diff --git a/components/codetools/languages/codetools.ca.po b/components/codetools/languages/codetools.ca.po index 718b4aa722..5e6d5cdd84 100644 --- a/components/codetools/languages/codetools.ca.po +++ b/components/codetools/languages/codetools.ca.po @@ -12,7 +12,7 @@ msgstr "Projecte %s" #: codetoolsstrconsts:ctsstrexpectedbutatomfound msgid "%s expected, but %s found" -msgstr "S'esperava %s, per s'ha trobat %s" +msgstr "esperava %s, per s'ha trobat %s" #: codetoolsstrconsts:ctsfilehascircularsymlink msgid "%s has a circular symbolic link" @@ -44,23 +44,23 @@ msgstr ". comen #: codetoolsstrconsts:ctssemicolonafterpropspecmissing msgid "; expected after \"%s\" property specifier, but %s found" -msgstr "; esperat desprs de l'especificador de propietat \"%S\", per s'ha trobat %s" +msgstr "; esperat desprs de l'especificador de propietat \"%s\", per s'ha trobat %s" #: codetoolsstrconsts:ctsanoymdefinitionsarenotallowed msgid "Anonym %s definitions are not allowed" -msgstr "Definicions annimes %s no estan permeses" +msgstr "No estan permeses les definicions annimes %s" #: codetoolsstrconsts:ctscpudirectory msgid "CPU directory" -msgstr "" +msgstr "Directori de CPU" #: codetoolsstrconsts:ctsclasssnotfound msgid "Class %s not found" -msgstr "" +msgstr "Classe %s no trobada" #: codetoolsstrconsts:ctscommandlineparameters msgid "Command line parameters" -msgstr "Parmetres de la lnia de comandaments" +msgstr "Parmetres de la lnia d'ordres" #: codetoolsstrconsts:ctscommentendnotfound msgid "Comment end not found" @@ -84,11 +84,11 @@ msgstr "Directori de Components Personalitzats" #: codetoolsstrconsts:ctsdebuggerdirectory msgid "Debugger Directory" -msgstr "Directori del depurador" +msgstr "Directori del Depurador" #: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem msgid "Default ppc386 source Operating System" -msgstr "Codi font del SO predeterminat del ppc386" +msgstr "SO font predeterminat del ppc386" #: codetoolsstrconsts:ctsdefaultppc386symbol msgid "Default ppc386 symbol" @@ -108,23 +108,23 @@ msgstr "Definir" #: codetoolsstrconsts:ctsdefinemacroname msgid "Define Macro %s" -msgstr "Definir macro %s" +msgstr "Definir macroinstrucci %s" #: codetoolsstrconsts:ctsdefinemacrocarbon1 msgid "Define macro carbon1" -msgstr "" +msgstr "Definir macroinstrucci carbon1" #: codetoolsstrconsts:ctsdefinemacrognome2 msgid "Define macro gnome2" -msgstr "definir macro gnome2" +msgstr "Definir macroinstrucci gnome2" #: codetoolsstrconsts:ctsdefinemacrogtk1 msgid "Define macro gtk1" -msgstr "" +msgstr "Definir macroinstrucci gtk1" #: codetoolsstrconsts:ctsdefinemacrogtk2 msgid "Define macro gtk2" -msgstr "Definir macro gtk2" +msgstr "Definir macroinstrucci gtk2" #: codetoolsstrconsts:ctsdefineprocessortype msgid "Define processor type" @@ -144,7 +144,7 @@ msgstr "Unitats del dissenyador" #: codetoolsstrconsts:ctsdoceditordirectory msgid "Doc Editor Directory" -msgstr "" +msgstr "Directori de l'editor de documents" #: codetoolsstrconsts:ctsendofsourcenotfound msgid "End of source not found" @@ -160,11 +160,11 @@ msgstr "Definici #: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros msgid "Free Pascal Compiler initial macros" -msgstr "Macros inicials del Free Pascal Compiler" +msgstr "Macroinstruccions inicials del Free Pascal Compiler" #: codetoolsstrconsts:ctsfreepascalcomponentlibrary msgid "Free Pascal Component Library" -msgstr "Llibreria de Components del Free Pascal" +msgstr "Biblioteca de Components del Free Pascal" #: codetoolsstrconsts:ctsfreepascalsourcedir msgid "Free Pascal Source Directory" @@ -176,7 +176,7 @@ msgstr "Fonts del Free Pascal, %s" #: codetoolsstrconsts:ctsideintfdirectory msgid "IDEIntf Directory" -msgstr "" +msgstr "Directori IDEIntf" #: codetoolsstrconsts:ctsidentifieralreadydefined msgid "Identifier %s already defined" @@ -192,7 +192,7 @@ msgstr "If LCLWidgetType=gtk2 then" #: codetoolsstrconsts:ctsiftargetosisnotwin32 msgid "If TargetOS<>win32 then" -msgstr "" +msgstr "If targetOS<>win32 then" #: codetoolsstrconsts:ctsincludecircledetected msgid "Include circle detected" @@ -200,7 +200,7 @@ msgstr "Detectat cercle Include" #: codetoolsstrconsts:ctsinstallerdirectories msgid "Installer directories" -msgstr "" +msgstr "Directoris de l'installador" #: codetoolsstrconsts:ctsjitformdirectory msgid "JITForm Directory" @@ -220,7 +220,7 @@ msgstr "Analitzador no disponible" #: codetoolsstrconsts:ctsnoscannerfound msgid "No scanner found for \"%s\". If this is an include file, please open the main source first." -msgstr "No es troba analitzador per \"%s\". Si aquest s un fitxer incls, sisplau obra primer el codi font principal" +msgstr "No es troba analitzador per \"%s\". Si aquest s un fitxer incls, si us plau, obre primer el codi font principal" #: codetoolsstrconsts:ctspackagedirectories msgid "Package directories" @@ -240,7 +240,7 @@ msgstr "Directori d'unitats d'empaquetador" #: codetoolsstrconsts:ctspositionnotinsource msgid "Position not in source" -msgstr "" +msgstr "La posici no s al codi" #: codetoolsstrconsts:ctsresetalldefines msgid "Reset all defines" @@ -248,11 +248,11 @@ msgstr "Reiniciar totes les definicions" #: codetoolsstrconsts:ctsruntimelibrary msgid "Runtime library" -msgstr "Llibreria de temps d'execuci" +msgstr "Biblioteca de temps d'execuci" #: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits msgid "Source filenames for the standard fpc units" -msgstr "Noms de fitxers font de les unitats estndard del fpc" +msgstr "Noms de fitxers font de les unitats normalitzades del fpc" #: codetoolsstrconsts:ctssrcpathinitialization msgid "SrcPath Initialization" @@ -288,7 +288,7 @@ msgstr "Directoris d'utilitats" #: codetoolsstrconsts:ctswidgetdirectory msgid "Widget Directory" -msgstr "Directori de Widgets" +msgstr "Directori de ginys" #: codetoolsstrconsts:ctswordnotfound msgid "\"%s\" not found" @@ -296,7 +296,7 @@ msgstr "\"%S\" no trobat/ada" #: codetoolsstrconsts:ctsclassofdefinitionnotresolved msgid "\"class of\" definition not resolved: %s" -msgstr "" +msgstr "\"classe de \" definici no resolta: %s" #: codetoolsstrconsts:ctsendforclassnotfound msgid "\"end\" for class/object not found" @@ -304,7 +304,7 @@ msgstr "\"end\" per class/object no trobat" #: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink msgid "a directory component in %s does not exist or is a dangling symlink" -msgstr "un directori de components a %s no existeix o s un enlla simblic no vlid" +msgstr "un component del directori a %s no existeix o s un enlla simblic no vlid" #: codetoolsstrconsts:ctsdircomponentisnotdir msgid "a directory component in %s is not a directory" @@ -312,7 +312,7 @@ msgstr "un directori de components a %s no #: codetoolsstrconsts:ctsaddsdirtosourcepath msgid "adds %s to SrcPath" -msgstr "afegeix %s a SrcPath" +msgstr "afegir %s a SrcPath" #: codetoolsstrconsts:ctsanlclproject msgid "an LCL project" @@ -320,7 +320,7 @@ msgstr "un projecte LCL" #: codetoolsstrconsts:ctsancestorisnotproperty msgid "ancestor of untyped property is not a property" -msgstr "el progenitor o propietat sense tipus no s una propietat" +msgstr "el progenitor de propietat sense tipus no s una propietat" #: codetoolsstrconsts:ctsbasetypeofnotfound msgid "base type of \"%s\" not found" @@ -348,7 +348,7 @@ msgstr "cercle a les definicions" #: codetoolsstrconsts:ctsclassnotfound msgid "class %s%s%s not found" -msgstr "" +msgstr "classe %s%s%s no trobada" #: codetoolsstrconsts:ctsclassidentifierexpected msgid "class identifier expected" @@ -356,7 +356,7 @@ msgstr "s'esperava identificador de classe" #: codetoolsstrconsts:ctsclassnodewithoutparentnode msgid "class node without parent node" -msgstr "node class sense node pare" +msgstr "node classe sense node pare" #: codetoolsstrconsts:ctsclasswithoutname msgid "class without name" @@ -364,7 +364,7 @@ msgstr "classe sense nom" #: codetoolsstrconsts:ctsconstant msgid "constant" -msgstr "Constant" +msgstr "constant" #: codetoolsstrconsts:ctscursorposoutsideofcode msgid "cursor pos outside of code" @@ -396,15 +396,15 @@ msgstr "identificador duplicat: %s" #: codetoolsstrconsts:ctselse msgid "else" -msgstr "" +msgstr "else" #: codetoolsstrconsts:ctsendforrecordnotfound msgid "end for record not found" -msgstr "Final del registre no trobat" +msgstr "final del registre no trobat" #: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies msgid "error during creation of new proc bodies" -msgstr "error mentre creava els cossos de nous procediments" +msgstr "error mentre creava els cossos del nou procediment" #: codetoolsstrconsts:ctserrorduringinsertingnewclassparts msgid "error during inserting new class parts" @@ -412,7 +412,7 @@ msgstr "error mentre inseria parts de la nova classe" #: codetoolsstrconsts:ctserrorindirectiveexpression msgid "error in directive expression" -msgstr "Error en expressi de directiva" +msgstr "error en expressi de directiva" #: codetoolsstrconsts:ctserrorinparamlist msgid "error in paramlist" @@ -420,19 +420,19 @@ msgstr "error a llista de par #: codetoolsstrconsts:ctsexecuteaccessdeniedforfile msgid "execute access denied for %s" -msgstr "Denegat l'accs d'execuci per: %s" +msgstr "denegat l'accs d'execuci per: %s" #: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound msgid "expected end., but %s found" -msgstr "S'esperava end., per s'ha trobat %s" +msgstr "esperava end., per he trobat %s" #: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries msgid "exports clause only allowed in libraries" -msgstr "" +msgstr "clausula exportada noms s permesa en biblioteques" #: codetoolsstrconsts:ctsexprtypemustbeclassorrecord msgid "expression type must be class or record type" -msgstr "el tipus d'expressi ha de ser del tipus class o record" +msgstr "el tipus d'expressi ha de ser del tipus CLASS o RECORD" #: codetoolsstrconsts:ctsfiledoesnotexists msgid "file \"%s\" does not exist" @@ -440,7 +440,7 @@ msgstr "el fitxer \"%s\" no existeix" #: codetoolsstrconsts:ctsfileisreadonly msgid "file is read only" -msgstr "" +msgstr "el fitxer s noms de lectura" #: codetoolsstrconsts:ctsgnomeintfdirectory msgid "gnome interface directory" @@ -452,15 +452,15 @@ msgstr "directori d'interf #: codetoolsstrconsts:ctsidentifier msgid "identifier" -msgstr "Identificador" +msgstr "identificador" #: codetoolsstrconsts:ctsidentexpectedbutatomfound msgid "identifier expected, but %s found" -msgstr "S'esperava identificador, per s'ha trobat %s" +msgstr "esperava identificador, per s'ha trobat %s" #: codetoolsstrconsts:ctsidentexpectedbutkeywordfound msgid "identifier expected, but keyword %s found" -msgstr "S'esperava identificador, per s'ha trobat paraula clau %s" +msgstr "esperava identificador, per s'ha trobat paraula clau %s" #: codetoolsstrconsts:ctsidentifiernotfound msgid "identifier not found: %s" @@ -472,7 +472,7 @@ msgstr "cercle il #: codetoolsstrconsts:ctsillegalqualifier msgid "illegal qualifier %s found" -msgstr "S'ha trobat qualificador illegal %s" +msgstr "s'ha trobat qualificador illegal %s" #: codetoolsstrconsts:ctsimplementationnodenotfound msgid "implementation node not found" @@ -484,11 +484,11 @@ msgstr "directoris d'inclosos: %s" #: codetoolsstrconsts:ctsincludefilenotfound msgid "include file not found \"%s\"" -msgstr "Fitxer incls no trobat \"%s\"" +msgstr "fitxer incls no trobat \"%s\"" #: codetoolsstrconsts:ctsincompatibletypesgotexpected msgid "incompatibles types: expected \"%s\" but got \"%s\"" -msgstr "tipus incompatibles: esperat \"%s\" per trobat \"%s\"" +msgstr "tipus incompatibles: esperava \"%s\" per s'ha trobat \"%s\"" #: codetoolsstrconsts:ctsindexparameterexpectedbutatomfound msgid "index parameter expected, but %s found" @@ -508,7 +508,7 @@ msgstr "mem #: codetoolsstrconsts:ctsintfdirectory msgid "interface directory" -msgstr "" +msgstr "directori d'interfcie" #: codetoolsstrconsts:ctsinterfacesectionnotfound msgid "interface section not found" @@ -516,23 +516,23 @@ msgstr "secci #: codetoolsstrconsts:ctsinvalidclassname2 msgid "invalid class name %s%s%s" -msgstr "" +msgstr "nom de classe no vlid %s%s%s" #: codetoolsstrconsts:ctsinvalidclassname msgid "invalid class name=%s%s%s" -msgstr "" +msgstr "nom de classe no vlid=%s%s%s" #: codetoolsstrconsts:ctsinvalidflagvaluefordirective msgid "invalid flag value \"%s\" for directive %s" -msgstr "Valor de marcador \"%s\" no vlid per directiva %s" +msgstr "valor de marcador \"%s\" no vlid per directiva %s" #: codetoolsstrconsts:ctsinvalidmode msgid "invalid mode \"%s\"" -msgstr "Mode no vlid \"%s\"" +msgstr "mode no vlid \"%s\"" #: codetoolsstrconsts:ctsinvalidsubrange msgid "invalid subrange" -msgstr "subrang invlid" +msgstr "sot-abast no vlid" #: codetoolsstrconsts:ctsinvalidtype msgid "invalid type" @@ -540,11 +540,11 @@ msgstr "tipus inv #: codetoolsstrconsts:ctsinvalidvariablename msgid "invalid variable name %s%s%s" -msgstr "" +msgstr "nom de variable no vlid %s%s%s" #: codetoolsstrconsts:ctsinvalidvariabletype msgid "invalid variable type %s%s%s" -msgstr "" +msgstr "tipus de variable no vlid %s%s%s" #: codetoolsstrconsts:ctskeyword msgid "keyword" @@ -552,7 +552,7 @@ msgstr "Paraula clau" #: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound msgid "keyword (e.g. %s) expected, but %s found" -msgstr "S'esperava paraula clau (p.e.%s), per s'ha trobat %s" +msgstr "esperava paraula clau (p.e.