file"
+msgstr "File LFM"
+
+#: lazarusidestrconsts:lisremoveallinvalidproperties
+msgid "Remove all invalid properties"
+msgstr "Hapus semua properti yang tidak benar"
+
+#: lazarusidestrconsts:liscomptest
+msgid "Test"
+msgstr "Uji"
+
+#: lazarusidestrconsts:lisa2pswitchpaths
+msgid "Switch Paths"
+msgstr "Tukar Path"
+
+#: lazarusidestrconsts:lisa2paddfilestopackage
+msgid "Add files to package"
+msgstr "Tambah file ke paket"
+
+#: lazarusidestrconsts:lisa2paddtopackage
+msgid "Add to package"
+msgstr "Tambah file ke paket"
+
+#: lazarusidestrconsts:lisa2pfilename2
+msgid "Filename"
+msgstr "Nama file"
+
+#: lazarusidestrconsts:lisfrifindorrenameidentifier
+msgid "Find or Rename Identifier"
+msgstr "Cari atau Ganti nama Pengenal"
+
+#: lazarusidestrconsts:lishelpselectordialog
+msgid "Help selector"
+msgstr "Selektor Panduan"
+
+#: lazarusidestrconsts:lisselectahelpitem
+msgid "Select a help item:"
+msgstr "Pilih item panduan:"
+
+#: lazarusidestrconsts:liserrormovingcomponent
+msgid "Error moving component"
+msgstr "Kesalahan pemindahan komponen"
+
+#: lazarusidestrconsts:liserrormovingcomponent2
+msgid "Error moving component %s:%s"
+msgstr "Kesalahan pemindahan komponen %s:%s"
+
+#: lazarusidestrconsts:lisinstalledpackages
+msgid "Installed Packages"
+msgstr "Paket Terinstalasi"
+
+#: lazarusidestrconsts:lisavailablepackages
+msgid "Available packages"
+msgstr "Paket Tersedia"
+
+#: lazarusidestrconsts:lisexportlist
+msgid "Export list"
+msgstr "Daftar ekspor"
+
+#: lazarusidestrconsts:lisimportlist
+msgid "Import list"
+msgstr "Daftar impor"
+
+#: lazarusidestrconsts:lisuninstallselection
+msgid "Uninstall selection"
+msgstr "Deinstalasi pilihan"
+
+#: lazarusidestrconsts:lispackagestoinstallintheide
+msgid "Packages to install in the IDE"
+msgstr "Paket yang diinstalasi dalam IDE"
+
+#: lazarusidestrconsts:lisinstallselection
+msgid "Install selection"
+msgstr "Pilihan Instalasi"
+
+#: lazarusidestrconsts:lispackageinfo
+msgid "Package Info"
+msgstr "Info Paket"
+
+#: lazarusidestrconsts:lissaveandrebuildide
+msgid "Save and rebuild IDE"
+msgstr "Simpan dan bangun ulang IDE"
+
+#: lazarusidestrconsts:lissaveandexitdialog
+msgid "Save and exit dialog"
+msgstr "Dialog Simpan dan keluar"
+
+#: lazarusidestrconsts:lisalignment
+msgid "Alignment"
+msgstr "Penjajaran"
+
+#: lazarusidestrconsts:lishorizontal
+msgid "Horizontal"
+msgstr "Horisontal"
+
+#: lazarusidestrconsts:lisnochange
+msgid "No change"
+msgstr "Tidak ada perubahan"
+
+#: lazarusidestrconsts:listops
+msgid "Tops"
+msgstr "Atas"
+
+#: lazarusidestrconsts:lisleftsides
+msgid "Left sides"
+msgstr "Sisi Kiri"
+
+#: lazarusidestrconsts:liscenters
+msgid "Centers"
+msgstr "Tengah"
+
+#: lazarusidestrconsts:lisbottoms
+msgid "Bottoms"
+msgstr "Bawah"
+
+#: lazarusidestrconsts:lisrightsides
+msgid "Right sides"
+msgstr "Sisi Kanan"
+
+#: lazarusidestrconsts:liscenterinwindow
+msgid "Center in window"
+msgstr "Tengah dalam jendela"
+
+#: lazarusidestrconsts:lisspaceequally
+msgid "Space equally"
+msgstr "Spasi secara sama"
+
+#: lazarusidestrconsts:listopspaceequally
+msgid "Top space equally"
+msgstr "Spasi Atas secara sama"
+
+#: lazarusidestrconsts:lisbottomspaceequally
+msgid "Bottom space equally"
+msgstr "Bawah spasi secara sama"
+
+#: lazarusidestrconsts:lisleftspaceequally
+msgid "Left space equally"
+msgstr "Kiri spasi secara sama"
+
+#: lazarusidestrconsts:lisrightspaceequally
+msgid "Right space equally"
+msgstr "Kanan spasi secara sama"
+
+#: lazarusidestrconsts:lisvertical
+msgid "Vertical"
+msgstr "Vertikal"
+
+#: lazarusidestrconsts:lisscalingfactor
+msgid "Scaling factor:"
+msgstr "Faktor Skala:"
+
+#: lazarusidestrconsts:liscustomprogram
+msgid "Custom Program"
+msgstr "Program Kustom"
+
+#: lazarusidestrconsts:lisprogram
+msgid "Program"
+msgstr "Program"
+
+#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
+msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
+msgstr "Program%sProgram freepascal. File program otomatis dipelihara oleh lazarus."
+
+#: lazarusidestrconsts:liscustomprogramafreepascalprogram
+msgid "Custom Program%sA freepascal program."
+msgstr "Program Kustom%sProgram freepascal"
+
+#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
+msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
+msgstr "Librari%sLibrari freepascal (.dll pada windows, .so pada linux, .dylib pada macosx). File sumber librari otomatis dipelihara oleh Lazarus."
+
+#: lazarusidestrconsts:lisnpselectaprojecttype
+msgid "Select a project type"
+msgstr "Pilih tipe proyek"
+
+#: lazarusidestrconsts:lisnpcreateanewproject
+msgid "Create a new project"
+msgstr "Buat proyek baru"
+
+#: lazarusidestrconsts:lisnpcreate
+msgid "Create"
+msgstr "Buat"
+
+#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
+msgid "Choose a base class for the favourite property %s%s%s."
+msgstr "Pilih dasar kelas untuk properti favorit %s%s%s."
+
+#: lazarusidestrconsts:lisoifaddtofavouriteproperties
+msgid "Add to favourite properties"
+msgstr "Tambah properti favorit"
+
+#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
+msgid "Remove from favourite properties"
+msgstr "Hapus dari properti favorit"
+
+#: lazarusidestrconsts:lisreplacingselectionfailed
+msgid "Replacing selection failed."
+msgstr "Penggantian yang dipilih gagal."
+
+#: lazarusidestrconsts:lisunabletofindinlfmstream
+msgid "Unable to find %s in LFM Stream."
+msgstr "Tidak bisa menemukan %s dalam LFM Stream."
+
+#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
+msgid "Error parsing lfm component stream."
+msgstr "Pemindaian aliran komponen lfm salah."
+
+#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
+msgid "Unable to create temporary lfm buffer."
+msgstr "Tidak bisa membuat bufer lfm sementara."
+
+#: lazarusidestrconsts:lisunabletogetsourcefordesigner
+msgid "Unable to get source for designer."
+msgstr "Tidak bisa mendapatkan sumber untuk desainer."
+
+#: lazarusidestrconsts:lisunabletogathereditorchanges
+msgid "Unable to gather editor changes."
+msgstr "Tidak bisa mengumpulkan perubahan editor."
+
+#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
+msgid "Unable to stream selected components."
+msgstr "Tidak bisa mengalirkan komponen yang dipilih."
+
+#: lazarusidestrconsts:lisunabletochangeclassofto
+msgid "%s%sUnable to change class of %s to %s"
+msgstr "%s%sTidak bisa mengubah kelas dari %s ke %s"
+
+#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
+msgid "Can only change the class of TComponents."
+msgstr "Hanya bisa mengubah kelas dari TComponents."