%s), per s'ha trobat %s" #: codetoolsstrconsts:ctskeywordin msgid "keyword \"in\"" @@ -564,23 +564,23 @@ msgstr "Directori principal del Lazarus" #: codetoolsstrconsts:ctsmethodname msgid "method name" -msgstr "Nom de mtode" +msgstr "nom de mtode" #: codetoolsstrconsts:ctsmethodtypedefinitionnotfound msgid "method type definition not found" -msgstr "Definici de tipus de mtode no trobat" +msgstr "definici de tipus de mtode no trobat" #: codetoolsstrconsts:ctsmissingpointafterend msgid "missing . after end" -msgstr "Falta el punt (.) desprs de end" +msgstr "falta el punt (.) desprs de end" #: codetoolsstrconsts:ctsmissingenumlist msgid "missing enum list" -msgstr "Falta llista d'enumerats" +msgstr "falta llista d'enumerats" #: codetoolsstrconsts:ctsmissingtypeidentifier msgid "missing type identifier" -msgstr "Falta identificador de tipus" +msgstr "falta identificador de tipus" #: codetoolsstrconsts:ctsnewprocbodynotfound msgid "new proc body not found" @@ -592,11 +592,11 @@ msgstr "node sense context trobat al cursor" #: codetoolsstrconsts:ctsnopascalcodefound msgid "no pascal code found (first token is %s)" -msgstr "No es troba codi Pascal (el primer testimoni s %s)" +msgstr "no es troba codi Pascal (el primer testimoni s %s)" #: codetoolsstrconsts:ctsnonodefoundatcursor msgid "no pascal node found at cursor (i.e. in unparsed code)" -msgstr "Node no Pascal trobat al cursor." +msgstr "node no Pascal trobat al cursor. (p.e. en codi no analitzat)" #: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice msgid "nodefault specifier defined twice" @@ -604,11 +604,11 @@ msgstr "l'especificador no predeterminat s'ha definit dues vegades" #: codetoolsstrconsts:ctsoldmethodnotfound msgid "old method not found: %s" -msgstr "Mtode vell no trobat: %s" +msgstr "mtode vell no trobat: %s" #: codetoolsstrconsts:ctsprocedureorfunction msgid "procedure or function" -msgstr "Procediment o funci" +msgstr "procediment o funci" #: codetoolsstrconsts:ctsprocessorspecific msgid "processor specific" @@ -620,15 +620,15 @@ msgstr "especificador de propietat ja definit: %s" #: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound msgid "property type expected, but %s found" -msgstr "s'esperava tipus de propietat, per s'ha trobat %s" +msgstr "esperava tipus de propietat, per s'ha trobat %s" #: codetoolsstrconsts:ctsqualifierexpectedbutatomfound msgid "qualifier expected but %s found" -msgstr "s'esperava qualificador per s'ha trobat %s" +msgstr "esperava qualificador per s'ha trobat %s" #: codetoolsstrconsts:ctssemicolonnotfound msgid "semicolon not found" -msgstr "Punt i coma no trobat" +msgstr "punt i coma no trobat" #: codetoolsstrconsts:ctssetsincpathto msgid "sets IncPath to %s" @@ -640,23 +640,23 @@ msgstr "defineix SrcPath a %s" #: codetoolsstrconsts:ctssourceisnotunit msgid "source is not unit" -msgstr "el codi font no s una unitat" +msgstr "la font no s una unitat" #: codetoolsstrconsts:ctssourcenotfoundunit msgid "source not found: unit %s" -msgstr "" +msgstr "no s'ha trobat font: unitat %s" #: codetoolsstrconsts:ctssrcpathforcompiledunits msgid "src path for compiled units" -msgstr "trajectria de codi font per les unitats compilades" +msgstr "trajectria font per les unitats compilades" #: codetoolsstrconsts:ctsstringconstant msgid "string constant" -msgstr "Constant de cadena" +msgstr "constant de cadena" #: codetoolsstrconsts:ctstypeidentifier msgid "type identifier" -msgstr "identificador tipus" +msgstr "identificador de tipus" #: codetoolsstrconsts:ctstypesectionofclassnotfound msgid "type section of class not found" @@ -664,39 +664,39 @@ msgstr "secci #: codetoolsstrconsts:ctsunabletoapplychanges msgid "unable to apply changes" -msgstr "incapa d'aplicar els canvis" +msgstr "no es pot aplicar els canvis" #: codetoolsstrconsts:ctsunabletocompleteproperty msgid "unable to complete property" -msgstr "incapa de completar la propietat" +msgstr "no es pot completar la propietat" #: codetoolsstrconsts:ctsidentexpectedbuteoffound msgid "unexpected end of file (identifier expected)" -msgstr "Final de fitxer inesperat (s'esperava identificador)" +msgstr "final de fitxer inesperat (s'esperava identificador)" #: codetoolsstrconsts:ctsunexpectedendofsource msgid "unexpected end of source" -msgstr "Final de codi font inesperat" +msgstr "final de codi font inesperat" #: codetoolsstrconsts:ctsunexpectedkeyword msgid "unexpected keyword \"%s\"" -msgstr "Paraula clau inesperada \"%s\"" +msgstr "paraula clau inesperada \"%s\"" #: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards msgid "unexpected keyword \"%s\" found while reading blocks backwards" -msgstr "Paraula clau \"%S\" inesperada trobada mentre llegia blocs enrera" +msgstr "paraula clau \"%S\" inesperada trobada mentre llegia blocs enrera" #: codetoolsstrconsts:ctsunexpectedkeywordinasmblock msgid "unexpected keyword \"%s\" in asm block found" -msgstr "Paraula clau \"%s\" inesperada en bloc asm" +msgstr "paraula clau \"%s\" inesperada en bloc asm" #: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock msgid "unexpected keyword \"%s\" in begin..end found" -msgstr "Paraula clau \"%S\" inesperada a begin..end" +msgstr "paraula clau \"%S\" inesperada a begin..end" #: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound msgid "unexpected subrange operator '..' found" -msgstr "Trobat operador de subrang inesperat '..'" +msgstr "s'ha trobat operador de sot-abast '..' inesperat" #: codetoolsstrconsts:ctsunitnotfound msgid "unit not found: %s" @@ -704,7 +704,7 @@ msgstr "unitat no trobada: %s" #: codetoolsstrconsts:ctsunknownsectionkeyword msgid "unknown section keyword %s found" -msgstr "Trobada paraula clau de secci %s desconeguda" +msgstr "s'ha trobat paraula clau de secci %s desconeguda" #: codetoolsstrconsts:ctsusedunitisnotapascalunit msgid "used unit is not a pascal unit" diff --git a/components/synedit/languages/synedit.ca.po b/components/synedit/languages/synedit.ca.po index 72d33a9ea0..488431f3f2 100644 --- a/components/synedit/languages/synedit.ca.po +++ b/components/synedit/languages/synedit.ca.po @@ -4,7 +4,7 @@ msgstr "%d - %d" #: syneditstrconst:syns_filterasm68hc11 msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" -msgstr "Fitxers d'ensamblador 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" +msgstr "Fitxers d'assemblador 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" #: syneditstrconst:syns_shortcutnone msgid "" @@ -44,7 +44,7 @@ msgstr "Fitxers de mem #: syneditstrconst:syns_filtercss msgid "Cascading Stylesheets (*.css)|*.css" -msgstr "Cascading Stylesheets (*.css)|*.css" +msgstr "Fulls d'estil en cascada (*.css)|*.css" #: syneditstrconst:syns_filteradsp21xx msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" @@ -72,7 +72,7 @@ msgstr "Fitxers Galaxy (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" #: syneditstrconst:syns_filterhp msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" -msgstr "" +msgstr "Fitxers HP48 (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" #: syneditstrconst:syns_filterhp48 msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" @@ -84,7 +84,7 @@ msgstr "HTML" #: syneditstrconst:syns_filterhtml msgid "HTML Document (*.htm,*.html)|*.htm;*.html" -msgstr "Documents HTML (*.htm,*.html)|*.htm;*.html" +msgstr "Document HTML (*.htm,*.html)|*.htm;*.html" #: syneditstrconst:syns_filterini msgid "INI Files (*.ini)|*.ini" @@ -112,7 +112,7 @@ msgstr "Fitxers de formes Lazarus (*.lfm)|*.lfm" #: syneditstrconst:syns_filterbatch msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" -msgstr "Fitxers de lots MS-DOS (*.bat;*.cmd)|*.bat;*.cmd" +msgstr "Fitxers de lot MS-DOS (*.bat;*.cmd)|*.bat;*.cmd" #: syneditstrconst:syns_filtermodelica msgid "Modelica Files (*.mo)|*.mo" @@ -172,7 +172,7 @@ msgstr "Ja existeix la drecera" #: syneditstrconst:syns_filtersml msgid "Standard ML Files (*.sml)|*.sml" -msgstr "Fitxers estndard ML (*.sml)|*.sml" +msgstr "Fitxers normalitzats ML (*.sml)|*.sml" #: syneditstrconst:syns_filtertcltk msgid "Tcl/Tk Files (*.tcl)|*.tcl" @@ -180,11 +180,11 @@ msgstr "Fitxers Tcl/Tk (*.tcl)|*.tcl" #: syneditstrconst:syns_filtertex msgid "TeX Files (*.tex)|*.tex" -msgstr "" +msgstr "Fitxers TeX (*.tex)|*.tex" #: syneditstrconst:syns_duplicateshortcutmsg msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" -msgstr "La seqncia \"%s\" ja est assignat a un altre comandament d'editor. (%s)" +msgstr "La seqncia \"%s\" ja est assignada a un altre ordre d'editor. (%s)" #: syneditstrconst:syns_scrollinfofmttop msgid "Top Line: %d" @@ -192,7 +192,7 @@ msgstr "Primera l #: syneditstrconst:syns_filterunixshellscript msgid "UNIX Shell Scripts (*.sh)|*.sh" -msgstr "" +msgstr "Seqncies de l'intrpret d'ordres UNIX (*.sh)|*.sh" #: syneditstrconst:syns_filtervbscript msgid "VBScript Files (*.vbs)|*.vbs" @@ -208,5 +208,5 @@ msgstr "Document XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;* #: syneditstrconst:syns_filterx86asm msgid "x86 Assembly Files (*.asm)|*.ASM" -msgstr "Fitxers d'ensamblador x86 (*.asm)|*.ASM" +msgstr "Fitxers d'assemblador x86 (*.asm)|*.ASM" diff --git a/components/synedit/languages/synmacrorecorder.ca.po b/components/synedit/languages/synmacrorecorder.ca.po index cc32505f7f..aa858e3a9e 100644 --- a/components/synedit/languages/synmacrorecorder.ca.po +++ b/components/synedit/languages/synmacrorecorder.ca.po @@ -1,6 +1,6 @@ #: synmacrorecorder:scannotpause msgid "Can only pause when recording" -msgstr "Noms es pot pausar metre es grava" +msgstr "Noms es pot pausar mentre es grava" #: synmacrorecorder:scannotresume msgid "Can only resume when paused" @@ -8,9 +8,9 @@ msgstr "Nom #: synmacrorecorder:scannotplay msgid "Cannot playback macro when recording" -msgstr "No es pot executar una macro mentre es grava" +msgstr "No es pot executar una macroinstrucci mentre es grava" #: synmacrorecorder:scannotrecord msgid "Cannot record macro when recording" -msgstr "No es pot gravar una macro metre es grava" +msgstr "No es pot gravar una macroinstrucci metre es grava" diff --git a/languages/lazaruside.ar.po b/languages/lazaruside.ar.po index 84ed3c1b69..879af7b18e 100644 --- a/languages/lazaruside.ar.po +++ b/languages/lazaruside.ar.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" diff --git a/languages/lazaruside.ca.po b/languages/lazaruside.ca.po index ba018ced45..ee9cefcb0f 100644 --- a/languages/lazaruside.ca.po +++ b/languages/lazaruside.ca.po @@ -1,30 +1,30 @@ #: lazarusidestrconsts:lisdonotshowsplashscreen msgid " Do not show splash screen" -msgstr "" +msgstr " No mostrar pantalla flaix" #: lazarusidestrconsts:lisskiploadinglastproject msgid " Skip loading last project" -msgstr "" +msgstr " No carregar l'ltim projecte" #: lazarusidestrconsts:lisfilewheredebugoutputiswritten msgid " file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr "" +msgstr " fitxer on s'escriu la sortida de depuraci. Si no s'especifica, la sortida de depuraci s'escriu a la consola" #: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid " primary config directory, where Lazarus stores its config files. Default is " -msgstr "" +msgstr " directori de configuraci principal, on el Lazarus guarda els fitxers de configuraci. El predeterminat s " #: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor msgid " secondary config directory, where Lazarus searches for config template files. Default is " -msgstr "" +msgstr " directori de configuraci secundari, on el Lazarus busca els fitxers on hi ha les plantilles de configuraci. El predeterminat s " #: lazarusidestrconsts:srkmcommand1 msgid " command1 \"" -msgstr " command1 \"" +msgstr " ordre1 \"" #: lazarusidestrconsts:srkmcommand2 msgid " command2 \"" -msgstr " command2 \"" +msgstr " ordre2 \"" #: lazarusidestrconsts:liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " @@ -36,23 +36,23 @@ msgstr "La tecla \"%s\" ja est #: lazarusidestrconsts:srkmconflicw msgid " conflicts with " -msgstr "Conflicte amb" +msgstr "conflicte amb" #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" -msgstr "" +msgstr "%s (compilant ...)" #: lazarusidestrconsts:lisdebugging msgid "%s (debugging ...)" -msgstr "" +msgstr "%s (depurant ...)" #: lazarusidestrconsts:lisnewproject msgid "%s - (new project)" -msgstr "" +msgstr "%s - (nou projecte)" #: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "%s This file was automatically created by Lazarus. Do not edit!%s This source is only used to compile and install%s the package %s.%s" -msgstr "" +msgstr "%s Aquest fitxer ha estat creat automaticament pel Lazarus. No l'editis!%s Aquesta font noms s'utilitza per compilar i installar%s el paquet %s.%s" #: lazarusidestrconsts:lisuidbytes msgid "%s bytes" @@ -64,15 +64,15 @@ msgstr "%s directori" #: lazarusidestrconsts:lisisalreadypartoftheproject msgid "%s is already part of the Project." -msgstr "" +msgstr "%s ja forma part del Projecte." #: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 msgid "%s project directory" -msgstr "Directori del projecte %s" +msgstr "directori del projecte %s" #: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "" +msgstr "%s%s%s s un nom de projecte invlid. %s Si et plau, tria'n un altre (p.e. project1.lpi)" #: lazarusidestrconsts:lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." @@ -80,23 +80,23 @@ msgstr "%s%s%s no #: lazarusidestrconsts:lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." -msgstr "" +msgstr "%s%s%s no s un nom d'unitat vlid" #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if are sure to do that." -msgstr "" +msgstr "%s%sPrem D'ACORD si n'ests segur." #: lazarusidestrconsts:lispkgsysfilename msgid "%s%sFile Name: %s%s%s" -msgstr "" +msgstr "%s%sNom de fitxer: %s%s%s" #: lazarusidestrconsts:lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" -msgstr "" +msgstr "%s%sNom d'unitat: %s%s%s" #: lazarusidestrconsts:lispckeditpage msgid "%s, Page: %s" -msgstr "" +msgstr "%s, Pgina: %s" #: lazarusidestrconsts:liscodetoolsdefsautogenerated msgid "%s, auto generated" @@ -112,23 +112,23 @@ msgstr "%s/Nom #: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" -msgstr "" +msgstr "%sAfegint nova dependncia pel paquet %s: paquet %s%s" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" -msgstr "" +msgstr "%sAfegint nova dependncia pel projecte %s: paquet %s%s" #: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." -msgstr "" +msgstr "%sAmbds paquets estan connectats. Aix vol dir, o que un paquet utilitza l'altre o que un tercer els utilitza tots dos." #: lazarusidestrconsts:lisoipdescriptiondescription msgid "%sDescription: %s" -msgstr "" +msgstr "%sDescripci: %s" #: lazarusidestrconsts:lisa2pexistingfile msgid "%sExisting file: %s%s%s" -msgstr "" +msgstr "%sFitxer existent: %s%s%s" #: lazarusidestrconsts:dlgpasautolower msgid "%sSave As%s always saves pascal files lowercase" @@ -136,7 +136,7 @@ msgstr "%sGuardar com a %s sempre guarda els fitxers Pascal en min #: lazarusidestrconsts:dlgpasasklower msgid "%sSave As%s asks to save pascal files lowercase" -msgstr "%s Guardar com a %s demana guardar els fitxers Pascal en majscules" +msgstr "%sGuardar com a %s demana guardar els fitxers Pascal en minscules" #: lazarusidestrconsts:lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" @@ -144,27 +144,27 @@ msgstr "" #: lazarusidestrconsts:lispckexplstate msgid "%sState: " -msgstr "" +msgstr "%sEstat: " #: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "" +msgstr "%sLes segents unitats seran afegides a la secci USES de%s%s:%s%s%s" #: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" -msgstr "" +msgstr "%sAquest paquet est intallat, per no he trobat el fitxer lpk" #: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" -msgstr "" +msgstr "%sAquest paquet ha estat creat automticament" #: lazarusidestrconsts:uemaddbreakpoint msgid "&Add Breakpoint" -msgstr "" +msgstr "&Afegir punt de trencament" #: lazarusidestrconsts:uemclosepage msgid "&Close Page" -msgstr "&Tancar pgina" +msgstr "Tan&car pgina" #: lazarusidestrconsts:lismenucomponents msgid "&Components" @@ -188,7 +188,7 @@ msgstr "&Anar al marcador" #: lazarusidestrconsts:lismenuhelp msgid "&Help" -msgstr "&Ajuda" +msgstr "A&juda" #: lazarusidestrconsts:uemopenfileatcursor msgid "&Open file at cursor" @@ -204,7 +204,7 @@ msgstr "&Reempla #: lazarusidestrconsts:lismenurun msgid "&Run" -msgstr "&Executar" +msgstr "E&xecutar" #: lazarusidestrconsts:uemruntocursor msgid "&Run to Cursor" @@ -216,7 +216,7 @@ msgstr "&Buscar" #: lazarusidestrconsts:uemsetbookmark msgid "&Set Bookmark" -msgstr "&Especificar marcador" +msgstr "Especificar &marcador" #: lazarusidestrconsts:dlgtexttofing msgid "&Text to Find" @@ -224,15 +224,15 @@ msgstr "&Text a buscar" #: lazarusidestrconsts:lismenutools msgid "&Tools" -msgstr "&Eines" +msgstr "Eine&s" #: lazarusidestrconsts:lismenuview msgid "&View" -msgstr "&Visualitzar" +msgstr "&Veure" #: lazarusidestrconsts:lismenuwindows msgid "&Windows" -msgstr "&Finestres" +msgstr "F&inestres" #: lazarusidestrconsts:dlgbakdirectory msgid "(no subdirectoy)" @@ -240,43 +240,47 @@ msgstr "(no sub-directori)" #: lazarusidestrconsts:listmunknownmacro msgid "(unknown macro: %s)" -msgstr "(macro desconeguda: %s)" +msgstr "(macroinstrucci desconeguda: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts:lisctdefnovariableselected msgid "" +msgstr "" + +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "" #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "" +msgstr "Ja existeix un fitxer %s%s%s. %sEl substitueixo?" #: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" -msgstr "" +msgstr "Una unitat Pascal ha de tenir l'extensi .pp o .pas" #: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." -msgstr "" +msgstr "Un paquet necessari no ha estat trobat. Mira't la grfica de paquets" #: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." -msgstr "" +msgstr "Una eina vlida necessita al menys, ttol i nom de fitxer" #: lazarusidestrconsts:lismenuabortbuild msgid "Abort Build" -msgstr "" +msgstr "Avortar muntatge" #: lazarusidestrconsts:lismenutemplateabout msgid "About" -msgstr "" +msgstr "Quan a" #: lazarusidestrconsts:lismenuaboutlazarus msgid "About Lazarus" @@ -292,7 +296,7 @@ msgstr "Acci #: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "" +msgstr "Activar sintaxi d'expressins regulars pel texte i reemplaament (ms similar a perl)" #: lazarusidestrconsts:liscodetempladd msgid "Add" @@ -300,39 +304,39 @@ msgstr "Afegir" #: lazarusidestrconsts:lisaddtoproject msgid "Add %s to project?" -msgstr "" +msgstr "Afegir %s al projecte?" #: lazarusidestrconsts:uemaddwatchatcursor msgid "Add &Watch At Cursor" -msgstr "" +msgstr "Afegir &Vigilant al cursor" #: lazarusidestrconsts:lisa2paddfile msgid "Add File" -msgstr "" +msgstr "Afegir fitxer" #: lazarusidestrconsts:lisa2paddfiles msgid "Add Files" -msgstr "" +msgstr "Afegir fitxers" #: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" -msgstr "" +msgstr "Afegir fitxers LFM i LRS, si existeixen" #: lazarusidestrconsts:lisa2paddunit msgid "Add Unit" -msgstr "" +msgstr "Afegir unitat" #: lazarusidestrconsts:lismenuaddcurunittopkg msgid "Add active unit to a package" -msgstr "Afegir unitat activa al paquet" +msgstr "Afegir unitat activa a un paquet" #: lazarusidestrconsts:lispckeditaddanitem msgid "Add an item" -msgstr "" +msgstr "Afegir un element" #: lazarusidestrconsts:lismenuaddbreakpoint msgid "Add breakpoint" -msgstr "" +msgstr "Afegir un punt de trencament" #: lazarusidestrconsts:liscodetempladdcodetemplate msgid "Add code template" @@ -340,27 +344,27 @@ msgstr "Afegir plantilla de codi" #: lazarusidestrconsts:lismenuaddtoproject msgid "Add editor file to Project" -msgstr "" +msgstr "Afegir fitxer de l'editor al Projecte" #: lazarusidestrconsts:lisprojaddeditorfile msgid "Add editor files" -msgstr "" +msgstr "Afegir fitxers de l'editor" #: lazarusidestrconsts:lisaf2paddfiletoapackage msgid "Add file to a package" -msgstr "" +msgstr "Afegir fitxer al paquet" #: lazarusidestrconsts:lisprojaddaddfiletoproject msgid "Add file to project:" -msgstr "" +msgstr "Afegir fitxer al projecte" #: lazarusidestrconsts:lisprojaddfiles msgid "Add files" -msgstr "" +msgstr "Afegir fitxers" #: lazarusidestrconsts:lisa2paddfilestopackage msgid "Add files to package" -msgstr "" +msgstr "Afegir fitxers al paquet" #: lazarusidestrconsts:srkmecaddjumppoint msgid "Add jump point" @@ -372,23 +376,23 @@ msgstr "Afegir punt de salt a la hist #: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" -msgstr "" +msgstr "Afegir opcions als paquets i projectes dependents" #: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" -msgstr "" +msgstr "Afegir trajectries als paquets/projectes dependents" #: lazarusidestrconsts:lisa2paddtopackage msgid "Add to package" -msgstr "" +msgstr "Afegir al paquet" #: lazarusidestrconsts:lisprojaddtoproject msgid "Add to project" -msgstr "" +msgstr "Afegir al projecte" #: lazarusidestrconsts:lismenuaddwatch msgid "Add watch ..." -msgstr "" +msgstr "Afegir vigilant ..." #: lazarusidestrconsts:dlgedadd msgid "Add..." @@ -396,15 +400,15 @@ msgstr "Afegir..." #: lazarusidestrconsts:dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" -msgstr "Trajectria addicional de les fonts de tots el projectes (.pp;.pas)" +msgstr "Trajectria del codi font addicional de tots el projectes (.pp;.pas)" #: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" -msgstr "" +msgstr "Opcions addicionals del compilador heretades dels paquets" #: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "" +msgstr "Fitxers addicionals a buscar (p.e. /trajectria/*.pas;/trajec2/*.pp)" #: lazarusidestrconsts:dlgadjusttopline msgid "Adjust top line due to comment in front" @@ -416,7 +420,7 @@ msgstr "Alinear" #: lazarusidestrconsts:lisalignment msgid "Alignment" -msgstr "" +msgstr "Alineaci" #: lazarusidestrconsts:dlgallfiles msgid "All files" @@ -424,7 +428,7 @@ msgstr "Tots els fitxers" #: lazarusidestrconsts:lisedtdefallpackages msgid "All packages" -msgstr "" +msgstr "Tots els paquets" #: lazarusidestrconsts:dlglabelgoto msgid "Allow LABEL and GOTO" @@ -432,7 +436,7 @@ msgstr "Permetre LABEL i GOTO" #: lazarusidestrconsts:lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" -msgstr "" +msgstr "Permetre buscar per mltiples lnies" #: lazarusidestrconsts:dlgalphabetically msgid "Alphabetically" @@ -440,11 +444,11 @@ msgstr "Alfab #: lazarusidestrconsts:lisedtexttoolalt msgid "Alt" -msgstr "" +msgstr "Alt" #: lazarusidestrconsts:dlgaltsetclmode msgid "Alt-Key sets column mode" -msgstr "" +msgstr "La tecla alt defineix mode columna" #: lazarusidestrconsts:srkmalternkey msgid "Alternative Key" @@ -452,23 +456,23 @@ msgstr "Tecla alternativa" #: lazarusidestrconsts:lisa2pambigiousancestortype msgid "Ambigious Ancestor Type" -msgstr "" +msgstr "Tipus d'avantpassat ambigu" #: lazarusidestrconsts:lisa2pambigiousclassname msgid "Ambigious Class Name" -msgstr "" +msgstr "Nom de classe ambigu" #: lazarusidestrconsts:lisa2pambigiousunitname msgid "Ambigious Unit Name" -msgstr "" +msgstr "Nom d'unitat ambigu" #: lazarusidestrconsts:lisambigiousunitfound msgid "Ambigious Unit found" -msgstr "" +msgstr "He trobat unitat ambigua" #: lazarusidestrconsts:liscoambigiousadditionalcompilerconfigfile msgid "Ambigious additional compiler config file" -msgstr "" +msgstr "Fitxer de configuraci addicional ambigu" #: lazarusidestrconsts:dlgambigfileact msgid "Ambigious file action:" @@ -476,23 +480,23 @@ msgstr "Acci #: lazarusidestrconsts:lisambigiousfilefound msgid "Ambigious file found" -msgstr "" +msgstr "He trobat un fitxer ambigu" #: lazarusidestrconsts:lisambigiousfilefoundthisfilecanbemistakenwithdelete msgid "Ambigious file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambigious file?" -msgstr "" +msgstr "He trobat un fitxer ambigu: %s%s%s%sAquest fitxer pot ser confs amb %s%s%s%s%sEsborrar el fitxer ambigu?" #: lazarusidestrconsts:lisambigiousfilesfound msgid "Ambigious files found" -msgstr "" +msgstr "He trobat fitxers ambigus" #: lazarusidestrconsts:lispkgmangambigiousunitsfound msgid "Ambigious units found" -msgstr "" +msgstr "He trobat unitats ambiges" #: lazarusidestrconsts:lisa2pancestortype msgid "Ancestor Type" -msgstr "" +msgstr "Tipus d'avantpassat" #: lazarusidestrconsts:lismakeresstrappendtosection msgid "Append to section" @@ -508,7 +512,7 @@ msgstr "Par #: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "" +msgstr "Aplicaci%sUn programa grfic lcl/freepascal. El fitxer de programa s mantingut automticament pel Lazarus" #: lazarusidestrconsts:dlgbutapply msgid "Apply" @@ -516,11 +520,11 @@ msgstr "Aplicar" #: lazarusidestrconsts:lispckeditapplychanges msgid "Apply changes" -msgstr "" +msgstr "Aplicar canvis" #: lazarusidestrconsts:rslanguagearabic msgid "Arabic" -msgstr "" +msgstr "Arbic" #: lazarusidestrconsts:dlgcoasis msgid "As-Is" @@ -536,7 +540,7 @@ msgstr "Demanar" #: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" -msgstr "" +msgstr "Demanar abans de reemplaar cada text trobat" #: lazarusidestrconsts:liscodetoolsoptsat msgid "At" @@ -544,15 +548,15 @@ msgstr "A" #: lazarusidestrconsts:lispckoptsauthor msgid "Author:" -msgstr "" +msgstr "Autor" #: lazarusidestrconsts:dlgautoform msgid "Auto create form when opening unit" -msgstr "Crear forma automticament quan s'obri una unitat" +msgstr "Crear forma aut. quan s'obri unitat" #: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." -msgstr "Nodes auto-generats no es poden editar, %s ni poden tenir nodes fills" +msgstr "Els nodes auto-generats no es poden editar, %sni poden tenir nodes fills" #: lazarusidestrconsts:dlgautodel msgid "Auto delete file" @@ -564,11 +568,11 @@ msgstr "Els nodes generats autom #: lazarusidestrconsts:dlgautoident msgid "Auto indent" -msgstr "" +msgstr "Sagnar automticament" #: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" -msgstr "" +msgstr "Muntar de nou automticament quan es munti tot" #: lazarusidestrconsts:dlgautoren msgid "Auto rename file" @@ -584,7 +588,7 @@ msgstr "Crear autom #: lazarusidestrconsts:lispckexplautocreated msgid "AutoCreated" -msgstr "" +msgstr "AutoCreat" #: lazarusidestrconsts:rslanguageautomatic msgid "Automatic (or english)" @@ -592,15 +596,15 @@ msgstr "Autom #: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" -msgstr "" +msgstr "Incrementar la versi automticament en muntar" #: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" -msgstr "" +msgstr "Paquets installats automticament" #: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" -msgstr "" +msgstr "Muntar de nou automticament quan es necessiti" #: lazarusidestrconsts:dlgavailableforms msgid "Available forms:" @@ -608,7 +612,7 @@ msgstr "Formes disponibles:" #: lazarusidestrconsts:lisavailablepackages msgid "Available packages" -msgstr "" +msgstr "Paquets disponibles" #: lazarusidestrconsts:dlgedback msgid "Back" @@ -628,11 +632,11 @@ msgstr "C #: lazarusidestrconsts:lisbackupfilefailed msgid "Backup file failed" -msgstr "" +msgstr "Cpia de seguretat fallida" #: lazarusidestrconsts:lisfrbackwardsearch msgid "Backward search" -msgstr "" +msgstr "Recerca cap enrera" #: lazarusidestrconsts:dlgbehindmethods msgid "Behind methods" @@ -648,7 +652,7 @@ msgstr "Bloc" #: lazarusidestrconsts:dlgblockindent msgid "Block indent:" -msgstr "Sagnar bloc:" +msgstr "Sagnat bloc:" #: lazarusidestrconsts:dlgedbold msgid "Bold" @@ -660,19 +664,19 @@ msgstr "Marcador" #: lazarusidestrconsts:lisbottomspaceequally msgid "Bottom space equally" -msgstr "" +msgstr "Igualar espais inferiors" #: lazarusidestrconsts:lisbottoms msgid "Bottoms" -msgstr "" +msgstr "Inferiors" #: lazarusidestrconsts:dlgbrachighlight msgid "Bracket highlighting" -msgstr "" +msgstr "Claudtor ressaltat" #: lazarusidestrconsts:lismenubeaklinesinselection msgid "Break Lines in selection" -msgstr "" +msgstr "Interrompre lnies en la selecci" #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" @@ -684,7 +688,7 @@ msgstr "Interrompre l #: lazarusidestrconsts:lismenuviewbreakpoints msgid "BreakPoints" -msgstr "Punts de ruptura" +msgstr "Punts de trencament" #: lazarusidestrconsts:fdmbringtofront msgid "Bring to front" @@ -692,19 +696,19 @@ msgstr "Portar a primer pla" #: lazarusidestrconsts:lisa2pbrokendependencies msgid "Broken Dependencies" -msgstr "" +msgstr "Dependncies Interrompudes" #: lazarusidestrconsts:lispkgmangbrokendependency msgid "Broken dependency" -msgstr "" +msgstr "Dependncia Interrompuda" #: lazarusidestrconsts:lispatheditbrowse msgid "Browse" -msgstr "" +msgstr "Navegar" #: lazarusidestrconsts:lisbrowseforcompiler msgid "Browse for Compiler (%s)" -msgstr "" +msgstr "Navegar pel Compilador (%s)" #: lazarusidestrconsts:dlgunitdepbrowse msgid "Browse..." @@ -712,83 +716,83 @@ msgstr "Navegar..." #: lazarusidestrconsts:lismenubuild msgid "Build" -msgstr "Construir" +msgstr "Muntar" #: lazarusidestrconsts:lisbuildcodetools msgid "Build CodeTools" -msgstr "Construir CodeTools" +msgstr "Muntar les eines del codi" #: lazarusidestrconsts:lisbuildcomponent msgid "Build Component" -msgstr "Construir el component" +msgstr "Muntar el component" #: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools msgid "Build Components (SynEdit, CodeTools)" -msgstr "Construir components (SynEdit, CodeTools)" +msgstr "Muntar components (SynEdit, CodeTools)" #: lazarusidestrconsts:lisbuildexamples msgid "Build Examples" -msgstr "Construir exemples" +msgstr "Muntar exemples" #: lazarusidestrconsts:lismenubuildfile msgid "Build File" -msgstr "" +msgstr "Muntar fitxer" #: lazarusidestrconsts:lisbuildide msgid "Build IDE" -msgstr "Construir IDE" +msgstr "Muntar IDE" #: lazarusidestrconsts:lisbuildideintf msgid "Build IDE Interface" -msgstr "" +msgstr "Muntar interfcie IDE" #: lazarusidestrconsts:lisbuildjitform msgid "Build JIT Form" -msgstr "Construir forma JIT" +msgstr "Muntar forma JIT" #: lazarusidestrconsts:lislazbuildbuildjitform msgid "Build JITForm" -msgstr "Construir JITForm" +msgstr "Muntar JITForm" #: lazarusidestrconsts:lisbuildlcl msgid "Build LCL" -msgstr "Construir LCL" +msgstr "Muntar LCL" #: lazarusidestrconsts:lismenubuildlazarus msgid "Build Lazarus" -msgstr "Construir Lazarus" +msgstr "Muntar Lazarus" #: lazarusidestrconsts:lisbuildnumber msgid "Build Number" -msgstr "" +msgstr "Muntar Nmero" #: lazarusidestrconsts:lisbuildpkgreg msgid "Build Package Registration" -msgstr "Construir Package Registration" +msgstr "Muntar Registre del Paquet" #: lazarusidestrconsts:lisbuildstarter msgid "Build Starter" -msgstr "" +msgstr "Muntar Iniciador" #: lazarusidestrconsts:lisbuildsynedit msgid "Build SynEdit" -msgstr "Construir SynEdit" +msgstr "Muntar SynEdit" #: lazarusidestrconsts:lismenubuildall msgid "Build all" -msgstr "Construir Tot" +msgstr "Muntar-ho Tot" #: lazarusidestrconsts:srkmecbuildlazarus msgid "Build lazarus" -msgstr "" +msgstr "Muntar Lazarus" #: lazarusidestrconsts:lisbuildnewproject msgid "Build new project" -msgstr "" +msgstr "Muntar projecte nou" #: lazarusidestrconsts:dlgcmacro msgid "C Style Macros (global)" -msgstr "Macros estil C (global)" +msgstr "Macroinstruccions estil C (global)" #: lazarusidestrconsts:dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" @@ -804,7 +808,7 @@ msgstr "Paraula de pas de CVS" #: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" -msgstr "" +msgstr "Cridar %sRegistre%s procediment de l'unitat seleccionada" #: lazarusidestrconsts:lismenuviewcallstack msgid "Call Stack" @@ -812,19 +816,19 @@ msgstr "Cridar pila" #: lazarusidestrconsts:liscocallon msgid "Call on:" -msgstr "" +msgstr "Visitar:" #: lazarusidestrconsts:liscannotcopytoplevelcomponent msgid "Can not copy top level component." -msgstr "" +msgstr "No es pot copiar component de nivell superior." #: lazarusidestrconsts:liscannotcreatefile msgid "Can not create file %s%s%s" -msgstr "" +msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" -msgstr "" +msgstr "No es pot registrar components sense unitat" #: lazarusidestrconsts:dlgcancel msgid "Cancel" @@ -832,7 +836,7 @@ msgstr "Cancel #: lazarusidestrconsts:liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" -msgstr "" +msgstr "No es pot trobar iniciador Lazarus:%s%s" #: lazarusidestrconsts:srvk_capital msgid "Capital" @@ -848,11 +852,11 @@ msgstr "Distingir entre maj #: lazarusidestrconsts:lisfindfilecasesensitive msgid "Case sensitive" -msgstr "" +msgstr "Distingir entre majscules i minscules" #: lazarusidestrconsts:rslanguagecatalan msgid "Catalan" -msgstr "" +msgstr "Catal" #: lazarusidestrconsts:dlgcentercursorline msgid "Center Cursor Line" @@ -860,11 +864,11 @@ msgstr "Centra la l #: lazarusidestrconsts:liscenterinwindow msgid "Center in window" -msgstr "" +msgstr "Centrar a la finestra" #: lazarusidestrconsts:liscenters msgid "Centers" -msgstr "" +msgstr "Centres" #: lazarusidestrconsts:liscodetemplchange msgid "Change" @@ -872,7 +876,7 @@ msgstr "Canviar" #: lazarusidestrconsts:lischangeclass msgid "Change Class" -msgstr "" +msgstr "Canviar Classe" #: lazarusidestrconsts:lismenuinsertchangelogentry msgid "ChangeLog entry" @@ -880,11 +884,11 @@ msgstr "Entrada de registre de canvis" #: lazarusidestrconsts:lisdiskdiffchangedfiles msgid "Changed files:" -msgstr "" +msgstr "Fitxers canviats:" #: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "" +msgstr "Canviar el nom del paquet o versi, trenca dependncies. S'haurien de canviar aquestes dependncies tamb?