+
+#: lazarusidestrconsts:lisoldclass
+msgid "Old Class"
+msgstr "Kelas Lama"
+
+#: lazarusidestrconsts:lisnewclass
+msgid "New Class"
+msgstr "Kelas Baru"
+
+#: lazarusidestrconsts:lisoldancestors
+msgid "Old Ancestors"
+msgstr "Karuhun Lama"
+
+#: lazarusidestrconsts:lisnewancestors
+msgid "New Ancestors"
+msgstr "Karuhun Baru"
+
+#: lazarusidestrconsts:lisceocodeexplorer
+msgid "CodeExplorer Options"
+msgstr "Opsi CodeExplorer"
+
+#: lazarusidestrconsts:lisceoupdate
+msgid "Update"
+msgstr "Mutahirkan"
+
+#: lazarusidestrconsts:lisceorefreshautomatically
+msgid "Refresh automatically"
+msgstr "Segarkan secara otomatis"
+
+#: lazarusidestrconsts:lisceoneveronlymanually
+msgid "Never, only manually"
+msgstr "Tidak pernah, hanya secara manual"
+
+#: lazarusidestrconsts:lisceowhenswitchingfile
+msgid "When switching file in source editor"
+msgstr "Saat menukar file dalam editor sumber"
+
+#: lazarusidestrconsts:lisceoonidle
+msgid "On idle"
+msgstr "Saat menganggur"
+
+#: lazarusidestrconsts:liscefollowcursor
+msgid "Follow cursor"
+msgstr "Mengikuti kursor"
+
+#: lazarusidestrconsts:lismenulazdoc
+msgid "LazDoc Editor"
+msgstr "Editor LazDoc"
+
+#: lazarusidestrconsts:lislazdocmainformcaption
+msgid "LazDoc editor"
+msgstr "Editor LazDoc"
+
+#: lazarusidestrconsts:lislazdocnotagcaption
+msgid "<NONE>"
+msgstr "<TIDAK ADA>"
+
+#: lazarusidestrconsts:lislazdocnodocumentation
+msgid "Documentation entry does not exist"
+msgstr "Entri dokumentasi tidak ada"
+
+#: lazarusidestrconsts:lislazdocshorttag
+msgid "Short"
+msgstr "Pendek"
+
+#: lazarusidestrconsts:lislazdocdescrtag
+msgid "Description"
+msgstr "Deskripsi"
+
+#: lazarusidestrconsts:lislazdocerrorstag
+msgid "Errors"
+msgstr "Kesalahan"
+
+#: lazarusidestrconsts:lislazdocseealsotag
+msgid "See also"
+msgstr "Lihat juga"
+
+#: lazarusidestrconsts:lislazdocaddpathbutton
+msgid "Add path"
+msgstr "Tambah path"
+
+#: lazarusidestrconsts:lislazdocdeletepathbutton
+msgid "Remove path"
+msgstr "Hapus path"
+
+#: lazarusidestrconsts:lislazdocpathsgroupbox
+msgid "LazDoc settings"
+msgstr "Seting LazDoc"
+
+#: lazarusidestrconsts:lislazdochintboldformat
+msgid "Insert bold formatting tag"
+msgstr "Sisipkan tag format tebal"
+
+#: lazarusidestrconsts:lislazdochintitalicformat
+msgid "Insert italic formatting tag"
+msgstr "Sisipkan tag format miring"
+
+#: lazarusidestrconsts:lislazdochintunderlineformat
+msgid "Insert underline formatting tag"
+msgstr "Sisipkan tag format garis bawah"
+
+#: lazarusidestrconsts:lislazdochintinsertcodetag
+msgid "Insert code formatting tag"
+msgstr "Sisipkan tag format kode"
+
+#: lazarusidestrconsts:lislazdochintremarktag
+msgid "Insert remark formatting tag"
+msgstr "Sisipkan tag format catatan"
+
+#: lazarusidestrconsts:lislazdochintvartag
+msgid "Insert var formatting tag"
+msgstr "Sisipkan tag format var"
+
+#: lazarusidestrconsts:lislazdocaddlinkbutton
+msgid "Add link"
+msgstr "Tambah link"
+
+#: lazarusidestrconsts:lislazdocdeletelinkbutton
+msgid "Delete link"
+msgstr "Hapus link"
+
+#: lazarusidestrconsts:lislazdocexampletag
+msgid "Example"
+msgstr "Contoh"
+
+#: lazarusidestrconsts:lislazdocbrowseexamplebutton
+msgid "Browse"
+msgstr "Browse"
+
+#: lazarusidestrconsts:lisenablemakros
+msgid "Enable Makros"
+msgstr "Hidupkan Makro"
+
+#: lazarusidestrconsts:lisctselectcodemacro
+msgid "Select Code Macro"
+msgstr "Pilih Makro Kode"
+
+#: lazarusidestrconsts:lispdprogress
+msgid "Progress"
+msgstr "Progres"
+
+#: lazarusidestrconsts:lispdabort
+msgid "Abort"
+msgstr "Batalkan"
+
+#: lazarusidestrconsts:lisposaveinlpifil
+msgid "Save in .lpi file"
+msgstr "Simpan dalam file .lpi"
+
+#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
+msgid "Save in .lps file in project directory"
+msgstr "Simpan dalam file .lps dalam direktori proyek"
+
+#: lazarusidestrconsts:lisposaveinideconfigdirectory
+msgid "Save in IDE config directory"
+msgstr "Simpan dalam direktori konfigurasi IDE"
+
+#: lazarusidestrconsts:lispodonotsaveanysessioninfo
+msgid "Do not save any session info"
+msgstr "Jangan simpan info sesi apapun"
+
+#: lazarusidestrconsts:lisposavesessioninformationin
+msgid "Save session information in"
+msgstr "Simpan informasi sesi dalam"
+
+#: lazarusidestrconsts:lismvsavemessagestofiletxt
+msgid "Save messages to file (*.txt)"
+msgstr "Simpan pesan ke file (*.txt)"
+
+#: lazarusidestrconsts:lisshowoldtaborder
+msgid "Show old tab order"
+msgstr "Tampilkan urutan tab lama"
+
+#: lazarusidestrconsts:listaborderof
+msgid "Tab Order of"
+msgstr "Urutan Tab dari"
+
+#: lazarusidestrconsts:lisanchorenabledhint
+msgid "Enabled = Include %s in Anchors"
+msgstr "Hidupkan = Sertakan %s dalam Anchors"
+
+#: lazarusidestrconsts:lisaroundborderspacehint
+msgid "Borderspace around the control. The other four borderspaces are added to this value."
+msgstr "Batas spasi sekeliling kontrol. Batas spasi ke empat lainnya ditambahkan ke nilai ini"
+
+#: lazarusidestrconsts:listopborderspacespinedithint
+msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
+msgstr "Batas spasi Atas. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi diatas kontrol."
+
+#: lazarusidestrconsts:lisbottomborderspacespinedithint
+msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
+msgstr "Batas spasi Bawah. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dibawah kontrol."
+
+#: lazarusidestrconsts:lisleftborderspacespinedithint
+msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
+msgstr "Batas spasi Kiri. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikiri kontrol."
+
+#: lazarusidestrconsts:lisrightborderspacespinedithint
+msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
+msgstr "Batas spasi Kanan. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikanan kontrol."
+
+#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
+msgid "Center control vertically relative to the given sibling"
+msgstr "Tengahkan kontrol secara vertikal relatif ke yang terdekat"
+
+#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
+msgid "Center control horizontally relative to the given sibling"
+msgstr "Tengahkan kontrol secara horisontal relatif ke yang terdekat"
+
+#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
+msgid "Anchor to top side of sibling, keep border space"
+msgstr "Anchor ke sisi atas dari yang terdekat, biarkan batas spasi"
+
+#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
+msgid "Anchor to bottom side of sibling, keep border space"
+msgstr "Anchor ke sisi bawah dari yang terdekat, biarkan batas spasi"
+
+#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
+msgid "Anchor to left side of sibling, keep border space"
+msgstr "Anchor ke sisi kiri dari yang terdekat, biarkan batas spasi"
+
+#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
+msgid "Anchor to right side of sibling, keep border space"
+msgstr "Anchor ke sisi kanan dari yang terdekat, biarkan batas spasi"
+
+#: lazarusidestrconsts:listopsiblingcomboboxhint
+msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
+msgstr "Ini adalah kontrol terdekat dimana sisi atas dianchor. Biarkan kosong untuk parent."
+
+#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
+msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
+msgstr "Ini adalah kontrol terdekat dimana sisi bawah dianchor. Biarkan kosong untuk parent."
+
+#: lazarusidestrconsts:lisrightsiblingcomboboxhint
+msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
+msgstr "Ini adalah kontrol terdekat dimana sisi kanan dianchor. Biarkan kosong untuk parent."
+
+#: lazarusidestrconsts:lisleftsiblingcomboboxhint
+msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
+msgstr "Ini adalah kontrol terdekat dimana sisi kiri dianchor. Biarkan kosong untuk parent."