%sSelecciona Si per canviar totes les dependncies llistades.%sSelecciona Ignorar per trencar les dependncies i continuar." #: lazarusidestrconsts:srkmecchar msgid "Char" @@ -892,11 +896,11 @@ msgstr "Car #: lazarusidestrconsts:lischaractermap msgid "Character Map" -msgstr "" +msgstr "Mapa de Carcters" #: lazarusidestrconsts:lismenuchecklfm msgid "Check LFM file in editor" -msgstr "" +msgstr "Comprova fitxer LFM en l'editor" #: lazarusidestrconsts:dlgcheckconsistency msgid "Check consistency" @@ -908,19 +912,19 @@ msgstr "Comprovacions:" #: lazarusidestrconsts:lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" -msgstr "" +msgstr "Escollir projecte Delphi (*.dpr)" #: lazarusidestrconsts:lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" -msgstr "" +msgstr "Escollir unitat Delphi (*.pas)" #: lazarusidestrconsts:lisctdefchoosedirectory msgid "Choose Directory" -msgstr "" +msgstr "Escollir Directori" #: lazarusidestrconsts:lischoosefpcsourcedir msgid "Choose FPC source directory" -msgstr "Escollir directori font del FPC" +msgstr "Escollir directori de codi font del FPC" #: lazarusidestrconsts:lischooselazarussourcedirectory msgid "Choose Lazarus Directory" @@ -928,11 +932,11 @@ msgstr "Escollir directori Lazarus" #: lazarusidestrconsts:lisedoptschoosescheme msgid "Choose Scheme" -msgstr "" +msgstr "Escollir Esquema" #: lazarusidestrconsts:lischooseadifferentname msgid "Choose a different name" -msgstr "" +msgstr "Escollir un nom diferent" #: lazarusidestrconsts:dlgchscodetempl msgid "Choose code template file (*.dci)" @@ -940,7 +944,7 @@ msgstr "Escollir fitxer de plantilla (*.dci)" #: lazarusidestrconsts:lischoosecompilerpath msgid "Choose compiler filename (%s)" -msgstr "" +msgstr "escollir nom del fitxer del compilador (%s)" #: lazarusidestrconsts:lischoosedebuggerpath msgid "Choose debugger filename" @@ -952,15 +956,15 @@ msgstr "Escollir directori" #: lazarusidestrconsts:lischoosemakepath msgid "Choose make path" -msgstr "" +msgstr "Escollir trajectria per a construir" #: lazarusidestrconsts:lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "" +msgstr "Escollir codi font del programa (*.pp, *.pas, *.lpr)" #: lazarusidestrconsts:lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" -msgstr "" +msgstr "Escollir estructura per contenir selecci" #: lazarusidestrconsts:lischoosetestbuilddir msgid "Choose the directory for tests" @@ -968,19 +972,19 @@ msgstr "Escollir el directori per les proves" #: lazarusidestrconsts:lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" -msgstr "" +msgstr "Cercle en les dependncies del paquet" #: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." -msgstr "" +msgstr "La classe %s%s%s no est registrada com a component de classe. %sNo es pot enganxar" #: lazarusidestrconsts:lisa2pclassnamealreadyexists msgid "Class Name already exists" -msgstr "" +msgstr "El nom de classe ja existeix" #: lazarusidestrconsts:lisclassnotfound msgid "Class not found" -msgstr "" +msgstr "Classe no trobada" #: lazarusidestrconsts:dlgcdtclassorder msgid "Class order" @@ -992,7 +996,7 @@ msgstr "Pol #: lazarusidestrconsts:liscldircleandirectory msgid "Clean Directory" -msgstr "" +msgstr "Netejar directori" #: lazarusidestrconsts:liscleanlazarussource msgid "Clean Lazarus Source" @@ -1000,19 +1004,19 @@ msgstr "Netejar el codi Lazarus" #: lazarusidestrconsts:lislazbuildcleanall msgid "Clean all" -msgstr "Netejar tot" +msgstr "Netejar-ho tot" #: lazarusidestrconsts:lismenucleandirectory msgid "Clean directory" -msgstr "" +msgstr "Netejar directori" #: lazarusidestrconsts:liscldircleansubdirectories msgid "Clean sub directories" -msgstr "" +msgstr "Netejar subdirectoris" #: lazarusidestrconsts:lislazbuildcleanbuild msgid "Clean+Build" -msgstr "Netejar i construir" +msgstr "Netejar i muntar" #: lazarusidestrconsts:srvk_clear msgid "Clear" @@ -1020,7 +1024,7 @@ msgstr "Netejar" #: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" -msgstr "" +msgstr "Fer un clic en els elements d'amunt per veure les diferencies" #: lazarusidestrconsts:lismenuclose msgid "Close" @@ -1036,7 +1040,7 @@ msgstr "Tancar tots els fitxers de l'editor" #: lazarusidestrconsts:dlgcodegeneration msgid "Code" -msgstr "" +msgstr "Codi" #: lazarusidestrconsts:dlgcodecreation msgid "Code Creation" @@ -1064,23 +1068,23 @@ msgstr "Plantilles del codi" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" -msgstr "" +msgstr "Editor Definicions CodeTools" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" -msgstr "CodeTools Defines Preview" +msgstr "Vista Prvia Definicions CodeTools" #: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" -msgstr "" +msgstr "Valors del Directori de CodeTools" #: lazarusidestrconsts:dlgcodetoolsopts msgid "CodeTools Options" -msgstr "" +msgstr "Opcions de CodeTools" #: lazarusidestrconsts:srkmcatcodetools msgid "CodeTools commands" -msgstr "Comandaments de les eines del codi" +msgstr "Ordres de les eines del codi" #: lazarusidestrconsts:lismenucodetoolsdefineseditor msgid "CodeTools defines editor" @@ -1092,15 +1096,15 @@ msgstr "Opcions de les eines del codi" #: lazarusidestrconsts:srkmeccodetoolsdefinesed msgid "Codetools defines editor" -msgstr "" +msgstr "Editor de definicions de CodeTools" #: lazarusidestrconsts:srkmeccodetoolsoptions msgid "Codetools options" -msgstr "" +msgstr "Opcions de CodeTools" #: lazarusidestrconsts:lismenucollectpofil msgid "Collect .po files" -msgstr "" +msgstr "Recollir fitxers .po" #: lazarusidestrconsts:liscodetoolsoptscolon msgid "Colon" @@ -1128,31 +1132,31 @@ msgstr "Coma" #: lazarusidestrconsts:srkmcommand msgid "Command " -msgstr "Comandament" +msgstr "Ordre" #: lazarusidestrconsts:liscommandafterinvalid msgid "Command after invalid" -msgstr "" +msgstr "Ordre no vlida" #: lazarusidestrconsts:liscommandafterpublishingmodule msgid "Command after publishing module" -msgstr "" +msgstr "Ordre desprs de publicar el mdul" #: lazarusidestrconsts:srkmcatcmdcmd msgid "Command commands" -msgstr "Comandaments d'instruccions" +msgstr "Ordres d'instruccions" #: lazarusidestrconsts:dlgcommandlineparams msgid "Command line parameters (without application name)" -msgstr "Parmetres de la lnia de comandaments (sense nom d'aplicaci)" +msgstr "Parmetres de la lnia d'ordres (sense nom d'aplicaci)" #: lazarusidestrconsts:liscommandlineparamsofprogram msgid "Command line parameters of program" -msgstr "Parmetres de la lnia de comandaments del programa" +msgstr "Parmetres de la lnia d'ordres del programa" #: lazarusidestrconsts:liscocommand msgid "Command:" -msgstr "" +msgstr "Ordre:" #: lazarusidestrconsts:lismenucommentselection msgid "Comment selection" @@ -1160,35 +1164,35 @@ msgstr "Comentar selecci #: lazarusidestrconsts:liscodetemplcomment msgid "Comment:" -msgstr "Comentari" +msgstr "Comentari:" #: lazarusidestrconsts:dlgcocompilation msgid "Compilation" -msgstr "" +msgstr "Compilaci" #: lazarusidestrconsts:liscocalloncompile msgid "Compile" -msgstr "" +msgstr "Compilar" #: lazarusidestrconsts:liscompileidewithoutlinking msgid "Compile IDE (without linking)" -msgstr "" +msgstr "Compilar IDE (sense enllaar)" #: lazarusidestrconsts:lispckeditcompileeverything msgid "Compile everything?" -msgstr "" +msgstr "Compilar-ho tot?" #: lazarusidestrconsts:lispckeditcompilepackage msgid "Compile package" -msgstr "" +msgstr "Compilar paquet" #: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" -msgstr "" +msgstr "Afegir CompiledSrcPath" #: lazarusidestrconsts:liscompiler msgid "Compiler" -msgstr "" +msgstr "Compilador" #: lazarusidestrconsts:dlgcompileroptions msgid "Compiler Options" @@ -1196,11 +1200,11 @@ msgstr "Opcions del compilador" #: lazarusidestrconsts:lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" -msgstr "" +msgstr "Opcions del compilador pel paquet %s" #: lazarusidestrconsts:liscompileroptionsforproject msgid "Compiler Options for Project: %s" -msgstr "" +msgstr "Opcions del compilador pel projecte: %s" #: lazarusidestrconsts:lismenucompileroptions msgid "Compiler Options..." @@ -1216,7 +1220,7 @@ msgstr "Nom del fitxer del compilador" #: lazarusidestrconsts:dlgfpcpath msgid "Compiler path (%s)" -msgstr "" +msgstr "Trajectria del compilador (%s)" #: lazarusidestrconsts:lismenucompletecode msgid "Complete Code" @@ -1224,7 +1228,7 @@ msgstr "Completar el codi" #: lazarusidestrconsts:srkmeccompletecode msgid "Complete code" -msgstr "" +msgstr "Completar el codi" #: lazarusidestrconsts:dlgcompleteproperties msgid "Complete properties" @@ -1232,19 +1236,19 @@ msgstr "Completar propietats" #: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" -msgstr "" +msgstr "La classe del component %s%s%s ja est definida" #: lazarusidestrconsts:liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" -msgstr "" +msgstr "El nom de component %s%s%s s paraula clau" #: lazarusidestrconsts:liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" -msgstr "" +msgstr "El nom de component %s%s%s no s un identificador vlid" #: lazarusidestrconsts:srkmcatcomponentsmenu msgid "Components menu commands" -msgstr "Comandaments del men de components" +msgstr "Ordres del men de components" #: lazarusidestrconsts:dlgconfigfiles msgid "Config Files:" @@ -1252,23 +1256,23 @@ msgstr "Fitxers de configuraci #: lazarusidestrconsts:lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" -msgstr "Configurar %sConstruir Lazarus%s" +msgstr "Configurar %sMuntar Lazarus%s" #: lazarusidestrconsts:lismenuconfigbuildfile msgid "Configure Build+Run File" -msgstr "" +msgstr "Configurar fitxer de muntatje/execuci" #: lazarusidestrconsts:lismenuconfigurehelp msgid "Configure Help" -msgstr "" +msgstr "Configurar ajuda" #: lazarusidestrconsts:lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" -msgstr "Configurar \"Construir Lazarus\"" +msgstr "Configurar \"Muntar Lazarus\"" #: lazarusidestrconsts:lismenuconfigcustomcomps msgid "Configure custom components" -msgstr "Configurar els components seleccionats" +msgstr "Configurar els components personalitzats" #: lazarusidestrconsts:lismenusettings msgid "Configure custom tools ..." @@ -1276,19 +1280,19 @@ msgstr "Configurar les eines personalitzades ..." #: lazarusidestrconsts:lismenueditinstallpkgs msgid "Configure installed packages" -msgstr "" +msgstr "Configurar paquets intallats" #: lazarusidestrconsts:lisconfirmchanges msgid "Confirm changes" -msgstr "" +msgstr "Confirmar canvis" #: lazarusidestrconsts:lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" -msgstr "" +msgstr "Confirmar esborrar dependncies" #: lazarusidestrconsts:lisprojinspconfirmremovingfile msgid "Confirm removing file" -msgstr "" +msgstr "Confirmar esborrar fitxer" #: lazarusidestrconsts:srkmconflic msgid "Conflict " @@ -1300,19 +1304,19 @@ msgstr "El nom del constructor ha de ser 'init' (el del destructor ha de ser 'do #: lazarusidestrconsts:lismenutemplatecontents msgid "Contents" -msgstr "" +msgstr "Contingut" #: lazarusidestrconsts:lismenucontexthelp msgid "Context sensitive Help" -msgstr "" +msgstr "Ajuda sensitiva al context" #: lazarusidestrconsts:srvk_control msgid "Control" -msgstr "Tecla de control" +msgstr "Control" #: lazarusidestrconsts:liscontrolneedsparent msgid "Control needs parent" -msgstr "" +msgstr "El control necessita pare" #: lazarusidestrconsts:lismakeresstrconversionoptions msgid "Conversion Options" @@ -1320,7 +1324,7 @@ msgstr "Opcions de conversi #: lazarusidestrconsts:lisconversionerror msgid "Conversion error" -msgstr "" +msgstr "Error de conversi" #: lazarusidestrconsts:srvk_convert msgid "Convert" @@ -1332,11 +1336,11 @@ msgstr "Convertir fitxer DFM a LFM" #: lazarusidestrconsts:lismenuconvertdelphiproject msgid "Convert Delphi Project to Lazarus Project" -msgstr "" +msgstr "Convertit projecte Delphi a projecte Lazarus" #: lazarusidestrconsts:lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit" -msgstr "" +msgstr "Convertir unitat Delphi a unitat Lazarus" #: lazarusidestrconsts:liscodetoolsdefsconvertnode msgid "Convert node" @@ -1356,15 +1360,15 @@ msgstr "Error de c #: lazarusidestrconsts:liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" -msgstr "" +msgstr "Copiar tots els missatges al porta-retalls" #: lazarusidestrconsts:liscopyerror2 msgid "Copy error" -msgstr "" +msgstr "Error de cpia" #: lazarusidestrconsts:lisdsgcopycomponents msgid "Copy selected components to clipboard" -msgstr "" +msgstr "Copiar els components seleccionats al porta-retalls" #: lazarusidestrconsts:srkmeccopy msgid "Copy selection to clipboard" @@ -1372,11 +1376,11 @@ msgstr "Copiar la selecci #: lazarusidestrconsts:dlgcopywordatcursoroncopynone msgid "Copy word on copy none" -msgstr "" +msgstr "Copiar paraula en no copiar-ne cap" #: lazarusidestrconsts:liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." -msgstr "" +msgstr "Copiar una forma sencera no est implementat." #: lazarusidestrconsts:lislgplnotice msgid "Copyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." @@ -1392,11 +1396,11 @@ msgstr "Comptador (.pp;1)" #: lazarusidestrconsts:lisnpcreate msgid "Create" -msgstr "" +msgstr "Crear" #: lazarusidestrconsts:lismenucreatepofile msgid "Create .po files" -msgstr "" +msgstr "Crear fitxers .po" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" @@ -1408,7 +1412,7 @@ msgstr "Crear definicions pel projecte %s" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcvssources msgid "Create Defines for Free Pascal CVS Sources" -msgstr "Crear definicions per les fonts del Free Pascal CVS" +msgstr "Crear definicions per les fonts CVS del Free Pascal" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" @@ -1420,63 +1424,63 @@ msgstr "Crear definicions pel directori del Lazarus" #: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" -msgstr "Crear macros FPC i trajectries per un directori de projecte FPC" +msgstr "Crear macroinstruccions FPC i trajectries per un directori de projecte FPC" #: lazarusidestrconsts:lismenueditorcreatesubmenu msgid "Create Submenu" -msgstr "" +msgstr "Crear submen" #: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "" +msgstr "Crear una nova aplicaci dgi.%sEl fitxer del programa est mantingut pel Lazarus." #: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." -msgstr "" +msgstr "Crear un nou fitxer d'editor.%sEscull-ne un tipus" #: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." -msgstr "" +msgstr "Crear un nou fitxer de text buit." #: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "" +msgstr "Crear una nova aplicaci grfica.%sEl fitxer del programa est mantingut pel Lazarus" #: lazarusidestrconsts:lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." -msgstr "" +msgstr "Crear una nova unitat Pascal." #: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram msgid "Create a new program." -msgstr "" +msgstr "Crear un nou programa." #: lazarusidestrconsts:lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "" +msgstr "Crear un nou programa.%sEl fitxer del programa est mantingut pel Lazarus." #: lazarusidestrconsts:lisnpcreateanewproject msgid "Create a new project" -msgstr "" +msgstr "Crear un nou projecte" #: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." -msgstr "" +msgstr "Crear un nou projecte.