+
+#: lazarusidestrconsts:lisborderspace
+msgid "BorderSpace"
+msgstr "BatasSpasi"
+
+#: lazarusidestrconsts:lissibling
+msgid "Sibling"
+msgstr "Terdekat"
+
+#: lazarusidestrconsts:lisenabled
+msgid "Enabled"
+msgstr "Hidupkan"
+
+#: lazarusidestrconsts:lisrightanchoring
+msgid "Right anchoring"
+msgstr "Anchor Kanan"
+
+#: lazarusidestrconsts:listopanchoring
+msgid "Top anchoring"
+msgstr "Anchor Atas"
+
+#: lazarusidestrconsts:lisleftgroupboxcaption
+msgid "Left anchoring"
+msgstr "Anchor Kiri"
+
+#: lazarusidestrconsts:lisbottomgroupboxcaption
+msgid "Bottom anchoring"
+msgstr "Anchor Bawah"
+
+#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
+msgid "Unable to set AnchorSide Control"
+msgstr "Tidak bisa men-set Kontrol AnchorSide"
+
+#: lazarusidestrconsts:lisanchoreditornocontrolselected
+msgid "Anchor Editor - no control selected"
+msgstr "Editor Anchor - tidak ada kontrol dipilih"
+
+#: lazarusidestrconsts:lisanchorsofselectedcontrols
+msgid "Anchors of selected controls"
+msgstr "Anchor dari kontrol yang dipilih"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
+msgid "Additional search path"
+msgstr "Tambahan path pencarian"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
+msgid "Debugger general options"
+msgstr "Opsi umum Debugger"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
+msgid "Show message on stop"
+msgstr "Tampilkan pesan saat berhenti"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
+msgid "Debugger specific options (depends on type of debugger)"
+msgstr "Opsi spesifik Debugger (tergantung pada tipe dari debugger)"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
+msgid "Event Log"
+msgstr "Log Event"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
+msgid "Clear log on run"
+msgstr "bersihkan log saat dijalankan"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
+msgid "Limit linecount to"
+msgstr "Batasi hitungan baris ke"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
+msgid "Breakpoint"
+msgstr "Titik pisah"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmprocess
+msgid "Process"
+msgstr "Proses"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmthread
+msgid "Thread"
+msgstr "Thread"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmmodule
+msgid "Module"
+msgstr "Modul"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmoutput
+msgid "Output"
+msgstr "Output"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmwindow
+msgid "Window"
+msgstr "Jendela"
+
+#: lazarusidestrconsts:lisdebugoptionsfrminterface
+msgid "Interface"
+msgstr "Interface"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
+msgid "Language Exceptions"
+msgstr "Eksepsi Bahasa"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
+msgid "Ignore these exceptions"
+msgstr "Abaikan eksepsi ini"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
+msgid "Break on Lazarus Exceptions"
+msgstr "Pisah saat Eksepsi Lazarus"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
+msgid "OS Exceptions"
+msgstr "Eksepsi OS"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmsignals
+msgid "Signals"
+msgstr "Sinyal"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmname
+msgid "Name"
+msgstr "Nama"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmid
+msgid "ID"
+msgstr "ID"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
+msgid "Handled by"
+msgstr "Ditangani oleh"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresume
+msgid "Resume"
+msgstr "Jalankan lagi"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
+msgid "Handled by Program"
+msgstr "Ditangani oleh Program"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
+msgid "Handled by Debugger"
+msgstr "Ditangani oleh Debugger"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
+msgid "Resume Handled"
+msgstr "Jalankan lagi yang Ditangani"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
+msgid "Resume Unhandled"
+msgstr "Jalankan lagi yang Tidak ditangani"
+
diff --git a/languages/objinspstrconsts.id.po b/languages/objinspstrconsts.id.po
new file mode 100644
index 0000000000..b0af406b55
--- /dev/null
+++ b/languages/objinspstrconsts.id.po
@@ -0,0 +1,990 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-03 01:09+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Lazarus Team <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: objinspstrconsts:oisobjectinspector
+msgid "Object Inspector"
+msgstr "Inspektor Objek"
+
+#: objinspstrconsts:oisall
+msgid "All"
+msgstr "Semua"
+
+#: objinspstrconsts:oiserror
+msgid "Error"
+msgstr "Salah"
+
+#: objinspstrconsts:oisitemsselected
+msgid "%u items selected"
+msgstr "%u item dipilih"
+
+#: objinspstrconsts:oiscadd
+msgid "&Add"
+msgstr "&Tambah"
+
+#: objinspstrconsts:oiscdelete
+msgid "&Delete"
+msgstr "&Hapus"
+
+#: objinspstrconsts:oisconfirmdelete
+msgid "Confirm delete"
+msgstr "Konfirmasi hapus"
+
+#: objinspstrconsts:oisdeleteitem
+msgid "Delete item %s%s%s?"
+msgstr "Hapus item %s%s%s?"
+
+#: objinspstrconsts:oisunknown
+msgid "Unknown"
+msgstr "Tidak dikenal"
+
+#: objinspstrconsts:oisobject
+msgid "Object"
+msgstr "Objek"
+
+#: objinspstrconsts:oisclass
+msgid "Class"
+msgstr "Kelas"
+
+#: objinspstrconsts:oisword
+msgid "Word"
+msgstr "Word"
+
+#: objinspstrconsts:oisstring
+msgid "String"
+msgstr "String"
+
+#: objinspstrconsts:oisfloat
+msgid "Float"
+msgstr "Float"
+
+#: objinspstrconsts:oisset
+msgid "Set"
+msgstr "Set"
+
+#: objinspstrconsts:oismethod
+msgid "Method"
+msgstr "Metode"
+
+#: objinspstrconsts:oisvariant
+msgid "Variant"
+msgstr "Varian"
+
+#: objinspstrconsts:oisarray
+msgid "Array"
+msgstr "Array"
+
+#: objinspstrconsts:oisrecord
+msgid "Record"
+msgstr "Record"
+
+#: objinspstrconsts:oisinterface
+msgid "Interface"
+msgstr "Interface"
+
+#: objinspstrconsts:oisproperties
+msgid "Properties"
+msgstr "Properti"
+
+#: objinspstrconsts:oisevents
+msgid "Events"
+msgstr "Event"
+
+#: objinspstrconsts:oisfavorites
+msgid "Favorites"
+msgstr "Favorit"
+
+#: objinspstrconsts:oissettodefault
+msgid "Set to default: %s"
+msgstr "Set ke default: %s"
+
+#: objinspstrconsts:oissettodefaultvalue
+msgid "Set to default value"
+msgstr "Set ke nilai default"
+
+#: objinspstrconsts:oisaddtofavorites
+msgid "Add to Favorites"
+msgstr "Tambahkan ke Favorit"
+
+#: objinspstrconsts:oisremovefromfavorites
+msgid "Remove from Favorites"
+msgstr "Hapus dari Favorit"
+
+#: objinspstrconsts:oisundo
+msgid "Undo"
+msgstr "Undo"
+
+#: objinspstrconsts:oisfinddeclaration
+msgid "Jump to declaration"
+msgstr "Lompat ke deklarasi"
+
+#: objinspstrconsts:oiscut
+msgid "Cut"
+msgstr "Cut"
+
+#: objinspstrconsts:oiscopy
+msgid "Copy"
+msgstr "Copy"
+
+#: objinspstrconsts:oispaste
+msgid "Paste"
+msgstr "Paste"
+
+#: objinspstrconsts:oisdelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:oisshowhints
+msgid "Show Hints"
+msgstr "Tampilkan Petunjuk"
+
+#: objinspstrconsts:oisshowcomponenttree
+msgid "Show Component Tree"
+msgstr "Tampilkan Susunan Komponen"
+
+#: objinspstrconsts:oisoptions
+msgid "Options"
+msgstr "Opsi"
+
+#: objinspstrconsts:oisvalue
+msgid "Value:"
+msgstr "Nilai:"
+
+#: objinspstrconsts:oisinteger
+msgid "Integer"
+msgstr "Integer"
+
+#: objinspstrconsts:oisint64
+msgid "Int64"
+msgstr "Int64"
+
+#: objinspstrconsts:oisboolean
+msgid "Boolean"
+msgstr "Boolean"
+
+#: objinspstrconsts:oisenumeration
+msgid "Enumeration"
+msgstr "Enumeration"
+
+#: objinspstrconsts:oischar
+msgid "Char"
+msgstr "Char"
+
+#: objinspstrconsts:sccstredtcaption
+msgid "TreeView Items Editor"
+msgstr "Editor Item TreeView"
+
+#: objinspstrconsts:sccstredt
+msgid "Edit TreeView Items..."
+msgstr "Edit Item TreeView..."
+
+#: objinspstrconsts:sccstredtgrplcaption
+msgid "Items"
+msgstr "Item"
+
+#: objinspstrconsts:sccstredtgrprcaption
+msgid "Item Properties"
+msgstr "Properti Item"
+
+#: objinspstrconsts:sccstredtnewitem
+msgid "New Item"
+msgstr "Item Baru"
+
+#: objinspstrconsts:sccstredtnewsubitem
+msgid "New SubItem"
+msgstr "Subitem Baru"
+
+#: objinspstrconsts:sccstredtdelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:sccstredtapply
+msgid "Apply"
+msgstr "Terapkan"
+
+#: objinspstrconsts:sccstredtload
+msgid "Load"
+msgstr "Ambil"
+
+#: objinspstrconsts:sccstredtsave
+msgid "Save"
+msgstr "Simpan"
+
+#: objinspstrconsts:sccstredtlabeltext
+msgid "Text:"
+msgstr "Teks:"
+
+#: objinspstrconsts:sccstredtlabelimageindex
+msgid "Image Index:"
+msgstr "Indeks Gambar:"
+
+#: objinspstrconsts:sccstredtlabelselindex
+msgid "Selected Index:"
+msgstr "Indeks Dipilih"
+
+#: objinspstrconsts:sccstredtlabelstateindex
+msgid "State Index:"
+msgstr "Indeks Keadaan:"
+
+#: objinspstrconsts:sccstredtitem
+msgid "Item"
+msgstr "Item"
+
+#: objinspstrconsts:sccstredtopendialog
+msgid "Open"
+msgstr "Buka"
+
+#: objinspstrconsts:sccstredtsavedialog
+msgid "Save"
+msgstr "Simpan"
+
+#: objinspstrconsts:sccslvedtcaption
+msgid "ListView Items Editor"
+msgstr "Editor Item ListView"
+
+#: objinspstrconsts:sccslvedt
+msgid "Edit ListView Items..."
+msgstr "Edit Item ListView..."
+
+#: objinspstrconsts:sccslvedtgrplcaption
+msgid "Items"
+msgstr "Item"
+
+#: objinspstrconsts:sccslvedtgrprcaption
+msgid "Item Properties"
+msgstr "Properti Item"
+
+#: objinspstrconsts:sccslvedtnewitem
+msgid "New Item"
+msgstr "Item Baru"
+
+#: objinspstrconsts:sccslvedtnewsubitem
+msgid "New SubItem"
+msgstr "SubItem Baru"
+
+#: objinspstrconsts:sccslvedtapply
+msgid "Apply"
+msgstr "Terapkan"
+
+#: objinspstrconsts:sccslvedtdelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:sccslvedtlabelcaption
+msgid "Caption:"
+msgstr "Caption:"
+
+#: objinspstrconsts:sccslvedtlabelimageindex
+msgid "Image Index:"
+msgstr "Indeks Gambar"
+
+#: objinspstrconsts:sccslvedtlabelstateindex
+msgid "State Index:"
+msgstr "Indeks Keadaan:"
+
+#: objinspstrconsts:sccslvedtitem
+msgid "Item"
+msgstr "Item"
+
+#: objinspstrconsts:sccsiledtcaption
+msgid "ImageList Editor"
+msgstr "Editor DaftarGambar"
+
+#: objinspstrconsts:sccsiledtgrplcaption
+msgid "Images"
+msgstr "Gambar"
+
+#: objinspstrconsts:sccsiledtgrprcaption
+msgid "Selected Image"
+msgstr "Gambar dipilih"
+
+#: objinspstrconsts:sccsiledtadd
+msgid "Add..."