%sEscull-ne un tipus." #: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "" +msgstr "Crear un nou paquet normalitzat.%sUn paquet s una collecci d'unitats i components." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." -msgstr "" +msgstr "Crear una nova unitat amb una forma LCL." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." -msgstr "" +msgstr "Crear una nova unitat amb un mdul de dades." #: lazarusidestrconsts:liscreateaprojectfirst msgid "Create a project first!" -msgstr "" +msgstr "Crear primer un projecte!" #: lazarusidestrconsts:dlgruberbandcreationcolor msgid "Creation" @@ -1484,19 +1488,19 @@ msgstr "Creaci #: lazarusidestrconsts:lisedtexttoolctrl msgid "Ctrl" -msgstr "" +msgstr "Ctrl" #: lazarusidestrconsts:lisedtdefcurrentproject msgid "Current Project" -msgstr "" +msgstr "Projecte actual" #: lazarusidestrconsts:lisedtdefcurrentprojectdirectory msgid "Current Project Directory" -msgstr "" +msgstr "Directori del projecte actual" #: lazarusidestrconsts:lismenuinsertdatetime msgid "Current date and time" -msgstr "Data i hora actual" +msgstr "Data i hora actuals" #: lazarusidestrconsts:lismenuinsertusername msgid "Current username" @@ -1512,7 +1516,7 @@ msgstr "Columna del cursor en l'editor actual" #: lazarusidestrconsts:srkmcatcursormoving msgid "Cursor moving commands" -msgstr "Comandaments de moviment del cursor" +msgstr "Ordres de moviment del cursor" #: lazarusidestrconsts:liscursorrowincurrenteditor msgid "Cursor row in current editor" @@ -1520,7 +1524,7 @@ msgstr "L #: lazarusidestrconsts:lispckoptscustom msgid "Custom" -msgstr "" +msgstr "Personalitzat" #: lazarusidestrconsts:lismakeresstrcustomidentifier msgid "Custom Identifier" @@ -1528,19 +1532,19 @@ msgstr "Identificador personalitzat" #: lazarusidestrconsts:liscustomprogram msgid "Custom Program" -msgstr "" +msgstr "Programa personalitzat" #: lazarusidestrconsts:liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." -msgstr "" +msgstr "Programa personalitzat%sUn programa FreePascal." #: lazarusidestrconsts:liskeycatcustom msgid "Custom commands" -msgstr "" +msgstr "Ordres personalitzades" #: lazarusidestrconsts:liscustomoptions2 msgid "Custom options" -msgstr "" +msgstr "Opcions personalitzades" #: lazarusidestrconsts:rsiwpcustomposition msgid "Custom position" @@ -1548,7 +1552,7 @@ msgstr "Posici #: lazarusidestrconsts:srkmeccustomtool msgid "Custom tool %d" -msgstr "" +msgstr "Eina personalitzada %d" #: lazarusidestrconsts:lismenucut msgid "Cut" @@ -1556,7 +1560,7 @@ msgstr "Tallar" #: lazarusidestrconsts:lisdsgcutcomponents msgid "Cut selected components to clipboard" -msgstr "" +msgstr "Tallar els components seleccionats al porta-retalls" #: lazarusidestrconsts:srkmeccut msgid "Cut selection to clipboard" @@ -1564,11 +1568,11 @@ msgstr "Retallar la selecci #: lazarusidestrconsts:lishlpoptsdatabases msgid "Databases" -msgstr "" +msgstr "BaseDades" #: lazarusidestrconsts:lisdate msgid "Date" -msgstr "" +msgstr "Data" #: lazarusidestrconsts:uemdebugword msgid "Debug" @@ -1576,31 +1580,31 @@ msgstr "Depuraci #: lazarusidestrconsts:lismenuviewdebugoutput msgid "Debug output" -msgstr "Depurar sortida" +msgstr "Sortida Depuraci" #: lazarusidestrconsts:lismenudebugwindows msgid "Debug windows" -msgstr "Depurar finestres" +msgstr "Finestres Depuraci" #: lazarusidestrconsts:lismendebuggeroptions msgid "Debugger Options" -msgstr "" +msgstr "Opcions del depurador" #: lazarusidestrconsts:lisdebuggererror msgid "Debugger error" -msgstr "" +msgstr "Error del depurador" #: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "" +msgstr "Error del depurador%sAtenci!! el depurador a entrat en estat d'error%sGuarda el teu treball ara mateix!!%sPrem Stop i creua els dits ..." #: lazarusidestrconsts:lisdebuggerinvalid msgid "Debugger invalid" -msgstr "" +msgstr "Depurador invlid" #: lazarusidestrconsts:dlgcodebugpath msgid "Debugger path addition (none):" -msgstr "" +msgstr "Afegir trajectria addicional del depurador (cap):" #: lazarusidestrconsts:dlgdebugtype msgid "Debugger type and path" @@ -1616,11 +1620,11 @@ msgstr "Predeterminat" #: lazarusidestrconsts:dlgdefaulteditorfont msgid "Default editor font" -msgstr "Font de l'editor per defecte" +msgstr "Font de l'editor predeterminat" #: lazarusidestrconsts:dlgpasext msgid "Default pascal extension" -msgstr "Extensi Pascal per defecte" +msgstr "Extensi Pascal predeterminada" #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" @@ -1640,11 +1644,11 @@ msgstr "Esborrar" #: lazarusidestrconsts:lismenueditordeletefromtemplate msgid "Delete From Template..." -msgstr "" +msgstr "Esborrar desde la plantilla..." #: lazarusidestrconsts:lismenueditordeleteitem msgid "Delete Item" -msgstr "" +msgstr "Esborrar element" #: lazarusidestrconsts:srkmecdeletelastchar msgid "Delete Last Char" @@ -1652,11 +1656,11 @@ msgstr "Esborrar l' #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" -msgstr "" +msgstr "Esborrar fitxer de paquet antic?" #: lazarusidestrconsts:lisdeleteambigiousfile msgid "Delete ambigious file?" -msgstr "" +msgstr "Esborrar fitxer ambigu?" #: lazarusidestrconsts:srkmecdeletechar msgid "Delete char at cursor" @@ -1668,15 +1672,15 @@ msgstr "Esborrar l #: lazarusidestrconsts:lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" -msgstr "" +msgstr "Esborrar dependncia per %s?" #: lazarusidestrconsts:lispkgmangdeletefailed msgid "Delete failed" -msgstr "" +msgstr "Ha fallat l'eliminaci" #: lazarusidestrconsts:lisdeletefilefailed msgid "Delete file failed" -msgstr "" +msgstr "Ha fallat l'eliminaci del fitxer" #: lazarusidestrconsts:liscodetoolsdefsdeletenode msgid "Delete node" @@ -1684,11 +1688,11 @@ msgstr "Esborrar el node" #: lazarusidestrconsts:lisdeleteoldfile msgid "Delete old file %s%s%s?" -msgstr "" +msgstr "Esborrat fitxer vell %s%s%s?" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" -msgstr "" +msgstr "Esborrar fitxer de paquet vell %s%s%s?" #: lazarusidestrconsts:fdmdeleteselection msgid "Delete selection" @@ -1720,7 +1724,7 @@ msgstr "Esborrar tot el text" #: lazarusidestrconsts:lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." -msgstr "" +msgstr "Ha fallat l'eliminaci del fitxer %s%s%s." #: lazarusidestrconsts:dlgdelphi2ext msgid "Delphi 2 Extensions" @@ -1732,19 +1736,19 @@ msgstr "Compatible amb Delphi" #: lazarusidestrconsts:lisa2pdependency msgid "Dependency" -msgstr "" +msgstr "Dependncia" #: lazarusidestrconsts:lispckeditdependencyproperties msgid "Dependency Properties" -msgstr "" +msgstr "Propietats de dependncia" #: lazarusidestrconsts:lisprojadddependencyalreadyexists msgid "Dependency already exists" -msgstr "" +msgstr "Ja existeix la dependncia" #: lazarusidestrconsts:lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" -msgstr "" +msgstr "Dependncia sense propietari: %s" #: lazarusidestrconsts:lissortseldescending msgid "Descending" @@ -1756,7 +1760,7 @@ msgstr "Descripci #: lazarusidestrconsts:lispckoptsdescriptionabstract msgid "Description/Abstract" -msgstr "" +msgstr "Descripci/Abstracte" #: lazarusidestrconsts:liscodetoolsdefsdescription msgid "Description:" @@ -1764,19 +1768,19 @@ msgstr "Descripci #: lazarusidestrconsts:lisoipdescription msgid "Description: " -msgstr "" +msgstr "Descripci: " #: lazarusidestrconsts:liskeycatdesigner msgid "Designer commands" -msgstr "" +msgstr "Ordres del dissenyador" #: lazarusidestrconsts:lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" -msgstr "" +msgstr "Temps de disseny i temp d'execuci" #: lazarusidestrconsts:lispckoptsdesigntimeonly msgid "Designtime only" -msgstr "" +msgstr "Noms temps de disseny" #: lazarusidestrconsts:dlgdesktop msgid "Desktop" @@ -1788,11 +1792,11 @@ msgstr "Fitxers d'escriptori" #: lazarusidestrconsts:lisaf2pdestinationpackage msgid "Destination Package" -msgstr "" +msgstr "Paquet destinaci" #: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." -msgstr "" +msgstr "El directori de destinaci %s%s%s s incorrecte.%sSi us plau, escull una trajectria completa." #: lazarusidestrconsts:rslanguagedeutsch msgid "Deutsch" @@ -1816,7 +1820,7 @@ msgstr "El directori no existeix" #: lazarusidestrconsts:dlgtestprjdir msgid "Directory for building test projects" -msgstr "Directori per a construir projectes de prova" +msgstr "Directori per a muntar projectes de prova" #: lazarusidestrconsts:lisenvoptdlgdirectorynotfound msgid "Directory not found" @@ -1824,11 +1828,11 @@ msgstr "Directori no trobat" #: lazarusidestrconsts:lisfindfiledirectoryoptions msgid "Directory options" -msgstr "" +msgstr "Opcions del directori" #: lazarusidestrconsts:dlgeddisplay msgid "Display" -msgstr "Visualitzar" +msgstr "Veure a pantalla" #: lazarusidestrconsts:dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" @@ -1840,7 +1844,7 @@ msgstr "Mostrar n #: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" -msgstr "" +msgstr "Distingir lletres grans i petites p.e. A i a" #: lazarusidestrconsts:dlgnotsplitlinefront msgid "Do not split line In front of:" @@ -1852,7 +1856,7 @@ msgstr "No separar la l #: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" -msgstr "" +msgstr "Vols obviar tots els canvis al paquet %s i recarregar-lo del fitxer?" #: lazarusidestrconsts:rsiwpdocked msgid "Docked" @@ -1860,7 +1864,7 @@ msgstr "Amarrat" #: lazarusidestrconsts:lisdocumentationeditor msgid "Documentation Editor" -msgstr "" +msgstr "Editor de documentaci" #: lazarusidestrconsts:lissortseldomain msgid "Domain" @@ -1868,11 +1872,11 @@ msgstr "Domini" #: lazarusidestrconsts:dlgdoubleclickline msgid "Double click line" -msgstr "Lnia de doble clic" +msgstr "Fer doble clic a la lnia" #: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" -msgstr "" +msgstr "Fer doble clic en els missatges salta (cas contari: un clic)" #: lazarusidestrconsts:dlgdownword msgid "Down" @@ -1880,15 +1884,15 @@ msgstr "Avall" #: lazarusidestrconsts:dlgdragdroped msgid "Drag Drop editing" -msgstr "" +msgstr "Edici arrossegar i deixar anar" #: lazarusidestrconsts:dlgdropfiles msgid "Drop files" -msgstr "" +msgstr "Deixar anar fitxers" #: lazarusidestrconsts:lismenuenvironent msgid "E&nvironment" -msgstr "Entorn" +msgstr "E&ntorn" #: lazarusidestrconsts:liscodetoolsdefsedit msgid "Edit" @@ -1896,7 +1900,7 @@ msgstr "Editar" #: lazarusidestrconsts:lispckediteditgeneraloptions msgid "Edit General Options" -msgstr "" +msgstr "Editar opcions generals" #: lazarusidestrconsts:srkmeditkeys msgid "Edit Keys" @@ -1904,19 +1908,19 @@ msgstr "Editar tecles" #: lazarusidestrconsts:lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" -msgstr "" +msgstr "Editar opcions per compilar el paquet" #: lazarusidestrconsts:lisedtexttooledittool msgid "Edit Tool" -msgstr "" +msgstr "Editar eina" #: lazarusidestrconsts:liscodetempleditcodetemplate msgid "Edit code template" -msgstr "Edita plantilla de codi" +msgstr "Editar plantilla de codi" #: lazarusidestrconsts:srkmeditforcmd msgid "Edit keys for command" -msgstr "Editar tecles pel comandament" +msgstr "Editar tecles per l'ordre" #: lazarusidestrconsts:dlgededit msgid "Edit..." @@ -1924,7 +1928,7 @@ msgstr "Editar..." #: lazarusidestrconsts:dlgedfiles msgid "Editor files" -msgstr "Editor de fitxers" +msgstr "Fitxers de l'editor" #: lazarusidestrconsts:dlgeditorfont msgid "Editor font" @@ -1932,7 +1936,7 @@ msgstr "Font de l'editor" #: lazarusidestrconsts:dlgeditorfontheight msgid "Editor font height" -msgstr "Alada de font de l'editor" +msgstr "Alada de fonts de l'editor" #: lazarusidestrconsts:lismenueditoroptions msgid "Editor options" @@ -1956,15 +1960,15 @@ msgstr "ElseIf" #: lazarusidestrconsts:lisenclose msgid "Enclose" -msgstr "" +msgstr "Contenir" #: lazarusidestrconsts:uemencloseselection msgid "Enclose Selection" -msgstr "" +msgstr "Contenir selecci" #: lazarusidestrconsts:lismenuencloseselection msgid "Enclose selection" -msgstr "" +msgstr "Contenir selecci" #: lazarusidestrconsts:srvk_end msgid "End" @@ -1976,15 +1980,15 @@ msgstr "Angl #: lazarusidestrconsts:lismacropromptenterdata msgid "Enter data" -msgstr "" +msgstr "Entrar dades" #: lazarusidestrconsts:lismacropromptenterrunparameters msgid "Enter run parameters" -msgstr "" +msgstr "Entrar parmetres d'execuci" #: lazarusidestrconsts:lisentertransla msgid "Enter translation language" -msgstr "" +msgstr "Entrar llenguatge de traducci" #: lazarusidestrconsts:dlgentirescope msgid "Entire Scope" @@ -1996,7 +2000,7 @@ msgstr "Entorn" #: lazarusidestrconsts:srkmcatenvmenu msgid "Environment menu commands" -msgstr "Comandaments del men de l'entorn" +msgstr "Ordres del men de l'entorn" #: lazarusidestrconsts:lismenugeneraloptions msgid "Environment options" @@ -2008,27 +2012,27 @@ msgstr "Error" #: lazarusidestrconsts:lispkgmangerrorreadingpackage msgid "Error Reading Package" -msgstr "" +msgstr "Error llegint paquet" #: lazarusidestrconsts:lispkgmangerrorwritingpackage msgid "Error Writing Package" -msgstr "" +msgstr "Error escrivint paquet" #: lazarusidestrconsts:liserrorcreatingfile msgid "Error creating file" -msgstr "" +msgstr "Error creant fitxer" #: lazarusidestrconsts:liserrorcreatinglrs msgid "Error creating lrs" -msgstr "" +msgstr "Error creant lrs" #: lazarusidestrconsts:liserrordeletingfile msgid "Error deleting file" -msgstr "" +msgstr "Error esborrant fitxer" #: lazarusidestrconsts:liserrorin msgid "Error in %s" -msgstr "" +msgstr "Error a %s" #: lazarusidestrconsts:lisueerrorinregularexpression msgid "Error in regular expression" @@ -2036,15 +2040,15 @@ msgstr "Error en expressi #: lazarusidestrconsts:liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" -msgstr "" +msgstr "Error inicialitzant programa%s%s%s%s%sError: %s" #: lazarusidestrconsts:liserrormovingcomponent msgid "Error moving component" -msgstr "" +msgstr "Error movent component" #: lazarusidestrconsts:liserrormovingcomponent2 msgid "Error moving component %s:%s" -msgstr "" +msgstr "Error movent component %s:%s" #: lazarusidestrconsts:liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" @@ -2052,15 +2056,15 @@ msgstr "Error llegint %s%s%s%s%s" #: lazarusidestrconsts:lispkgmangerrorreadingfile msgid "Error reading file" -msgstr "" +msgstr "Error llegint fitxer" #: lazarusidestrconsts:lisdiskdifferrorreadingfile msgid "Error reading file: %s" -msgstr "" +msgstr "Error llegint fitxer" #: lazarusidestrconsts:liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" -msgstr "" +msgstr "Error llegint llista de paquets des del fitxer%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" @@ -2068,7 +2072,7 @@ msgstr "Error mentre llegia el fitxer d'informaci #: lazarusidestrconsts:liserrorrenamingfile msgid "Error renaming file" -msgstr "" +msgstr "Error canviant el nom del fitxer" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" @@ -2080,15 +2084,15 @@ msgstr "Error mentre escrivia informaci #: lazarusidestrconsts:lispkgmangerrorwritingfile msgid "Error writing file" -msgstr "" +msgstr "Error escrivint fitxer" #: lazarusidestrconsts:liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" -msgstr "" +msgstr "Error escrivint llista de paquest al fitxer%s%s%s%s" #: lazarusidestrconsts:liserror msgid "Error: " -msgstr "" +msgstr "Error: " #: lazarusidestrconsts:liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" @@ -2096,7 +2100,7 @@ msgstr "Error: compilador no v #: lazarusidestrconsts:liserrors msgid "Errors" -msgstr "" +msgstr "Errors" #: lazarusidestrconsts:srvk_escape msgid "Escape" @@ -2104,7 +2108,7 @@ msgstr "Escapament" #: lazarusidestrconsts:lismenuevaluate msgid "Evaluate/Modify ..." -msgstr "" +msgstr "Avaluar/Modificar ..." #: lazarusidestrconsts:srvk_execute msgid "Execute" @@ -2112,35 +2116,35 @@ msgstr "Executar" #: lazarusidestrconsts:liscoexecuteafter msgid "Execute after" -msgstr "" +msgstr "Executar desprs" #: lazarusidestrconsts:liscoexecutebefore msgid "Execute before" -msgstr "" +msgstr "Executar abans" #: lazarusidestrconsts:lisexecutingcommandafter msgid "Executing command after" -msgstr "" +msgstr "Executant ordre desprs" #: lazarusidestrconsts:lisexecutingcommandbefore msgid "Executing command befor" -msgstr "" +msgstr "Executant ordre abans" #: lazarusidestrconsts:lisexecutionpaused msgid "Execution paused" -msgstr "" +msgstr "Execuci pausada" #: lazarusidestrconsts:lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" -msgstr "" +msgstr "Execuci pausada%s Adrea: $%s%s Procediment: %s%s Fitxer: %s%s(Algun dia una finestra d'assemblador emergir aqu :)" #: lazarusidestrconsts:lisexecutionstopped msgid "Execution stopped" -msgstr "" +msgstr "Execuci aturada" #: lazarusidestrconsts:lisexecutionstoppedon msgid "Execution stopped%s" -msgstr "" +msgstr "Execuci aturada%s" #: lazarusidestrconsts:liscodetoolsdefsexit msgid "Exit" @@ -2156,11 +2160,11 @@ msgstr "Nom del fitxer est #: lazarusidestrconsts:lisexportlist msgid "Export list" -msgstr "" +msgstr "Exportar llista" #: lazarusidestrconsts:lisexttoolexternaltools msgid "External Tools" -msgstr "" +msgstr "Eines externes" #: lazarusidestrconsts:srkmecexttool msgid "External tool %d" @@ -2176,35 +2180,35 @@ msgstr "Espaiat extra entre l #: lazarusidestrconsts:lisextract msgid "Extract" -msgstr "" +msgstr "Extraure" #: lazarusidestrconsts:uemextractproc msgid "Extract Procedure" -msgstr "" +msgstr "Extraure procediment" #: lazarusidestrconsts:lismenuextractproc msgid "Extract procedure" -msgstr "" +msgstr "Extraure procediment" #: lazarusidestrconsts:liscodetoolsdefsfpccvssourcedirectory msgid "FPC CVS source directory" -msgstr "Directori CVS de les fonts del FPC" +msgstr "Directori CVS del codi font del FPC" #: lazarusidestrconsts:lisfpcsourcedirectoryerror msgid "FPC Source Directory error" -msgstr "Error al directori font del FPC" +msgstr "Error al directori del codi font del FPC" #: lazarusidestrconsts:dlgfpcsrcpath msgid "FPC source directory" -msgstr "Directori de les fonts del FPC" +msgstr "Directori del codi font del FPC" #: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." -msgstr "No trobo el directori de les fonts del FPC \"%s\"" +msgstr "No trobo el directori del codi font del FPC \"%s\"" #: lazarusidestrconsts:lisexttoolfailedtoruntool msgid "Failed to run tool" -msgstr "" +msgstr "Ha fallat executar eina" #: lazarusidestrconsts:dlgcofast msgid "Faster Code" @@ -2216,47 +2220,47 @@ msgstr "Fitxer" #: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." -msgstr "" +msgstr "El fitxer %s%s%s ja existeix en el projecte." #: lazarusidestrconsts:lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" -msgstr "" +msgstr "El fitxer %s%s%s ha canviat. El guardo?" #: lazarusidestrconsts:lisfileisvirtual msgid "File %s%s%s is virtual." -msgstr "" +msgstr "El fitxer %s%s%s s virtual." #: lazarusidestrconsts:lispkgmangfilenotfound msgid "File %s%s%s not found." -msgstr "" +msgstr "No trobo el fitxer %s%s%s." #: lazarusidestrconsts:lisfilenotfound2 msgid "File %s%s%s not found.%s" -msgstr "" +msgstr "No trobo el fitxer %s%s%s.%s" #: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "" +msgstr "No trobo el fitxer %s%s%s.%sEl vols crear?%s" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "" +msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sL'obro igualment?" #: lazarusidestrconsts:lispckeditfileproperties msgid "File Properties" -msgstr "" +msgstr "Propietats del fitxer" #: lazarusidestrconsts:lisaf2pfiletype msgid "File Type" -msgstr "" +msgstr "Tipus de fitxer" #: lazarusidestrconsts:lisa2pfilealreadyexists msgid "File already exists" -msgstr "" +msgstr "Ja existeix el fitxer" #: lazarusidestrconsts:lisa2pfilealreadyinpackage msgid "File already in package" -msgstr "" +msgstr "Ja hi ha el fitxer en el paquet" #: lazarusidestrconsts:dlgfileexts msgid "File extensions:" @@ -2264,15 +2268,15 @@ msgstr "Ext. de fitxers" #: lazarusidestrconsts:lispkgmangfileisalreadyinpackage msgid "File is already in package" -msgstr "" +msgstr "Ja hi ha el fitxer en el paquet" #: lazarusidestrconsts:lispkgmangfileisinproject msgid "File is in Project" -msgstr "" +msgstr "El fitxer s en el projecte" #: lazarusidestrconsts:lisfileisnotwritable msgid "File is not writable" -msgstr "" +msgstr "No es pot escriure en el fitxer" #: lazarusidestrconsts:uefilerocap msgid "File is readonly" @@ -2280,19 +2284,19 @@ msgstr "El fitxer #: lazarusidestrconsts:lisa2pfileisused msgid "File is used" -msgstr "" +msgstr "El fitxer est essent utilitzat" #: lazarusidestrconsts:lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" -msgstr "" +msgstr "Mscara del fitxer (*;*.*;*.bak?)" #: lazarusidestrconsts:srkmcatfilemenu msgid "File menu commands" -msgstr "Comandaments de mens de fitxers" +msgstr "Ordres de mens de fitxers" #: lazarusidestrconsts:lisa2pfilename msgid "File name:" -msgstr "" +msgstr "Nom del fitxer:" #: lazarusidestrconsts:lisrunparamsfilenotexecutable msgid "File not executable" @@ -2300,43 +2304,43 @@ msgstr "El fitxer no #: lazarusidestrconsts:lisfilenotfound msgid "File not found" -msgstr "" +msgstr "Fitxer no trobat" #: lazarusidestrconsts:lisfilenotlowercase msgid "File not lowercase" -msgstr "" +msgstr "Fitxer sense minscules" #: lazarusidestrconsts:lispkgmangfilenotsaved msgid "File not saved" -msgstr "" +msgstr "Fitxer no guardat" #: lazarusidestrconsts:lisfilenottext msgid "File not text" -msgstr "" +msgstr "Fitxer no de text" #: lazarusidestrconsts:lisa2pfilenotunit msgid "File not unit" -msgstr "" +msgstr "Fitxer no unitat" #: lazarusidestrconsts:lisa2pfilename2 msgid "Filename" -msgstr "" +msgstr "Nom de fitxer" #: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" -msgstr "" +msgstr "El nom de fitxer s diferent del nom del paquet" #: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" -msgstr "" +msgstr "El nom del fitxer est essent utilitzat per un altre paquet" #: lazarusidestrconsts:lispkgmangfilenameisusedbyproject msgid "Filename is used by project" -msgstr "" +msgstr "El nom del fitxer s utilitzat pel projecte" #: lazarusidestrconsts:lisoipfilename msgid "Filename: %s" -msgstr "" +msgstr "Nom del fitxer: %s" #: lazarusidestrconsts:dlgenvfiles msgid "Files" @@ -2352,31 +2356,31 @@ msgstr "Buscar" #: lazarusidestrconsts:lismenufindnext msgid "Find &Next" -msgstr "Buscar &Segent" +msgstr "Buscar Segent" #: lazarusidestrconsts:lismenufindprevious msgid "Find &Previous" -msgstr "Buscar &Anterior" +msgstr "Buscar Anterior" #: lazarusidestrconsts:lismenufindinfiles msgid "Find &in files" -msgstr "Buscar &als Fitxers" +msgstr "Buscar en els Fitxers" #: lazarusidestrconsts:lismenufinddeclarationatcursor msgid "Find Declaration at cursor" -msgstr "Buscar la declaraci des del cursor" +msgstr "Buscar la declaraci al cursor" #: lazarusidestrconsts:lismenufindidentifierrefs msgid "Find Identifier References" -msgstr "" +msgstr "Buscar referncies d'identificador" #: lazarusidestrconsts:lismenutemplatefindnext msgid "Find Next" -msgstr "" +msgstr "Buscar el segent" #: lazarusidestrconsts:lisfrifindreferences msgid "Find References" -msgstr "" +msgstr "Buscar referncies" #: lazarusidestrconsts:srkmecfindblockotherend msgid "Find block other end" @@ -2396,7 +2400,7 @@ msgstr "Buscar la declaraci #: lazarusidestrconsts:srkmecfindidentifierrefs msgid "Find identifier references" -msgstr "" +msgstr "Buscar referncies d'identificador" #: lazarusidestrconsts:srkmecfindinfiles msgid "Find in files" @@ -2408,7 +2412,7 @@ msgstr "Buscar el seg #: lazarusidestrconsts:lisfrifindorrenameidentifier msgid "Find or Rename Identifier" -msgstr "" +msgstr "Buscar o renombrar identificador" #: lazarusidestrconsts:lismenufindblockotherendofcodeblock msgid "Find other end of code block" @@ -2436,7 +2440,7 @@ msgstr "Buscar el text al cursor" #: lazarusidestrconsts:rslanguagefinnish msgid "Finnish" -msgstr "" +msgstr "Finlands" #: lazarusidestrconsts:rslanguagefinnishwin msgid "Finnish for MS Windows" @@ -2444,7 +2448,7 @@ msgstr "" #: lazarusidestrconsts:lisfixlfmfile msgid "Fix LFM file" -msgstr "" +msgstr "Fixar fitxer LFM" #: lazarusidestrconsts:srkmecjumptoeditor msgid "Focus to source editor" @@ -2460,11 +2464,11 @@ msgstr "Editor de forma" #: lazarusidestrconsts:lisformloaderror msgid "Form load error" -msgstr "" +msgstr "Error carregant forma" #: lazarusidestrconsts:lisformaterror msgid "Format error" -msgstr "" +msgstr "Error de format" #: lazarusidestrconsts:dlgpofroms msgid "Forms" @@ -2476,19 +2480,19 @@ msgstr "Formes..." #: lazarusidestrconsts:lisfrforwardsearch msgid "Forward search" -msgstr "" +msgstr "Recerca inversa" #: lazarusidestrconsts:lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" -msgstr "" +msgstr "No trobo el compilador Free Pascal" #: lazarusidestrconsts:lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" -msgstr "" +msgstr "No trobo el codi font del Free Pascal" #: lazarusidestrconsts:lisfreepascalsourcedirectory msgid "Freepascal source directory" -msgstr "Directori font del FreePascal" +msgstr "Directori del codi font del FreePascal" #: lazarusidestrconsts:rslanguagefrench msgid "French" @@ -2536,7 +2540,7 @@ msgstr "General" #: lazarusidestrconsts:lispckeditgeneraloptions msgid "General Options" -msgstr "" +msgstr "Opcions generals" #: lazarusidestrconsts:srkmecenvironmentoptions msgid "General environment options" @@ -2556,7 +2560,7 @@ msgstr "Generar codi pel gprof" #: lazarusidestrconsts:dlgcovalgrind msgid "Generate code for valgrind" -msgstr "" +msgstr "Generar codi per Valgrind" #: lazarusidestrconsts:dlgcogenerate msgid "Generate:" @@ -2564,7 +2568,7 @@ msgstr "Generar:" #: lazarusidestrconsts:dlggetposition msgid "Get position" -msgstr "Posici" +msgstr "Aconseguir posici" #: lazarusidestrconsts:dlgglobal msgid "Global" @@ -2572,7 +2576,7 @@ msgstr "Global" #: lazarusidestrconsts:lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" -msgstr "" +msgstr "Afegir Trajectria Font Global" #: lazarusidestrconsts:srkmecgotomarker msgid "Go to Marker %d" @@ -2596,7 +2600,7 @@ msgstr "Anar al seg #: lazarusidestrconsts:srkmecpreveditor msgid "Go to prior editor" -msgstr "Anar a l'editor primari" +msgstr "Anar a l'editor anterior" #: lazarusidestrconsts:srkmecgotoincludedirective msgid "Go to to include directive of current include file" @@ -2624,7 +2628,7 @@ msgstr "Anar a la l #: lazarusidestrconsts:srkmgrabkey msgid "Grab Key" -msgstr "Tecla de gravaci" +msgstr "Enregistrar" #: lazarusidestrconsts:dlggrabbercolor msgid "Grabber color" @@ -2640,11 +2644,11 @@ msgstr "Color de la graella" #: lazarusidestrconsts:dlggridx msgid "Grid size X" -msgstr "Tamany X" +msgstr "Tamany X de graella" #: lazarusidestrconsts:dlggridy msgid "Grid size Y" -msgstr "Tamany Y" +msgstr "Tamany Y de graella" #: lazarusidestrconsts:srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" @@ -2652,11 +2656,11 @@ msgstr "Suposar $IFDEF inexistent" #: lazarusidestrconsts:lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" -msgstr "Informar de IFDEF/ENDIF oms" +msgstr "Suposar IFDEF/ENDIF oms" #: lazarusidestrconsts:lismenuguessunclosedblock msgid "Guess unclosed block" -msgstr "Informar de bloc no tancat" +msgstr "Suposar bloc no tancat" #: lazarusidestrconsts:dlgenvlguidelines msgid "Guide lines" @@ -2672,11 +2676,11 @@ msgstr "Ample del canal" #: lazarusidestrconsts:dlghalfpagescroll msgid "Half page scroll" -msgstr "" +msgstr "Desplaar mitja pgina" #: lazarusidestrconsts:lismenueditorhandleonclickevent msgid "Handle OnClick Event" -msgstr "" +msgstr "Gestionar esdeveniment OnClick" #: lazarusidestrconsts:srvk_hanja msgid "Hanja" @@ -2684,11 +2688,11 @@ msgstr "Hanja" #: lazarusidestrconsts:lisaf2phasregisterprocedure msgid "Has Register procedure" -msgstr "" +msgstr "T procediment de registre" #: lazarusidestrconsts:lisheadercommentforclass msgid "Header comment for class" -msgstr "" +msgstr "Comentari de capalera per la classe" #: lazarusidestrconsts:dlgheapsize msgid "Heap Size" @@ -2696,7 +2700,7 @@ msgstr "Tamany del mont #: lazarusidestrconsts:rslanguagehebrew msgid "Hebrew" -msgstr "" +msgstr "Hebreu" #: lazarusidestrconsts:dlgheightpos msgid "Height:" @@ -2708,55 +2712,55 @@ msgstr "Ajuda" #: lazarusidestrconsts:lishelpcontextnotfound msgid "Help Context not found" -msgstr "" +msgstr "No trobo el context d'ajuda" #: lazarusidestrconsts:lishelpdatabasenotfound msgid "Help Database not found" -msgstr "" +msgstr "No trobo la base de dades de l'ajuda" #: lazarusidestrconsts:lishlpoptshelpoptions msgid "Help Options" -msgstr "" +msgstr "Opcions de l'ajuda" #: lazarusidestrconsts:lishelpselectorerror msgid "Help Selector Error" -msgstr "" +msgstr "Error del selector d'ajuda" #: lazarusidestrconsts:lishelpviewererror msgid "Help Viewer Error" -msgstr "" +msgstr "Error del visor d'ajuda" #: lazarusidestrconsts:lishelpviewernotfound msgid "Help Viewer not found" -msgstr "" +msgstr "No trobo el visor d'ajuda" #: lazarusidestrconsts:srkmcarhelpmenu msgid "Help menu commands" -msgstr "Comandaments del men d'ajuda" +msgstr "Ordres del men d'ajuda" #: lazarusidestrconsts:lishelpnotfound msgid "Help not found" -msgstr "" +msgstr "No trobo l'ajuda" #: lazarusidestrconsts:dlghideideonrun msgid "Hide IDE windows on run" -msgstr "" +msgstr "Amagar finestres IDE durant l'execuci" #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." -msgstr "" +msgstr "Suggeriment: La funci de la cadena del recurs de Make espera una constant de cadena.%sSi us plau, selecciona noms una expressi de cadena i torna-ho a provar." #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." -msgstr "" +msgstr "Suggeriment: La funci de la cadena del recurs de Make espera una constant de cadena.