+msgstr "Tambah..."
+
+#: objinspstrconsts:sccsiledtdelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:sccsiledtapply
+msgid "Apply"
+msgstr "Terapkan"
+
+#: objinspstrconsts:sccsiledtclear
+msgid "Clear"
+msgstr "Bersihkan"
+
+#: objinspstrconsts:sccsiledtmoveup
+msgid "Move Up"
+msgstr "Naikan"
+
+#: objinspstrconsts:sccsiledtmovedown
+msgid "Move Down"
+msgstr "Turunkan"
+
+#: objinspstrconsts:sccsiledtsave
+msgid "Save..."
+msgstr "Simpan..."
+
+#: objinspstrconsts:sccsiledtransparentcolor
+msgid "Transparent Color:"
+msgstr "Warna Transparan:"
+
+#: objinspstrconsts:sccsiledtadjustment
+msgid "Adjustment"
+msgstr "Penyesuaian"
+
+#: objinspstrconsts:sccsiledtnone
+msgid "None"
+msgstr "Tidak ada"
+
+#: objinspstrconsts:sccsiledtstretch
+msgid "Stretch"
+msgstr "Rentangkan"
+
+#: objinspstrconsts:sccsiledtcrop
+msgid "Crop"
+msgstr "Crop"
+
+#: objinspstrconsts:sccsiledtcenter
+msgid "Center"
+msgstr "Tengah"
+
+#: objinspstrconsts:sccsiledtopendialog
+msgid "Add Images"
+msgstr "Tambah Gambar"
+
+#: objinspstrconsts:sccsiledtsavedialog
+msgid "Save Image"
+msgstr "Simpan Gambar"
+
+#: objinspstrconsts:sccssgedt
+msgid "Edit StringGrid..."
+msgstr "Edit StringGrid..."
+
+#: objinspstrconsts:sccssgedtcaption
+msgid "StringGrid Editor"
+msgstr "StringGrid Editor"
+
+#: objinspstrconsts:sccssgedtgrp
+msgid "String Grid"
+msgstr "String Grid"
+
+#: objinspstrconsts:sccssgedtapply
+msgid "Apply"
+msgstr "Terapkan"
+
+#: objinspstrconsts:sccssgedtclean
+msgid "Clean"
+msgstr "Bersihkan"
+
+#: objinspstrconsts:sccssgedtload
+msgid "Load..."
+msgstr "Ambil..."
+
+#: objinspstrconsts:sccssgedtsave
+msgid "Save..."
+msgstr "Simpan..."
+
+#: objinspstrconsts:sccssgedtopendialog
+msgid "Open"
+msgstr "Buka"
+
+#: objinspstrconsts:sccssgedtsavedialog
+msgid "Save"
+msgstr "Simpan"
+
+#: objinspstrconsts:nbcesaddpage
+msgid "Add page"
+msgstr "Tambah halaman"
+
+#: objinspstrconsts:nbcesinsertpage
+msgid "Insert page"
+msgstr "Sisipkan halaman"
+
+#: objinspstrconsts:nbcesdeletepage
+msgid "Delete page"
+msgstr "Hapus halaman"
+
+#: objinspstrconsts:nbcesmovepageleft
+msgid "Move page left"
+msgstr "Pindahkan halaman kekiri"
+
+#: objinspstrconsts:nbcesmovepageright
+msgid "Move page right"
+msgstr "Pindahkan halaman kekanan"
+
+#: objinspstrconsts:nbcesshowpage
+msgid "Show page ..."
+msgstr "Tampilkan halaman..."
+
+#: objinspstrconsts:oiscreatedefaultevent
+msgid "Create default event"
+msgstr "Buat event default"
+
+#: objinspstrconsts:clbchecklistboxeditor
+msgid "CheckListBox Editor"
+msgstr "CheckListBox Editor"
+
+#: objinspstrconsts:clbup
+msgid "&Up"
+msgstr "&Naik"
+
+#: objinspstrconsts:clbdown
+msgid "Do&wn"
+msgstr "&Turun"
+
+#: objinspstrconsts:clbmodify
+msgid "Modify the Item"
+msgstr "Ubah Item"
+
+#: objinspstrconsts:clbadd
+msgid "Add new Item"
+msgstr "Tambah Item baru"
+
+#: objinspstrconsts:clbdelete
+msgid "Delete the Item %d \"%s\"?"
+msgstr "Hapus Item %d \"%s\"?"
+
+#: objinspstrconsts:clbcheckgroupeditor
+msgid "CheckGroup Editor"
+msgstr "CheckGroup Editor"
+
+#: objinspstrconsts:clbdisable
+msgid "Popup to disable/enable items"
+msgstr "Popup untuk mematikan/menghidupkan item"
+
+#: objinspstrconsts:oicoleditadd
+msgid "Add"
+msgstr "Tambah"
+
+#: objinspstrconsts:oicoleditdelete
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:oicoleditup
+msgid "Up"
+msgstr "Naik"
+
+#: objinspstrconsts:oicoleditdown
+msgid "Down"
+msgstr "Turun"
+
+#: objinspstrconsts:oicoleditediting
+msgid "Editing"
+msgstr "Mengedit"
+
+#: objinspstrconsts:cactionlisteditorunknowncategory
+msgid "(Unknown)"
+msgstr "(Tidak dikenal)"
+
+#: objinspstrconsts:cactionlisteditorallcategory
+msgid "(All)"
+msgstr "(Semua)"
+
+#: objinspstrconsts:cactionlisteditoreditcategory
+msgid "Edit"
+msgstr "Edit"
+
+#: objinspstrconsts:cactionlisteditorhelpcategory
+msgid "Help"
+msgstr "Panduan"
+
+#: objinspstrconsts:oiscategory
+msgid "Category"
+msgstr "Kategori"
+
+#: objinspstrconsts:oisaction
+msgid "Action"
+msgstr "Aksi"
+
+#: objinspstrconsts:oismasks
+msgid "Masks..."
+msgstr "Masks..."
+
+#: objinspstrconsts:oissaveliteralcharacters
+msgid "Save Literal Characters"
+msgstr "Simpan Karakter Literal"
+
+#: objinspstrconsts:oisinputmask
+msgid "Input Mask:"
+msgstr "Input Mask:"
+
+#: objinspstrconsts:oissamplemasks
+msgid "Sample Masks:"
+msgstr "Contoh Masks:"
+
+#: objinspstrconsts:oischaractersforblanks
+msgid "Characters for Blanks"
+msgstr "Karakter untuk Blank"
+
+#: objinspstrconsts:oistestinput
+msgid "Test Input"
+msgstr "Uji Input"
+
+#: objinspstrconsts:oisopenmaskfile
+msgid "Open masks file (*.dem)"
+msgstr "Buka f ile masks (*.dem)"
+
+#: objinspstrconsts:cactionlisteditordialogcategory
+msgid "Dialog"
+msgstr "Dialog"
+
+#: objinspstrconsts:cactionlisteditorfilecategory
+msgid "File"
+msgstr "File"
+
+#: objinspstrconsts:cactionlisteditordatabasecategory
+msgid "Database"
+msgstr "Database"
+
+#: objinspstrconsts:oiseditactionlist
+msgid "Edit action list..."
+msgstr "Edit daftar aksi..."
+
+#: objinspstrconsts:oisactionlisteditor
+msgid "Action List Editor"
+msgstr "Editor Daftar Aksi"
+
+#: objinspstrconsts:cactionlisteditornewaction
+msgid "New Action"
+msgstr "Aksi Baru"
+
+#: objinspstrconsts:cactionlisteditornewstdaction
+msgid "New Standard Action"
+msgstr "Aksi Standar Baru"
+
+#: objinspstrconsts:cactionlisteditormovedownaction
+msgid "Move Down"
+msgstr "Pindah kebawah"
+
+#: objinspstrconsts:ilesadd
+msgid "Add"
+msgstr "Tambah"
+
+#: objinspstrconsts:cactionlisteditormoveupaction
+msgid "Move Up"
+msgstr "Pindah keatas"
+
+#: objinspstrconsts:cactionlisteditordeleteactionhint
+msgid "Delete Action"
+msgstr "Hapus Aksi"
+
+#: objinspstrconsts:cactionlisteditordeleteaction
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:cactionlisteditorpaneldescrriptions
+msgid "Panel Descriptions"
+msgstr "Deskripsi Panel"
+
+#: objinspstrconsts:cactionlisteditorpaneltoolbar
+msgid "Toolbar"
+msgstr "Toolbar"
+
+#: objinspstrconsts:oistdacteditcutheadline
+msgid "Cu&t"
+msgstr "Cu&t"
+
+#: objinspstrconsts:oistdacteditcopyheadline
+msgid "&Copy"
+msgstr "&Copy"
+
+#: objinspstrconsts:oistdacteditpasteheadline
+msgid "&Paste"
+msgstr "&Paste"
+
+#: objinspstrconsts:oistdacteditselectallheadline
+msgid "Select &All"
+msgstr "Pilih &Semua"
+
+#: objinspstrconsts:oistdacteditundoheadline
+msgid "&Undo"
+msgstr "&Undo"
+
+#: objinspstrconsts:oistdacteditdeleteheadline
+msgid "&Delete"
+msgstr "&Hapus"
+
+#: objinspstrconsts:oistdacthelpcontentsheadline
+msgid "&Contents"
+msgstr "&Isi"
+
+#: objinspstrconsts:oistdacthelptopicsearchheadline
+msgid "&Topic Search"
+msgstr "Pencarian &Topik"
+
+#: objinspstrconsts:oistdacthelphelphelpheadline
+msgid "&Help on Help"
+msgstr "Panduan atas &Panduan"
+
+#: objinspstrconsts:oistdactfileopenheadline
+msgid "&Open..."