%sSi us plau, selecciona l'expressi i torna-ho a provar." #: lazarusidestrconsts:dlgedhintcommand msgid "Hint: click on the command you want to edit" -msgstr "Fes un clic al comandament que vols editar" +msgstr "Suggeriment: Fes un clic a l'ordre que vols editar" #: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "Indicaci: pots escollir la trajectria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectria del compilador" +msgstr "Suggeriment: pots escollir la trajectria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectria del compilador" #: lazarusidestrconsts:dlgpalhints msgid "Hints for component palette" @@ -2772,11 +2776,11 @@ msgstr "Inici" #: lazarusidestrconsts:lishorizontal msgid "Horizontal" -msgstr "" +msgstr "Horitzontal" #: lazarusidestrconsts:dlggridxhint msgid "Horizontal grid step size" -msgstr "" +msgstr "Tamany horitzontal del pas de la graella" #: lazarusidestrconsts:dlghostapplication msgid "Host application" @@ -2788,11 +2792,11 @@ msgstr "T'ho he dit: Encara no est #: lazarusidestrconsts:lispckoptsideintegration msgid "IDE Integration" -msgstr "" +msgstr "Integraci IDE" #: lazarusidestrconsts:lisideoptions msgid "IDE Options:" -msgstr "" +msgstr "Opcions IDE:" #: lazarusidestrconsts:uepins msgid "INS" @@ -2820,15 +2824,15 @@ msgstr "Pol #: lazarusidestrconsts:lisfriidentifier msgid "Identifier: %s" -msgstr "" +msgstr "Identificador: %s" #: lazarusidestrconsts:liscodetoolsdefsif msgid "If" -msgstr "If" +msgstr "Si" #: lazarusidestrconsts:uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "" +msgstr "Si ens pots ajudar a implementar aquesta caracterstica, escriu a lazarus@miraclec.com" #: lazarusidestrconsts:liscodetoolsdefsifdef msgid "IfDef" @@ -2856,7 +2860,7 @@ msgstr "Ignorar les difer #: lazarusidestrconsts:lisdiskdiffignorediskchanges msgid "Ignore disk changes" -msgstr "" +msgstr "Ignorar els canvis del disc" #: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" @@ -2864,7 +2868,7 @@ msgstr "Ignorar si s'han afegit o esborrat l #: lazarusidestrconsts:lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" -msgstr "Ignorar espais (carcter nova lnia no incls)" +msgstr "Ignorar espais (carcters noves lnies no inclosos)" #: lazarusidestrconsts:lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" @@ -2880,7 +2884,7 @@ msgstr "Ime Str" #: lazarusidestrconsts:lisimportlist msgid "Import list" -msgstr "" +msgstr "importar llista" #: lazarusidestrconsts:dlginfrontofmethods msgid "In front of methods" @@ -2888,7 +2892,7 @@ msgstr "Davant dels m #: lazarusidestrconsts:lispckoptsinclude msgid "Include" -msgstr "" +msgstr "Incloure" #: lazarusidestrconsts:dlgassertcode msgid "Include Assertion Code" @@ -2896,15 +2900,15 @@ msgstr "Incloure codi afirmat" #: lazarusidestrconsts:dlgcoincfiles msgid "Include Files (-Fi):" -msgstr "" +msgstr "Fitxers Include (-Fi):" #: lazarusidestrconsts:lispkgfiletypeinclude msgid "Include file" -msgstr "Fitxer incls" +msgstr "Incloure fitxer" #: lazarusidestrconsts:lisfindfileincludesubdirectories msgid "Include sub directories" -msgstr "" +msgstr "Incloure subdirectoris" #: lazarusidestrconsts:dlgincludesystemvariables msgid "Include system variables" @@ -2920,7 +2924,7 @@ msgstr "Recerca Incremental" #: lazarusidestrconsts:srkmecblockindent msgid "Indent block" -msgstr "Sagna bloc" +msgstr "Sagnar bloc" #: lazarusidestrconsts:dlgindentcodeto msgid "Indent code to" @@ -2944,7 +2948,7 @@ msgstr "Inserir" #: lazarusidestrconsts:lismenuconditionalselection msgid "Insert $IFDEF..." -msgstr "" +msgstr "Inserir $IFDEF..." #: lazarusidestrconsts:srkmecinsertcvsauthor msgid "Insert CVS keyword Author" @@ -2984,7 +2988,7 @@ msgstr "Inserir entrada de registres de canvis" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" -msgstr "inserir plantilla del compilador Delphi 5" +msgstr "Inserir plantilla del compilador Delphi 5" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" @@ -3008,15 +3012,15 @@ msgstr "Inserir plantilla del projecte Delphi 6" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" -msgstr "" +msgstr "Inserir plantilla del compilador Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" -msgstr "" +msgstr "Inserir plantilla del compilador Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" -msgstr "" +msgstr "Inserir plantilla de projecte Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcvssource msgid "Insert Free Pascal CVS Source Template" @@ -3032,7 +3036,7 @@ msgstr "Inserir plantilla del projecte Free Pascal" #: lazarusidestrconsts:lismenueditorinsertfromtemplate msgid "Insert From Template..." -msgstr "" +msgstr "Inserir desde plantilla..." #: lazarusidestrconsts:srkmecinsertgplnotice msgid "Insert GPL notice" @@ -3040,15 +3044,15 @@ msgstr "Inserir comentari GPL" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" -msgstr "" +msgstr "Inserir plantilla del compilador Kylix 3" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" -msgstr "" +msgstr "Inserir plantilla del directori Kylix 3" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" -msgstr "" +msgstr "Inserir plantilla de projecte Kylix 3" #: lazarusidestrconsts:srkmecinsertlgplnotice msgid "Insert LGPL notice" @@ -3064,11 +3068,11 @@ msgstr "Mode inserir" #: lazarusidestrconsts:lismenueditorinsertnewitemafter msgid "Insert New Item (after)" -msgstr "" +msgstr "Inserir nou element (desprs)" #: lazarusidestrconsts:lismenueditorinsertnewitembefore msgid "Insert New Item (before)" -msgstr "" +msgstr "Inserir nou element (abans)" #: lazarusidestrconsts:liscodetoolsdefsinserttemplate msgid "Insert Template" @@ -3092,11 +3096,11 @@ msgstr "Inserir nom d'usuari actual" #: lazarusidestrconsts:lismenuinsertcharacter msgid "Insert from Character Map" -msgstr "" +msgstr "Inserir desde mapa de carcters" #: lazarusidestrconsts:srkmecinsertcharacter msgid "Insert from Charactermap" -msgstr "" +msgstr "Inserir desde mapa de carcters" #: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" @@ -3112,7 +3116,7 @@ msgstr "Inserir espai despr #: lazarusidestrconsts:dlginsspacefront msgid "Insert space in front of" -msgstr "Inserir espai abans de" +msgstr "Inserir espai davant de" #: lazarusidestrconsts:lismenuinserttext msgid "Insert text" @@ -3120,55 +3124,55 @@ msgstr "Inserir text" #: lazarusidestrconsts:lismenuinspect msgid "Inspect ..." -msgstr "" +msgstr "Inspeccionar ..." #: lazarusidestrconsts:lispckeditinstall msgid "Install" -msgstr "" +msgstr "Installar" #: lazarusidestrconsts:lispckexplinstallonnextstart msgid "Install on next start" -msgstr "" +msgstr "Installar en el proper inici" #: lazarusidestrconsts:lispckeditinstallpackageintheide msgid "Install package in the IDE" -msgstr "" +msgstr "Installar el paquet en IDE" #: lazarusidestrconsts:lisinstallselection msgid "Install selection" -msgstr "" +msgstr "Installar selecci" #: lazarusidestrconsts:lispckexplinstalled msgid "Installed" -msgstr "" +msgstr "Installat" #: lazarusidestrconsts:lisinstalledpackages msgid "Installed Packages" -msgstr "" +msgstr "Paquets installats" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstall msgid "Installing the package %s will automatically install the package(s):%s%s" -msgstr "" +msgstr "Installar el paquet %s installar automticament el(s) paquet(s):%s%s" #: lazarusidestrconsts:dlgintvinsec msgid "Interval in secs" -msgstr "Interval en segons" +msgstr "Interval en seg." #: lazarusidestrconsts:lisa2pinvalidancestortype msgid "Invalid Ancestor Type" -msgstr "" +msgstr "Tipus d'avantpassat no vlid" #: lazarusidestrconsts:lisa2pinvalidcircle msgid "Invalid Circle" -msgstr "" +msgstr "Cercle no vlid" #: lazarusidestrconsts:lisa2pinvalidclassname msgid "Invalid Class Name" -msgstr "" +msgstr "Nom de classe no vlid" #: lazarusidestrconsts:lisinvalidcompilerfilename msgid "Invalid Compiler Filename" -msgstr "" +msgstr "Nom de fitxer de compilador no vlid" #: lazarusidestrconsts:lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" @@ -3176,11 +3180,11 @@ msgstr "Filtre Exclude no v #: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" -msgstr "" +msgstr "Directori del codi font de Free Pascal no vlid" #: lazarusidestrconsts:lisfriinvalididentifier msgid "Invalid Identifier" -msgstr "" +msgstr "Identificador no vlid" #: lazarusidestrconsts:lispublprojinvalidincludefilter msgid "Invalid Include filter" @@ -3188,15 +3192,15 @@ msgstr "Filtre Include no v #: lazarusidestrconsts:lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" -msgstr "" +msgstr "Versi min/max no vlida" #: lazarusidestrconsts:lisaf2pinvalidpackage msgid "Invalid Package" -msgstr "" +msgstr "Paquet no vlid" #: lazarusidestrconsts:lispkgmanginvalidpackagename2 msgid "Invalid Package Name" -msgstr "" +msgstr "Nom de paquet no vlid" #: lazarusidestrconsts:lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" @@ -3204,19 +3208,19 @@ msgstr "Identificador de Pascal no v #: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" -msgstr "Secci de cadena de recursos no vlida" +msgstr "Secci de la cadena del recurs no vlida" #: lazarusidestrconsts:lisa2pinvalidunitname msgid "Invalid Unit Name" -msgstr "" +msgstr "Nom d'unitat no vlid" #: lazarusidestrconsts:lispkgsysinvalidunitname msgid "Invalid Unitname: %s" -msgstr "" +msgstr "Nom d'unitat no vlid: %s" #: lazarusidestrconsts:lisinvalidcommand msgid "Invalid command" -msgstr "" +msgstr "Ordre invlida" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" @@ -3224,7 +3228,7 @@ msgstr "Nom de compilador no v #: lazarusidestrconsts:lispkgsysinvalidcomponentclass msgid "Invalid component class" -msgstr "" +msgstr "Classe de component no vlida" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" @@ -3232,71 +3236,71 @@ msgstr "Nom de depurador no v #: lazarusidestrconsts:lisinvaliddelete msgid "Invalid delete" -msgstr "" +msgstr "Esborrat no vlid" #: lazarusidestrconsts:lisinvaliddestinationdirectory msgid "Invalid destination directory" -msgstr "" +msgstr "Directori destinaci no vlid" #: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." -msgstr "" +msgstr "Expressi no vlida.%sSuggeriment: La funci de la cadena del recurs de Make espera una constant de cadena en un sol fitxer. Si us plau, selecciona l'expressi i torna-ho a provar." #: lazarusidestrconsts:lisa2pinvalidfile msgid "Invalid file" -msgstr "" +msgstr "Fitxer no vlid" #: lazarusidestrconsts:lispkgmanginvalidfileextension msgid "Invalid file extension" -msgstr "" +msgstr "Extensi de fitxer no vlida" #: lazarusidestrconsts:lisa2pinvalidfilename msgid "Invalid filename" -msgstr "" +msgstr "Nom de fitxer no vlid" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilename msgid "Invalid make filename" -msgstr "" +msgstr "Nom de fitxer Make no vlid" #: lazarusidestrconsts:lispckeditinvalidmaximumversion msgid "Invalid maximum version" -msgstr "" +msgstr "Versi mxima no vlida" #: lazarusidestrconsts:lispckeditinvalidminimumversion msgid "Invalid minimum version" -msgstr "" +msgstr "Versi mnima no vlida" #: lazarusidestrconsts:lisinvalidmultiselection msgid "Invalid multiselection" -msgstr "" +msgstr "Multiselecci no vlida" #: lazarusidestrconsts:fdinvalidmutliselectioncap msgid "Invalid mutliselection" -msgstr "Multi-secci no vlida" +msgstr "Multiselecci no vlida" #: lazarusidestrconsts:lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" -msgstr "" +msgstr "ID de paquet no vlida: %s%s%s" #: lazarusidestrconsts:lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" -msgstr "" +msgstr "Extensi de paquet no vlida" #: lazarusidestrconsts:lispkgmanginvalidpackagefilename msgid "Invalid package filename" -msgstr "" +msgstr "Nom de fitxer de paquet no vlid" #: lazarusidestrconsts:lispkgmanginvalidpackagename msgid "Invalid package name" -msgstr "" +msgstr "Nom de paquet no vlid" #: lazarusidestrconsts:lispckoptsinvalidpackagetype msgid "Invalid package type" -msgstr "" +msgstr "Tipus de paquet no vlid" #: lazarusidestrconsts:lisprojaddinvalidpackagename msgid "Invalid packagename" -msgstr "" +msgstr "Nom de paquet no vlid" #: lazarusidestrconsts:liscodetoolsdefsinvalidparent msgid "Invalid parent" @@ -3308,7 +3312,7 @@ msgstr "Node pare no v #: lazarusidestrconsts:lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" -msgstr "" +msgstr "Nom d'unitat pascal no vlid" #: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" @@ -3316,15 +3320,15 @@ msgstr "Node anterior no v #: lazarusidestrconsts:lisinvalidprocname msgid "Invalid proc name" -msgstr "" +msgstr "Nom de procediment no vlid" #: lazarusidestrconsts:lisinvalidprojectfilename msgid "Invalid project filename" -msgstr "" +msgstr "Nom de fitxer de projecte no vlid" #: lazarusidestrconsts:lisinvalidselection msgid "Invalid selection" -msgstr "" +msgstr "Selecci no vlida" #: lazarusidestrconsts:lissvuoinvalidvariablename msgid "Invalid variable name" @@ -3332,15 +3336,15 @@ msgstr "Nom de variable no v #: lazarusidestrconsts:lisprojaddinvalidversion msgid "Invalid version" -msgstr "" +msgstr "Versi no vlida" #: lazarusidestrconsts:ueminvertassignment msgid "Invert Assignment" -msgstr "" +msgstr "Invertir assignaci" #: lazarusidestrconsts:srkmecinvertassignment msgid "Invert assignment" -msgstr "" +msgstr "Invertir assignaci" #: lazarusidestrconsts:srvk_irregular msgid "Irregular " @@ -3348,11 +3352,11 @@ msgstr "Irregular" #: lazarusidestrconsts:rslanguageitalian msgid "Italian" -msgstr "" +msgstr "Itali" #: lazarusidestrconsts:rslanguageitalianiso msgid "Italian(ISO 8859-1)" -msgstr "" +msgstr "Itali(ISO 8859-1)" #: lazarusidestrconsts:dlgedital msgid "Italic" @@ -3372,11 +3376,11 @@ msgstr "Saltar endavant" #: lazarusidestrconsts:lismenujumptonexterror msgid "Jump to next error" -msgstr "" +msgstr "Saltar al segent error" #: lazarusidestrconsts:lismenujumptopreverror msgid "Jump to previous error" -msgstr "" +msgstr "Saltar a l'error previ" #: lazarusidestrconsts:dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" @@ -3392,11 +3396,11 @@ msgstr "Kana" #: lazarusidestrconsts:dlgkeepcaretx msgid "Keep X caret" -msgstr "" +msgstr "Mantenir intercalaci X" #: lazarusidestrconsts:liscldirkeepalltextfiles msgid "Keep all text files" -msgstr "" +msgstr "Mantenir tots els fitxers de text" #: lazarusidestrconsts:dlgcokeepvarsreg msgid "Keep certain variables in registers" @@ -3404,7 +3408,7 @@ msgstr "Mantenir certes variables als registres" #: lazarusidestrconsts:liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" -msgstr "" +msgstr "Mantenir els fitxers que coincideixin amb el filtre" #: lazarusidestrconsts:dlgforwardprocskeeporder msgid "Keep order of procedures" @@ -3416,7 +3420,7 @@ msgstr "Tecla" #: lazarusidestrconsts:dlgkeymappingscheme msgid "Key Mapping Scheme" -msgstr "Combinaci accessos rpids" +msgstr "Combinaci d'accessos rpids" #: lazarusidestrconsts:dlgkeymapping msgid "Key Mappings" @@ -3440,7 +3444,7 @@ msgstr "Opcions espec #: lazarusidestrconsts:lislclwidgettype msgid "LCL Widget Type" -msgstr "Tipus de LCL Widget" +msgstr "Tipus de giny LCL" #: lazarusidestrconsts:lislazbuildlclinterface msgid "LCL interface" @@ -3448,7 +3452,7 @@ msgstr "Interf #: lazarusidestrconsts:lislclunitpathmissing msgid "LCL unit path missing" -msgstr "" +msgstr "Falta trajectria a unitat LCL" #: lazarusidestrconsts:lispkgfiletypelfm msgid "LFM - Lazarus form text" @@ -3456,15 +3460,15 @@ msgstr "LFM - Lazarus Form Text" #: lazarusidestrconsts:lislfmfile msgid "LFM file" -msgstr "" +msgstr "Fitxer LFM" #: lazarusidestrconsts:lislfmfilecorrupt msgid "LFM file corrupt" -msgstr "" +msgstr "Fitxer LFM corrupte" #: lazarusidestrconsts:lislfmfilenotfound msgid "LFM file not found" -msgstr "" +msgstr "No trobo el fitxer LFM" #: lazarusidestrconsts:lismenuinsertlgplnotice msgid "LGPL notice" @@ -3480,7 +3484,7 @@ msgstr "Llenguatge" #: lazarusidestrconsts:dlglang msgid "Language:" -msgstr "Llenguatge" +msgstr "Llenguatge:" #: lazarusidestrconsts:dlgcdtlast msgid "Last" @@ -3492,27 +3496,23 @@ msgstr " #: lazarusidestrconsts:lislaunchingapplicationinvalid msgid "Launching application invalid" -msgstr "" +msgstr "Execuci d'aplicaci no vlida" #: lazarusidestrconsts:lislaunchingcmdline msgid "Launching target command line" -msgstr "Llanant lnia de comandaments" +msgstr "Executant lnia d'ordres destinaci" #: lazarusidestrconsts:lispkgmanglazarus msgid "Lazarus" -msgstr "" +msgstr "Lazarus" #: lazarusidestrconsts:liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" -msgstr "" +msgstr "Directori Lazarus" #: lazarusidestrconsts:lislazaruseditorv msgid "Lazarus Editor v%s" -msgstr "" - -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" +msgstr "Editor Lazarus v%s" #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" @@ -3528,7 +3528,7 @@ msgstr "Directori del Lazarus" #: lazarusidestrconsts:dlglazarusdir msgid "Lazarus directory (default for all projects)" -msgstr "Directori Lazarus (per defecte per a tots els projectes)" +msgstr "Directori Lazarus (predeterminat per a tots els projectes)" #: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." @@ -3536,11 +3536,11 @@ msgstr "No trobo el directori del Lazarus \"%s\"" #: lazarusidestrconsts:lislazarusdirectorynotfound msgid "Lazarus directory not found" -msgstr "" +msgstr "No trobo el directori Lazarus" #: lazarusidestrconsts:lisleaveemptyfo msgid "Leave empty for default .po file" -msgstr "" +msgstr "Deixar buit per omissi el fitxer .po" #: lazarusidestrconsts:srvk_left msgid "Left" @@ -3548,11 +3548,11 @@ msgstr "Esquerra" #: lazarusidestrconsts:lisleftsides msgid "Left sides" -msgstr "" +msgstr "Costats esquerres" #: lazarusidestrconsts:lisleftspaceequally msgid "Left space equally" -msgstr "" +msgstr "Igualar espai esquerra" #: lazarusidestrconsts:dlgleftpos msgid "Left:" @@ -3560,7 +3560,7 @@ msgstr "Esquerra:" #: lazarusidestrconsts:dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" -msgstr "" +msgstr "Nivell 0 (sense optimitzacions extres)" #: lazarusidestrconsts:dlglevel1opt msgid "Level 1 (Quick Optimizations)" @@ -3576,15 +3576,15 @@ msgstr "Nivell 3 (Nivell 2 + incert" #: lazarusidestrconsts:dlgcolibraries msgid "Libraries (-Fl):" -msgstr "" +msgstr "Biblioteques (-Fl):" #: lazarusidestrconsts:lispckoptslibrary msgid "Library" -msgstr "" +msgstr "Biblioteca" #: lazarusidestrconsts:lispckoptslicense msgid "License:" -msgstr "" +msgstr "llicncia:" #: lazarusidestrconsts:lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers." @@ -3612,11 +3612,11 @@ msgstr "Enlla #: lazarusidestrconsts:dlglinklibraries msgid "Link Style:" -msgstr "" +msgstr "Estil d'enllaament" #: lazarusidestrconsts:lispckoptslinker msgid "Linker" -msgstr "" +msgstr "Enllaador" #: lazarusidestrconsts:dlgcolinking msgid "Linking" @@ -3628,15 +3628,15 @@ msgstr "Carregar par #: lazarusidestrconsts:dlgcoloadsave msgid "Load/Save" -msgstr "" +msgstr "Carregar/Guardar" #: lazarusidestrconsts:lispckexplloadedpackages msgid "Loaded Packages:" -msgstr "" +msgstr "Paquets carregats:" #: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" -msgstr "" +msgstr "Carregar el paquet %s reemplaar el paquet %s%sdel fitxer %s.