+msgstr "&Buka"
+
+#: objinspstrconsts:oistdactfilesaveasheadline
+msgid "Save &As..."
+msgstr "Simpan Seb&agai..."
+
+#: objinspstrconsts:oistdactfileexitheadline
+msgid "E&xit"
+msgstr "&Keluar"
+
+#: objinspstrconsts:oistdactcolorselect1headline
+msgid "Select &Color..."
+msgstr "Pilih &Warna..."
+
+#: objinspstrconsts:oistdactfonteditheadline
+msgid "Select &Font..."
+msgstr "Pilih &Font..."
+
+#: objinspstrconsts:oistdactdatasetfirstheadline
+msgid "&First"
+msgstr "&Pertama"
+
+#: objinspstrconsts:oistdactdatasetpriorheadline
+msgid "&Prior"
+msgstr "S&ebelum"
+
+#: objinspstrconsts:oistdactdatasetnextheadline
+msgid "&Next"
+msgstr "&Berikut"
+
+#: objinspstrconsts:oistdactdatasetlastheadline
+msgid "&Last"
+msgstr "&Terakhir"
+
+#: objinspstrconsts:oistdactdatasetinsertheadline
+msgid "&Insert"
+msgstr "S&isipkan"
+
+#: objinspstrconsts:oistdactdatasetdeleteheadline
+msgid "&Delete"
+msgstr "&Hapus"
+
+#: objinspstrconsts:oistdactdataseteditheadline
+msgid "&Edit"
+msgstr "&Edit"
+
+#: objinspstrconsts:oistdactdatasetpostheadline
+msgid "P&ost"
+msgstr "Tu&lis"
+
+#: objinspstrconsts:oistdactdatasetcancelheadline
+msgid "&Cancel"
+msgstr "B&atal"
+
+#: objinspstrconsts:oistdactdatasetrefreshheadline
+msgid "&Refresh"
+msgstr "&Segarkan"
+
+#: objinspstrconsts:oistdacteditcutshortcut
+msgid "Ctrl+X"
+msgstr "Ctrl+X"
+
+#: objinspstrconsts:oistdacteditcopyshortcut
+msgid "Ctrl+C"
+msgstr "Ctrl+C"
+
+#: objinspstrconsts:oistdacteditpasteshortcut
+msgid "Ctrl+V"
+msgstr "Ctrl+V"
+
+#: objinspstrconsts:oistdacteditselectallshortcut
+msgid "Ctrl+A"
+msgstr "Ctrl+A"
+
+#: objinspstrconsts:oistdacteditundoshortcut
+msgid "Ctrl+Z"
+msgstr "Ctrl+Z"
+
+#: objinspstrconsts:oistdacteditdeleteshortcut
+msgid "Del"
+msgstr "Del"
+
+#: objinspstrconsts:oistdactfileopenshortcut
+msgid "Ctrl+O"
+msgstr "Ctrl+O"
+
+#: objinspstrconsts:oistdacteditcutshorthint
+msgid "Cut"
+msgstr "Cut"
+
+#: objinspstrconsts:oistdacteditcopyshorthint
+msgid "Copy"
+msgstr "Copy"
+
+#: objinspstrconsts:oistdacteditpasteshorthint
+msgid "Paste"
+msgstr "Paste"
+
+#: objinspstrconsts:oistdacteditselectallshorthint
+msgid "Select All"
+msgstr "Pilih Semua"
+
+#: objinspstrconsts:oistdacteditundoshorthint
+msgid "Undo"
+msgstr "Undo"
+
+#: objinspstrconsts:oistdacteditdeleteshorthint
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:oistdacthelpcontentshint
+msgid "Help Contents"
+msgstr "Daftar Isi Panduan"
+
+#: objinspstrconsts:oistdacthelptopicsearchhint
+msgid "Topic Search"
+msgstr "Pencarian Topik"
+
+#: objinspstrconsts:oistdacthelphelphelphint
+msgid "Help on help"
+msgstr "Panduan atas Panduan"
+
+#: objinspstrconsts:oistdactfileopenhint
+msgid "Open"
+msgstr "Buka"
+
+#: objinspstrconsts:oistdactfilesaveashint
+msgid "Save As"
+msgstr "Simpan Sebagai"
+
+#: objinspstrconsts:oistdactfileexithint
+msgid "Exit"
+msgstr "Keluar"
+
+#: objinspstrconsts:oistdactcolorselecthint
+msgid "Color Select"
+msgstr "Pilih Warna"
+
+#: objinspstrconsts:oistdactfontedithint
+msgid "Font Select"
+msgstr "Pilih Font"
+
+#: objinspstrconsts:oistdactdatasetfirsthint
+msgid "First"
+msgstr "Pertama"
+
+#: objinspstrconsts:oistdactdatasetpriorhint
+msgid "Prior"
+msgstr "Sebelum"
+
+#: objinspstrconsts:oistdactdatasetnexthint
+msgid "Next"
+msgstr "Berikut"
+
+#: objinspstrconsts:oistdactdatasetlasthint
+msgid "Last"
+msgstr "Terakhir"
+
+#: objinspstrconsts:oistdactdatasetinserthint
+msgid "Insert"
+msgstr "Sisipkan"
+
+#: objinspstrconsts:oistdactdatasetdeletehint
+msgid "Delete"
+msgstr "Hapus"
+
+#: objinspstrconsts:oistdactdatasetedithint
+msgid "Edit"
+msgstr "Edit"
+
+#: objinspstrconsts:oistdactdatasetposthint
+msgid "Post"
+msgstr "Tulis"
+
+#: objinspstrconsts:oistdactdatasetcancel1hint
+msgid "Cancel"
+msgstr "Batal"
+
+#: objinspstrconsts:oiscomponents
+msgid "Components"
+msgstr "Komponen"
+
+#: objinspstrconsts:oistdactdatasetrefreshhint
+msgid "Refresh"
+msgstr "Segarkan"
+
+#: objinspstrconsts:oisstdactionlisteditor
+msgid "Standard Action Classes"
+msgstr "Kelas Aksi Standar"
+
+#: objinspstrconsts:oisstdactionlisteditorclass
+msgid "Available Action Classes:"
+msgstr "Kelas Aksi Tersedia"
+
+#: objinspstrconsts:oisselectafile
+msgid "Select a file"
+msgstr "Pilih sebuah file"
+
+#: objinspstrconsts:oispropertiesof
+msgid "Properties of %s"
+msgstr "Properti dari %s"
+
+#: objinspstrconsts:oisallfiles
+msgid "All files"
+msgstr "Semua file"
+
+#: objinspstrconsts:oistestdialog
+msgid "Test dialog..."
+msgstr "Uji dialog..."
+
+#: objinspstrconsts:oissort
+msgid "Sort"
+msgstr "Urut"
+
+#: objinspstrconsts:oisdlinesdchars
+msgid "%d lines, %d chars"
+msgstr "%d baris, %d chars"
+
+#: objinspstrconsts:ois1linedchars
+msgid "1 line, %d chars"
+msgstr "1 baris, %d chars"
+
+#: objinspstrconsts:oisstringseditordialog
+msgid "Strings Editor Dialog"
+msgstr "Dialog Editor String"
+
+#: objinspstrconsts:ois0lines0chars
+msgid "0 lines, 0 chars"
+msgstr "0 baris, 0 chars"
+
+#: objinspstrconsts:oisinvalidpropertyvalue
+msgid "Invalid property value"
+msgstr "Nilai properti tidak benar"
+
+#: objinspstrconsts:oisnone
+msgid "(none)"
+msgstr "(tidak ada)"
+
+#: objinspstrconsts:oiscomponentnameisnotavalididentifier
+msgid "Component name %s%s%s is not a valid identifier"
+msgstr "Nama komponen %s%s%s bukan pengenal yang benar"
+
+#: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile
+msgid "The help database %s%s%s was unable to find file %s%s%s."
+msgstr "Database panduan %s%s%s tidak bisa menemukan file %s%s%s."
+
+#: objinspstrconsts:oishelpthemacrosinbrowserparamswillbereplacedbytheurl
+msgid "The macro %s in BrowserParams will be replaced by the URL."
+msgstr "Makro %s dalam BrowserParams akan ditimpa dengan URL."
+
+#: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe
+msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers"
+msgstr "Tidak ada HTML Browser ditemukan.%s Silahkan tetapkan satu dalam Panduan >Konfigurasi Panduan >Viewers"
+
+#: objinspstrconsts:oishelpbrowsernotfound
+msgid "Browser %s%s%s not found."
+msgstr "Browser %s%s%s tidak ditemukan"
+
+#: objinspstrconsts:oishelpbrowsernotexecutable
+msgid "Browser %s%s%s not executable."
+msgstr "Browser %s%s%s bukan eksekutabel."
+
+#: objinspstrconsts:oishelperrorwhileexecuting
+msgid "Error while executing %s%s%s:%s%s"
+msgstr "Salah ketika menjalankan %s%s%s:%s%s"
+
+#: objinspstrconsts:oishelphelpnodehasnohelpdatabase
+msgid "Help node %s%s%s has no Help Database"
+msgstr "Node Panduan %s%s%s tidak mempunyai Database Panduan"
+
+#: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype
+msgid "Help Database %s%s%s did not found a viewer for a help page of type %s"
+msgstr "Database Panduan %s%s%s tidak menemukan viewer untuk halaman panduan dari tipe %s"
+
+#: objinspstrconsts:oishelpalreadyregistered
+msgid "%s: Already registered"
+msgstr "%s: Sudah terdaftar"
+
+#: objinspstrconsts:oishelpnotregistered
+msgid "%s: Not registered"
+msgstr "%s: Tidak terdaftar"
+
+#: objinspstrconsts:oishelphelpdatabasenotfound
+msgid "Help Database %s%s%s not found"
+msgstr "Database Panduan %s%s%s tidak ditemukan"
+
+#: objinspstrconsts:oishelphelpkeywordnotfoundindatabase
+msgid "Help keyword %s%s%s not found in Database %s%s%s."
+msgstr "Kunci kata Panduan %s%s%s tidak ditemukan dalam Database %s%s%s."
+
+#: objinspstrconsts:oishelphelpkeywordnotfound
+msgid "Help keyword %s%s%s not found."
+msgstr "Kunci kata Panduan %s%s%s tidak ditemukan."
+
+#: objinspstrconsts:oishelphelpcontextnotfoundindatabase
+msgid "Help context %s not found in Database %s%s%s."
+msgstr "Konteks Panduan %s tidak ditemukan dalam Database %s%s%s."
+
+#: objinspstrconsts:oishelphelpcontextnotfound
+msgid "Help context %s not found."
+msgstr "Konteks panduan %s tidak ditemukan."
+
+#: objinspstrconsts:oishelpnohelpfoundforsource
+msgid "No help found for line %d, column %d of %s."
+msgstr "Tidak ditemukan panduan untuk baris %d, kolom %d dari %s."
+
+#: objinspstrconsts:oisloadimagedialog
+msgid "Load Image Dialog"
+msgstr "Ambil Dialog Gambar"
+
+#: objinspstrconsts:oisok
+msgid "&OK"
+msgstr "&OK"
+
+#: objinspstrconsts:oiscancel
+msgid "&Cancel"
+msgstr "&Batal"
+
+#: objinspstrconsts:oisloadpicture
+msgid "Load picture"
+msgstr "Ambil gambar"
+
+#: objinspstrconsts:oissavepicture
+msgid "Save picture"
+msgstr "Simpan gambar"
+
+#: objinspstrconsts:oisclearpicture
+msgid "Clear picture"
+msgstr "Bersihkan gambar"
+
+#: objinspstrconsts:oisload
+msgid "&Load"
+msgstr "&Ambil"
+
+#: objinspstrconsts:oissave
+msgid "&Save"
+msgstr "&Simpan"
+
+#: objinspstrconsts:oisclear
+msgid "C&lear"
+msgstr "&Bersihkan"
+
+#: objinspstrconsts:oiserrorloadingimage
+msgid "Error loading image"
+msgstr "Kesalahan pengambilan gambar"
+
+#: objinspstrconsts:oiserrorloadingimage2
+msgid "Error loading image %s%s%s:%s%s"
+msgstr "Kesalahan pengambilan gambar %s%s%s:%s%s"
+
+#: objinspstrconsts:oisok2
+msgid "Ok"
+msgstr "Ok"
+
+#: objinspstrconsts:oiscreateanewpascalunit
+msgid "Create a new pascal unit."
+msgstr "Buat unit pascal baru."
+
diff --git a/lcl/languages/lcl.id.po b/lcl/languages/lcl.id.po
new file mode 100644
index 0000000000..a6c540bad7
--- /dev/null
+++ b/lcl/languages/lcl.id.po
@@ -0,0 +1,658 @@
+msgid ""
+msgstr ""
+"Project-Id-Version: Lazarus LCL v1.x\n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: 2006-06-02 15:42+0700\n"
+"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
+"Language-Team: Zaenal Mutaqin <ade999@gmail.com>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=iso-8859-1\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Poedit-Language: Indonesian\n"
+"X-Poedit-Country: INDONESIA\n"
+"X-Poedit-SourceCharset: iso-8859-1\n"
+
+#: lclstrconsts:snomdiform
+msgid "No MDI form present."
+msgstr "Tidak ada form MDI"
+
+#: lclstrconsts:rsmbyes
+msgid "&Yes"
+msgstr "&Ya"
+
+#: lclstrconsts:rsmbno
+msgid "&No"
+msgstr "&Tidak"
+
+#: lclstrconsts:rsmbok
+msgid "&OK"
+msgstr "&OK"
+
+#: lclstrconsts:rsmbcancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lclstrconsts:rsmbabort
+msgid "Abort"
+msgstr "Batal"
+
+#: lclstrconsts:rsmbretry
+msgid "&Retry"
+msgstr "&Coba lagi"
+
+#: lclstrconsts:rsmbignore
+msgid "&Ignore"
+msgstr "&Abaikan"
+
+#: lclstrconsts:rsmball
+msgid "&All"
+msgstr "&Semua"
+
+#: lclstrconsts:rsmbnotoall
+msgid "No to all"
+msgstr "Tidak untuk semua"
+
+#: lclstrconsts:rsmbyestoall
+msgid "Yes to &All"
+msgstr "Ya untuk &Semua"
+
+#: lclstrconsts:rsmbhelp
+msgid "&Help"
+msgstr "&Panduan"
+
+#: lclstrconsts:rsmbclose
+msgid "&Close"
+msgstr "&Tutup"
+
+#: lclstrconsts:rsmtwarning
+msgid "Warning"
+msgstr "Peringatan"
+
+#: lclstrconsts:rsmterror
+msgid "Error"
+msgstr "Salah"
+
+#: lclstrconsts:rsmtinformation
+msgid "Information"
+msgstr "Informasi"
+
+#: lclstrconsts:rsmtconfirmation
+msgid "Confirmation"
+msgstr "Konfirmasi"
+
+#: lclstrconsts:rsmtcustom
+msgid "Custom"
+msgstr "Kustom"
+
+#: lclstrconsts:rsfdopenfile
+msgid "Open existing file"
+msgstr "Buka file yang ada"
+
+#: lclstrconsts:rsfdoverwritefile
+msgid "Overwrite file ?"
+msgstr "Timpa file ?"
+
+#: lclstrconsts:rsfdfilealreadyexists
+msgid "The file \"%s\" already exists. Overwrite ?"
+msgstr "File \"%s\" sudah ada. Timpa saja ?"
+
+#: lclstrconsts:rsfdpathmustexist
+msgid "Path must exist"
+msgstr "Path harus ada"
+
+#: lclstrconsts:rsfdpathnoexist
+msgid "The path \"%s\" does not exist."
+msgstr "Path \"%s\" tidak ada."
+
+#: lclstrconsts:rsfdfilemustexist
+msgid "File must exist"
+msgstr "File harus ada"
+
+#: lclstrconsts:rsfddirectorymustexist
+msgid "Directory must exist"
+msgstr "Direktori harus ada"
+
+#: lclstrconsts:rsfdfilenotexist
+msgid "The file \"%s\" does not exist."
+msgstr "File \"%s\" tidak ada."
+
+#: lclstrconsts:rsfddirectorynotexist
+msgid "The directory \"%s\" does not exist."
+msgstr "Directori \"%s\" tidak ada."
+
+#: lclstrconsts:rsfdfilereadonlytitle
+msgid "File is not writable"
+msgstr "File tidak bisa ditulisi"
+
+#: lclstrconsts:rsfdfilereadonly
+msgid "The file \"%s\" is not writable."
+msgstr "File \"%s\" tidak bisa ditulisi."
+
+#: lclstrconsts:rsfdfilesaveas
+msgid "Save file as"
+msgstr "Simpan file sebagai"
+
+#: lclstrconsts:rsallfiles
+msgid "All files (%s)|%s|%s"
+msgstr "Semua file (%s)|%s|%s"
+
+#: lclstrconsts:rsfdselectdirectory
+msgid "Select Directory"
+msgstr "Pilih Direktori"
+
+#: lclstrconsts:rsselectcolortitle
+msgid "Select color"
+msgstr "Pilih warna"
+
+#: lclstrconsts:rsselectfonttitle
+msgid "Select a font"
+msgstr "Pilih font"
+
+#: lclstrconsts:rswarningunremovedpaintmessages
+msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left."
+msgstr " PERINGATAN: ada %s tersisa link pesan LM_PAINT/LM_GtkPAINT tidak dihapus."
+
+#: lclstrconsts:rswarningunreleaseddcsdump
+msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:"
+msgstr " PERINGATAN: Ada %d DCs tidak dilepas, dump detil sebagai berikut:"
+
+#: lclstrconsts:rswarningunreleasedgdiobjectsdump
+msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:"
+msgstr " PERINGATAN: Ada %d GDIObjects tidak dilepas, detil dump sebagai berikut:"
+
+#: lclstrconsts:rswarningunreleasedmessagesinqueue
+msgid " WARNING: There are %d messages left in the queue! I'll free them"
+msgstr " PERINGATAN: Ada %d pesan tersisa dalam antrian! Saya akan membebaskannya"
+
+#: lclstrconsts:rswarningunreleasedtimerinfos
+msgid " WARNING: There are %d TimerInfo structures left, I'll free them"
+msgstr " PERINGATAN: Ada %d struktur TimerInfo tersisa, Saya akan membebaskannya"
+
+#: lclstrconsts:rsfileinformation
+msgid "File information"
+msgstr "Informasi file"
+
+#: lclstrconsts:rsgtkfilter
+msgid "Filter:"
+msgstr "Filter:"
+
+#: lclstrconsts:rsgtkhistory
+msgid "History:"
+msgstr "Histori:"
+
+#: lclstrconsts:rsdefaultfileinfovalue
+msgid "permissions user group size date time"
+msgstr "ukuran waktu tanggal perijinan grup pemakai "
+
+#: lclstrconsts:rsblank
+msgid "Blank"
+msgstr "Kosong"
+
+#: lclstrconsts:rsunabletoloaddefaultfont
+msgid "Unable to load default font"
+msgstr "Tidak bisa mengambil font default"
+
+#: lclstrconsts:rsfileinfofilenotfound
+msgid "(file not found: \"%s\")"
+msgstr "(file tidak ditemukan: \"%s\")"
+
+#: lclstrconsts:rsgtkoptionnotransient
+msgid "--lcl-no-transient    Do not set transient order for modal forms"
+msgstr "--lcl-no-transient    Jangan set urutan sementara untuk form modal"
+
+#: lclstrconsts:rsgtkoptionmodule
+msgid "--gtk-module module   Load the specified module at startup."
+msgstr "--gtk-module module   Ambil modul yang ditetapkan saat startup."
+
+#: lclstrconsts:rsgoptionfatalwarnings
+msgid "--g-fatal-warnings    Warnings and errors generated by Gtk+/GDK will halt the application."
+msgstr "--g-fatal-warnings    Peringatan dan kesalahan dihasilkan oleh Gtk+/GDK akan menghentikan aplikasi."
+
+#: lclstrconsts:rsgtkoptiondebug
+msgid "--gtk-debug flags     Turn on specific Gtk+ trace/debug messages."
+msgstr "--gtk-debug flags    Hidupkan pesan khusus Gtk+ trace/debug."
+
+#: lclstrconsts:rsgtkoptionnodebug
+msgid "--gtk-no-debug flags  Turn off specific Gtk+ trace/debug messages."
+msgstr "--gtk-no-debug flags  Matikan pesan khusus Gtk+ trace/debug."
+
+#: lclstrconsts:rsgdkoptiondebug
+msgid "--gdk-debug flags     Turn on specific GDK trace/debug messages."
+msgstr "--gdk-debug flags     Hidupkan pesan khusus GDK trace/debug."
+
+#: lclstrconsts:rsgdkoptionnodebug
+msgid "--gdk-no-debug flags  Turn off specific GDK trace/debug messages."
+msgstr "--gdk-no-debug flags  Matikan pesan khusus GDK trace/debug."
+
+#: lclstrconsts:rsgtkoptiondisplay
+msgid "--display h:s:d       Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used."
+msgstr "--display h:s:d       Sambungkan ke X server tertentu, dimana \"h\" adalah nama host, \"s\" adalah nomor server (biasanya 0), dan \"d\" adalah nomor layar (biasanya diabaikan). Jika --display tidak ditetapkan, variabel lingkungan DISPLAY yang digunakan."
+
+#: lclstrconsts:rsgtkoptionsync
+msgid "--sync                Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server."
+msgstr "--sync                Panggil XSynchronize (layar, Benar) setelah sambungan Xserver terlaksana. Ini membuat debugging kesalahan protokol X lebih mudah, karena permintaan penyanggaan X akan dimatikan dan kesalahan X akan diterima segera setelah permintaan protokol yang kesalahannya telah dibuat sudah diproses oleh X server."
+
+#: lclstrconsts:rsgtkoptionnoxshm
+msgid "--no-xshm             Disable use of the X Shared Memory Extension."
+msgstr "--no-xshm             Matikan penggunaan X Shared Memory Extension."
+
+#: lclstrconsts:rsgtkoptionname
+msgid "--name programe       Set program name to \"progname\". If not specified, program name will be set to ParamStr(0)."
+msgstr "--name programe       Set nama program ke \"progname\". Jika tidak ditetapkan, nama program akan diset ke ParamStr(0)."
+
+#: lclstrconsts:rsgtkoptionclass
+msgid "--class classname     Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"."
+msgstr "--class classname     Mengikuti konvensi Xt, class dari sebuah program dalam nama program dengan inisial karakter dibesarkan. Sebagai contoh, classname untuk gimp adalah \"Gimp\". Jika --class ditetapkan, class dari program akan di set ke \"classname\"."
+
+#: lclstrconsts:rswin32warning
+msgid "Warning:"
+msgstr "Peringatan:"
+
+#: lclstrconsts:rswin32error
+msgid "Error:"
+msgstr "Kesalahan:"
+
+#: lclstrconsts:sinvalidactionregistration
+msgid "Invalid action registration"
+msgstr "Registrasi action tidak benar"
+
+#: lclstrconsts:sinvalidactionunregistration
+msgid "Invalid action unregistration"
+msgstr "Pembatalan registrasi action tidak benar"
+
+#: lclstrconsts:sinvalidactionenumeration
+msgid "Invalid action enumeration"
+msgstr "Enumerasi action tidak benar"
+
+#: lclstrconsts:sinvalidactioncreation
+msgid "Invalid action creation"
+msgstr "Pembuatan action tidak benar"
+
+#: lclstrconsts:smenunotfound
+msgid "Sub-menu is not in menu"
+msgstr "Sub-menu tidak dalam menu"
+
+#: lclstrconsts:smenuindexerror
+msgid "Menu index out of range"
+msgstr "Indeks Menu diluar jangkauan"
+
+#: lclstrconsts:smenuitemisnil
+msgid "MenuItem is nil"
+msgstr "MenuItem kosong"
+
+#: lclstrconsts:snotimers
+msgid "No timers available"
+msgstr "Tidak tersedia timer"
+
+#: lclstrconsts:sinvalidindex
+msgid "Invalid ImageList Index"
+msgstr "Indeks ImageList tidak benar"
+
+#: lclstrconsts:sinvalidimagesize
+msgid "Invalid image size"
+msgstr "Ukuran gambar tidak benar"
+
+#: lclstrconsts:sduplicatemenus
+msgid "Duplicate menus"
+msgstr "Duplikasi menu"
+
+#: lclstrconsts:scannotfocus
+msgid "Cannot focus a disabled or invisible window"
+msgstr "Tidak bisa memberikan fokus ke jendela yang dimatikan atau tidak nampak"
+
+#: lclstrconsts:rslistmustbeempty
+msgid "List must be empty"
+msgstr "List harus kosong"
+
+#: lclstrconsts:rsinvalidpropertyvalue
+msgid "Invalid property value"
+msgstr "Nilai properti tidak benar"
+
+#: lclstrconsts:rspropertydoesnotexist
+msgid "Property %s does not exist"
+msgstr "Properti %s tidak ada"
+
+#: lclstrconsts:rsinvalidstreamformat
+msgid "Invalid stream format"
+msgstr "Format stream tidak benar"
+
+#: lclstrconsts:rserrorreadingproperty
+msgid "Error reading %s%s%s: %s"
+msgstr "Kesalahan pembacaan %s%s%s: %s"
+
+#: lclstrconsts:rsinvalidformobjectstream
+msgid "invalid Form object stream"
+msgstr "Aliran Objek Form tidak benar"
+
+#: lclstrconsts:rsscrollbaroutofrange
+msgid "ScrollBar property out of range"
+msgstr "Properti ScrollBar diluar jangkauan"
+
+#: lclstrconsts:rsinvaliddate
+msgid "Invalid Date : %s"
+msgstr "Tanggal tidak benar : %s"
+
+#: lclstrconsts:rsinvaliddaterangehint
+msgid "Invalid Date: %s. Must be between %s and %s"
+msgstr "Tanggal tidak benar: %s. Harus ada diantara %s dan %s"
+
+#: lclstrconsts:rserroroccurredinataddressframe
+msgid "Error occurred in %s at %sAddress %s%s Frame %s"
+msgstr "Kesalahan terjadi dalam %s at %sAlamat %s%s Frame %s"
+
+#: lclstrconsts:rsexception
+msgid "Exception"
+msgstr "Kekecualian"
+
+#: lclstrconsts:rsformstreamingerror
+msgid "Form streaming \"%s\" error: %s"
+msgstr "Pengaliran form \"%s\" salah: %s"
+
+#: lclstrconsts:rsfixedcolstoobig
+msgid "FixedCols can't be >= ColCount"
+msgstr "FixedCols tidak bisa >= ColCount"
+
+#: lclstrconsts:rsfixedrowstoobig
+msgid "FixedRows can't be >= RowCount"
+msgstr "FixedRows tidak bisa >= RowCount"
+
+#: lclstrconsts:rsgridfiledoesnotexists
+msgid "Grid file doesn't exists"
+msgstr "File grid tidak ada"
+
+#: lclstrconsts:rsnotavalidgridfile
+msgid "Not a valid grid file"
+msgstr "Bukan file grid yang benar"
+
+#: lclstrconsts:rsindexoutofrange
+msgid "Index Out of range Cell[Col=%d Row=%d]"
+msgstr "Indeks Diluar jangkauan Cell[Kolom=%d Baris=%d]"
+
+#: lclstrconsts:rserrorinlcl
+msgid "ERROR in LCL: "
+msgstr "KESALAHAN dalam LCL: "
+
+#: lclstrconsts:rscreatinggdbcatchableerror
+msgid "Creating gdb catchable error:"
+msgstr "Pembuatan cachable salah: "
+
+#: lclstrconsts:rsacontrolcannothaveitselfasparent
+msgid "A control can't have itself as parent"
+msgstr "Kontrol tidak bisa menjadikan dirinya sebagai induk"
+
+#: lclstrconsts:lislclresourcesnotfound
+msgid "Resource %s not found"
+msgstr "Sumber %s tidak ditemukan"
+
+#: lclstrconsts:rserrorcreatingdevicecontext
+msgid "Error creating device context for %s.%s"
+msgstr "Kesalahan pembuatan konteks device untuk %s.%s"
+
+#: lclstrconsts:rsindexoutofbounds
+msgid "%s Index %d out of bounds 0-%d"
+msgstr "%s Indeks %d diluar jangkauan 0-%d"
+
+#: lclstrconsts:rsunknownpictureextension
+msgid "Unknown picture extension"
+msgstr "Ekstensi gambar tidak dikenal"
+
+#: lclstrconsts:rsbitmaps
+msgid "Bitmaps"
+msgstr "Bitmaps"
+
+#: lclstrconsts:rspixmap
+msgid "Pixmap"
+msgstr "Pixmap"
+
+#: lclstrconsts:rsportablenetworkgraphic
+msgid "Portable Network Graphic"
+msgstr "Portable Network Graphic"
+
+#: lclstrconsts:rsicon
+msgid "Icon"
+msgstr "Ikon"
+
+#: lclstrconsts:rsunsupportedclipboardformat
+msgid "Unsupported clipboard format: %s"
+msgstr "Format clipboard tidak didukung: %s"
+
+#: lclstrconsts:rsgroupindexcannotbelessthanprevious
+msgid "GroupIndex cannot be less than a previous menu item's GroupIndex"
+msgstr "GroupIndex tidak bisa kurang dari item GroupIndex menu sebelumnya"
+
+#: lclstrconsts:rsisalreadyassociatedwith
+msgid "%s is already associated with %s"
+msgstr "%s sudah dikaitkan dengan %s"
+
+#: lclstrconsts:rscanvasdoesnotallowdrawing
+msgid "Canvas does not allow drawing"
+msgstr "Kanvas tidak membolehkan penggambaran"
+
+#: lclstrconsts:rsunsupportedbitmapformat
+msgid "Unsupported bitmap format."
+msgstr "Format bitmap tidak didukung."
+
+#: lclstrconsts:rsnowidgetset
+msgid "No widgetset object. Plz check if the unit \"interfaces\" was added to the programs uses clause."
+msgstr "Objek widgetset todal ada. Tolong periksa apakah unit \"interfaces\" sudah ditambahkan ke klausul uses program."
+
+#: lclstrconsts:rspressoktoignoreandriskdatacorruptionpresscanceltok
+msgid "%s%sPress Ok to ignore and risk data corruption.%sPress Cancel to kill the program."
+msgstr "%s%sTekan Ok untuk mengabaikan dan resiko kerusakan data.%sTekan Batal untuk mematikan program"
+
+#: lclstrconsts:rscannotfocus
+msgid "Can not focus"
+msgstr "Tidak bisa memfokuskan"
+
+#: lclstrconsts:rslistindexexceedsbounds
+msgid "List index exceeds bounds (%d)"
+msgstr "Indeks List melebihi jangkauan (%d)"
+
+#: lclstrconsts:rsresourcenotfound
+msgid "Resource %s not found"
+msgstr "Sumber %s tidak ditemukan"
+
+#: lclstrconsts:rscalculator
+msgid "Calculator"
+msgstr "Kalkulator"
+
+#: lclstrconsts:rserror
+msgid "Error"
+msgstr "Salah"
+
+#: lclstrconsts:rspickdate
+msgid "Select a date"
+msgstr "Pilih tanggal"
+
+#: lclstrconsts:rssize
+msgid "  size "
+msgstr "  ukuran "
+
+#: lclstrconsts:rsmodified
+msgid "  modified "
+msgstr "  diubah "
+
+#: lclstrconsts:ifsvk_unknown
+msgid "Unknown"
+msgstr "Tidak dikenal"
+
+#: lclstrconsts:ifsvk_lbutton
+msgid "Mouse Button Left"
+msgstr "Tombol Mouse Kiri"
+
+#: lclstrconsts:ifsvk_rbutton
+msgid "Mouse Button Right"
+msgstr "Tombol Mouse Kanan"
+
+#: lclstrconsts:ifsvk_cancel
+msgid "Cancel"
+msgstr "Batal"
+
+#: lclstrconsts:ifsvk_mbutton
+msgid "Mouse Button Middle"
+msgstr "Tombol Mouse Tengah"
+
+#: lclstrconsts:ifsvk_back
+msgid "Backspace"
+msgstr "Backspace"
+
+#: lclstrconsts:ifsvk_tab
+msgid "Tab"
+msgstr "Tab"
+
+#: lclstrconsts:ifsvk_clear
+msgid "Clear"
+msgstr "Clear"
+
+#: lclstrconsts:ifsvk_return
+msgid "Return"
+msgstr "Return"
+
+#: lclstrconsts:ifsvk_shift
+msgid "Shift"
+msgstr "Shift"
+
+#: lclstrconsts:ifsvk_control
+msgid "Control"
+msgstr "Kontrol"
+
+#: lclstrconsts:ifsvk_menu
+msgid "Menu"
+msgstr "Menu"
+
+#: lclstrconsts:ifsvk_pause
+msgid "Pause key"
+msgstr "Tombol pause"
+
+#: lclstrconsts:ifsvk_capital
+msgid "Capital"
+msgstr "Kapital"
+
+#: lclstrconsts:ifsvk_kana
+msgid "Kana"
+msgstr "Kana"
+
+#: lclstrconsts:ifsvk_junja
+msgid "Junja"
+msgstr "Junja"
+
+#: lclstrconsts:ifsvk_final
+msgid "Final"
+msgstr "Final"
+
+#: lclstrconsts:ifsvk_hanja
+msgid "Hanja"
+msgstr "Hanja"
+
+#: lclstrconsts:ifsvk_escape
+msgid "Escape"
+msgstr "Escape"
+
+#: lclstrconsts:ifsvk_convert
+msgid "Convert"
+msgstr "Konversi"
+
+#: lclstrconsts:ifsvk_nonconvert
+msgid "Nonconvert"
+msgstr "Nonkonversi"
+
+#: lclstrconsts:ifsvk_accept
+msgid "Accept"
+msgstr "Terima"
+
+#: lclstrconsts:ifsvk_modechange
+msgid "Mode Change"
+msgstr "Ubah  Mode"
+
+#: lclstrconsts:ifsvk_space
+msgid "Space key"
+msgstr "Tombol Spasi"
+
+#: lclstrconsts:ifsvk_prior
+msgid "Prior"
+msgstr "Sebelumnya"
+
+#: lclstrconsts:ifsvk_next
+msgid "Next"
+msgstr "Berikutnya"
+
+#: lclstrconsts:ifsvk_end
+msgid "End"
+msgstr "End"
+
+#: lclstrconsts:ifsvk_home
+msgid "Home"
+msgstr "Home"
+
+#: lclstrconsts:ifsvk_left
+msgid "Left"
+msgstr "Left"
+
+#: lclstrconsts:ifsvk_up
+msgid "Up"
+msgstr "Up"
+
+#: lclstrconsts:ifsvk_right
+msgid "Right"
+msgstr "Right"
+
+#: lclstrconsts:ifsvk_down
+msgid "Down"
+msgstr "Turun"
+
+#: lclstrconsts:ifsvk_select
+msgid "Select"
+msgstr "Pilih"
+
+#: lclstrconsts:ifsvk_print
+msgid "Print"
+msgstr "Cetak"
+
+#: lclstrconsts:ifsvk_execute
+msgid "Execute"
+msgstr "Jalankan"
+
+#: lclstrconsts:ifsvk_snapshot
+msgid "Snapshot"
+msgstr "Snapshot"
+
+#: lclstrconsts:ifsvk_insert
+msgid "Insert"
+msgstr "Insert"
+
+#: lclstrconsts:ifsvk_delete
+msgid "Delete"
+msgstr "Delete"
+
+#: lclstrconsts:ifsvk_help
+msgid "Help"
+msgstr "Panduan"
+
+#: lclstrconsts:ifsvk_lwin
+msgid "left windows key"
+msgstr "tombol kiri windows"
+
+#: lclstrconsts:ifsvk_rwin
+msgid "right windows key"
+msgstr "tombol kanan windows"
+
+#: lclstrconsts:ifsvk_apps
+msgid "application key"
+msgstr "tombol aplikasi"
+
+#: lclstrconsts:ifsvk_numpad
+msgid "Numpad %d"
+msgstr "Numpad %d"
+
+#: lclstrconsts:ifsvk_numlock
+msgid "Numlock"
+msgstr "Numlock"
+
+#: lclstrconsts:ifsvk_scroll
+msgid "Scroll"
+msgstr "Scroll"
+
+#: lclstrconsts:rsdocking
+msgid "Docking"
+msgstr "Docking"
+