%sEl paquet vell est modificat.%s%sGuardar el paquet vell %s?" #: lazarusidestrconsts:dlgrunolocal msgid "Local" @@ -3656,7 +3656,7 @@ msgstr "Min #: lazarusidestrconsts:lisedtexttoolmacros msgid "Macros" -msgstr "" +msgstr "Macroinstruccions" #: lazarusidestrconsts:dlgmainmenu msgid "Main Menu" @@ -3664,51 +3664,51 @@ msgstr "Men #: lazarusidestrconsts:lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" -msgstr "" +msgstr "La unitat principal t declaracions Application.CreateForm" #: lazarusidestrconsts:lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" -msgstr "" +msgstr "La unitat principal t declaracions Application.Title" #: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" -msgstr "" +msgstr "La unitat principal t secci USES contenint totes les unitats del projecte" #: lazarusidestrconsts:lismainunitispascalsource msgid "Main Unit is Pascal Source" -msgstr "" +msgstr "La unitat principal s codi font Pascal" #: lazarusidestrconsts:lispckoptsmajor msgid "Major" -msgstr "" +msgstr "Major" #: lazarusidestrconsts:lismakeexe msgid "Make Executable" -msgstr "" +msgstr "Fer executable" #: lazarusidestrconsts:lismenumakeresourcestring msgid "Make Resource String" -msgstr "Construir cadena de recursos" +msgstr "Fer cadena del recurs" #: lazarusidestrconsts:lismakeresourcestring msgid "Make ResourceString" -msgstr "Crear cadena de recursos" +msgstr "Fer cadena del recurs" #: lazarusidestrconsts:lismakenotfound msgid "Make not found" -msgstr "" +msgstr "No trobo Make" #: lazarusidestrconsts:dlgmakepath msgid "Make path" -msgstr "" +msgstr "Trajectria de Make" #: lazarusidestrconsts:srkmecmakeresourcestring msgid "Make resource string" -msgstr "" +msgstr "Fer cadena de recursos" #: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" -msgstr "" +msgstr "Compilaci manual (mai automticament)" #: lazarusidestrconsts:dlgmargingutter msgid "Margin and gutter" @@ -3716,7 +3716,7 @@ msgstr "Marge i canal" #: lazarusidestrconsts:dlgmarkercolor msgid "Marker color" -msgstr "Marker color" +msgstr "Color del marcador" #: lazarusidestrconsts:dlgmaxlinelength msgid "Max line length:" @@ -3724,23 +3724,23 @@ msgstr "Longitud m #: lazarusidestrconsts:dlgmaxrecentfiles msgid "Max recent files" -msgstr "Nombre mxim de fitxers recents" +msgstr "Mxim de fitxers recents" #: lazarusidestrconsts:dlgmaxrecentprojs msgid "Max recent project files" -msgstr "Nombre mxim de projectes" +msgstr "Mxim de fitxers projecte recents" #: lazarusidestrconsts:lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" -msgstr "" +msgstr "Nmero mxim d'eines accedides" #: lazarusidestrconsts:lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" -msgstr "" +msgstr "Nmero de versi mxim (opcional):" #: lazarusidestrconsts:lispckeditmaximumversion msgid "Maximum Version:" -msgstr "" +msgstr "Nmero mxim de versi:" #: lazarusidestrconsts:dlgmaxcntr msgid "Maximum counter" @@ -3752,7 +3752,7 @@ msgstr "Men #: lazarusidestrconsts:lismenueditormenueditor msgid "Menu Editor" -msgstr "" +msgstr "Editor de men" #: lazarusidestrconsts:lismenuviewmessages msgid "Messages" @@ -3768,15 +3768,15 @@ msgstr "Minimitzar tot en minimitzar el principal" #: lazarusidestrconsts:lisprojaddminimumversionoptional msgid "Minimum Version (optional):" -msgstr "" +msgstr "Nmero mnim de versi (opcional):" #: lazarusidestrconsts:lispckeditminimumversion msgid "Minimum Version:" -msgstr "" +msgstr "Nmero mnim de versi:" #: lazarusidestrconsts:lispckoptsminor msgid "Minor" -msgstr "" +msgstr "Menor" #: lazarusidestrconsts:fdmmirrorhorizontal msgid "Mirror horizontal" @@ -3808,11 +3808,11 @@ msgstr "Modificat" #: lazarusidestrconsts:lispckeditmodified msgid "Modified: %s" -msgstr "" +msgstr "Modificat: %s" #: lazarusidestrconsts:lispckeditmore msgid "More ..." -msgstr "" +msgstr "Ms ..." #: lazarusidestrconsts:srvk_lbutton msgid "Mouse Button Left" @@ -3832,7 +3832,7 @@ msgstr "Enlla #: lazarusidestrconsts:lisexttoolmovedown msgid "Move Down" -msgstr "" +msgstr "Moure aball" #: lazarusidestrconsts:uemmoveeditorleft msgid "Move Editor Left" @@ -3844,15 +3844,15 @@ msgstr "Moure l'editor a la dreta" #: lazarusidestrconsts:lisexttoolmoveup msgid "Move Up" -msgstr "" +msgstr "Moure amunt" #: lazarusidestrconsts:lismenueditormoveup msgid "Move Up(left)" -msgstr "" +msgstr "Moure amunt (esquerra)" #: lazarusidestrconsts:lismenueditormovedown msgid "Move Up(right)" -msgstr "" +msgstr "More amunt (dreta)" #: lazarusidestrconsts:srkmecpagedown msgid "Move cursor down one page" @@ -3868,11 +3868,11 @@ msgstr "Moure el cursor una p #: lazarusidestrconsts:srkmeceditortop msgid "Move cursor to absolute beginning" -msgstr "Moure el cursor a l'inici" +msgstr "Moure el cursor al principi de tot" #: lazarusidestrconsts:srkmeceditorbottom msgid "Move cursor to absolute end" -msgstr "Moure el cursor al final" +msgstr "Moure el cursor al final de tot" #: lazarusidestrconsts:srkmecpagebottom msgid "Move cursor to bottom of page" @@ -3904,19 +3904,19 @@ msgstr "Moure el cursor una paraula a la dreta" #: lazarusidestrconsts:lispckeditmovedependencydown msgid "Move dependency down" -msgstr "" +msgstr "Moure la dependnncia aball" #: lazarusidestrconsts:lispckeditmovedependencyup msgid "Move dependency up" -msgstr "" +msgstr "Moure la dependncia amunt" #: lazarusidestrconsts:srkmecmoveeditorleft msgid "Move editor left" -msgstr "" +msgstr "Moure l'editor a l'esquerra" #: lazarusidestrconsts:srkmecmoveeditorright msgid "Move editor right" -msgstr "" +msgstr "Moure l'editor a la dreta" #: lazarusidestrconsts:liscodetoolsdefsmovenodedown msgid "Move node down" @@ -3936,11 +3936,11 @@ msgstr "Moure el node amunt" #: lazarusidestrconsts:lispatheditmovepathdown msgid "Move path down" -msgstr "" +msgstr "Moure la trajectria aball" #: lazarusidestrconsts:lispatheditmovepathup msgid "Move path up" -msgstr "" +msgstr "Moure la trajectria amunt" #: lazarusidestrconsts:dlgmulti msgid "Multi" @@ -3956,11 +3956,11 @@ msgstr "Components multi seleccionats han de ser d'una sola forma" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "" +msgstr "Nota: No es pot crear plantilla definida per les fonts del Free Pascal" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "" +msgstr "Nota: No es pot crear plantilla definida per les fonts del Lazarus" #: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" @@ -3972,7 +3972,7 @@ msgstr "Nota: Carregant fitxer de les opcions de CodeTools vell: " #: lazarusidestrconsts:lisnameofnewprocedure msgid "Name of new procedure" -msgstr "" +msgstr "Nom del nou procediment" #: lazarusidestrconsts:liscodetoolsdefsname msgid "Name:" @@ -3992,7 +3992,7 @@ msgstr "Nou ..." #: lazarusidestrconsts:lisa2pnewcomponent msgid "New Component" -msgstr "" +msgstr "Nou component" #: lazarusidestrconsts:lismenunewform msgid "New Form" @@ -4008,11 +4008,11 @@ msgstr "Nou projecte des del fitxer" #: lazarusidestrconsts:lisprojaddnewrequirement msgid "New Requirement" -msgstr "" +msgstr "Nou requeriment" #: lazarusidestrconsts:lismenueditornewtemplatedescription msgid "New Template Description..." -msgstr "" +msgstr "Nova descripci de plantilla ..." #: lazarusidestrconsts:lismenunewunit msgid "New Unit" @@ -4020,19 +4020,19 @@ msgstr "Nova Unitat" #: lazarusidestrconsts:lisa2pnewclassname msgid "New class name:" -msgstr "" +msgstr "Nou nom de classe:" #: lazarusidestrconsts:srkmecnewform msgid "New form" -msgstr "" +msgstr "Nova forma" #: lazarusidestrconsts:srkmecnewunit msgid "New unit" -msgstr "" +msgstr "Nova unitat" #: lazarusidestrconsts:lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" -msgstr "" +msgstr "Nova unitat no en la trajectria d'unitats" #: lazarusidestrconsts:liscodetoolsdefsnewnode msgid "NewNode" @@ -4040,7 +4040,7 @@ msgstr "Nou node" #: lazarusidestrconsts:lispkgmangnewpackage msgid "NewPackage" -msgstr "" +msgstr "Nou paquet" #: lazarusidestrconsts:liscodetoolsoptsnewline msgid "Newline" @@ -4052,23 +4052,23 @@ msgstr "Seg #: lazarusidestrconsts:lisnoresourcestringsectionfound msgid "No ResourceString Section found" -msgstr "" +msgstr "No s'ha trobat secci de la cadena del recurs" #: lazarusidestrconsts:lisnostringconstantfound msgid "No String Constant Found" -msgstr "" +msgstr "No trobo constant de cadena" #: lazarusidestrconsts:lisnochange msgid "No change" -msgstr "" +msgstr "Cap canvi" #: lazarusidestrconsts:lisnocodeselected msgid "No code selected" -msgstr "" +msgstr "No hi ha codi seleccionat" #: lazarusidestrconsts:lisnocompileroptionsinherited msgid "No compiler options inherited." -msgstr "" +msgstr "No s'han heretat opcions del compilador" #: lazarusidestrconsts:dlgednoerr msgid "No errors in key mapping found." @@ -4076,19 +4076,19 @@ msgstr "No trobo errors en els accessos r #: lazarusidestrconsts:lisnewdlgnoitemselected msgid "No item selected" -msgstr "" +msgstr "No hi ha element seleccionat" #: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." -msgstr "" +msgstr "No trobo paquet per dependncia %s%s%s.%sSi us plau, escull un paquet existent." #: lazarusidestrconsts:lisoipnopackageselected msgid "No package selected" -msgstr "" +msgstr "Cap paquet seleccionat" #: lazarusidestrconsts:lisnoprogramfilesfound msgid "No program file %s%s%s found." -msgstr "" +msgstr "No trobo el fitxer de programa %s%s%s." #: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" @@ -4108,7 +4108,7 @@ msgstr "Cap" #: lazarusidestrconsts:dlgconormal msgid "Normal Code" -msgstr "" +msgstr "Codi normal" #: lazarusidestrconsts:srkmecnormalselect msgid "Normal selection mode" @@ -4116,11 +4116,11 @@ msgstr "Mode de selecci #: lazarusidestrconsts:lisnotadelphiproject msgid "Not a Delphi project" -msgstr "" +msgstr "No un projecte Delphi" #: lazarusidestrconsts:lisnotadelphiunit msgid "Not a Delphi unit" -msgstr "" +msgstr "No una unitat Delphi" #: lazarusidestrconsts:lisuenotfound msgid "Not found" @@ -4132,7 +4132,7 @@ msgstr "Encara no est #: lazarusidestrconsts:lisnotnow msgid "Not now" -msgstr "" +msgstr "Ara no" #: lazarusidestrconsts:dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" @@ -4156,7 +4156,7 @@ msgstr "OVR" #: lazarusidestrconsts:lispckoptsobject msgid "Object" -msgstr "" +msgstr "Objecte" #: lazarusidestrconsts:lismenuviewobjectinspector msgid "Object Inspector" @@ -4164,19 +4164,19 @@ msgstr "Inspector d'objectes" #: lazarusidestrconsts:lislazbuildok msgid "Ok" -msgstr "OK" +msgstr "D'acord" #: lazarusidestrconsts:lismenuonlinehelp msgid "Online Help" -msgstr "" +msgstr "Ajuda en lnia" #: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" -msgstr "" +msgstr "L'ajuda en lnia no est implementada encara" #: lazarusidestrconsts:lisonlysearchforwholewords msgid "Only search for whole words" -msgstr "" +msgstr "Noms buscar paraules senceres" #: lazarusidestrconsts:lisdiffdlgonlyselection msgid "Only selection" @@ -4184,7 +4184,7 @@ msgstr "Selecci #: lazarusidestrconsts:lisfindfileonlytextfiles msgid "Only text files" -msgstr "" +msgstr "Noms fitxers de text" #: lazarusidestrconsts:lismenuopen msgid "Open" @@ -4196,15 +4196,15 @@ msgstr "Obrir difer #: lazarusidestrconsts:lisopenpackagefile msgid "Open Package File" -msgstr "" +msgstr "Obir fitxer de paquet" #: lazarusidestrconsts:lisopenpackage msgid "Open Package?" -msgstr "" +msgstr "Obrir paquet?" #: lazarusidestrconsts:lisctdefsopenpreview msgid "Open Preview" -msgstr "" +msgstr "Obrir vista prvia" #: lazarusidestrconsts:lismenuopenproject msgid "Open Project" @@ -4216,7 +4216,7 @@ msgstr "Obrir fitxer de projecte" #: lazarusidestrconsts:lisopenproject msgid "Open Project?" -msgstr "" +msgstr "Obrir projecte?" #: lazarusidestrconsts:lismenuopenrecent msgid "Open Recent" @@ -4240,11 +4240,11 @@ msgstr "Obrir nom del fitxer al cursor" #: lazarusidestrconsts:dlgqopenlastprj msgid "Open last project at start" -msgstr "Obre l'ltim projecte a l'iniciar" +msgstr "Obrir l'ltim projecte a l'iniciar" #: lazarusidestrconsts:lismenuopenpackage msgid "Open loaded package" -msgstr "" +msgstr "Obrir paquet carregat" #: lazarusidestrconsts:liscomppalopenpackage msgid "Open package" @@ -4252,11 +4252,11 @@ msgstr "Obrir paquet" #: lazarusidestrconsts:lismenuopenpackagefile msgid "Open package file (.lpk)" -msgstr "" +msgstr "Obrir fitxer de paquet (.lpk)" #: lazarusidestrconsts:lismenuopenpackageofcurunit msgid "Open package of current unit" -msgstr "" +msgstr "Obrir el paquet de la unitat actual" #: lazarusidestrconsts:lismenuopenrecentpkg msgid "Open recent package" @@ -4264,15 +4264,15 @@ msgstr "Obrir paquet recent" #: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile msgid "Open the package %s?%sAnswer No to load it as xml file." -msgstr "" +msgstr "Obrir el paquet %s?%sRespon No per carregar-lo com a fitxer xml." #: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile msgid "Open the project %s?%sAnswer No to load it as xml file." -msgstr "" +msgstr "Obrir el projecte %s?%sRespon No per carregar-lo com a fitxer xml." #: lazarusidestrconsts:liscomppalopenunit msgid "Open unit" -msgstr "" +msgstr "Obrir unitat" #: lazarusidestrconsts:dlgoptimiz msgid "Optimizations:" @@ -4308,11 +4308,11 @@ msgstr "Altres" #: lazarusidestrconsts:dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" -msgstr "" +msgstr "Altres fonts (fitxers .pp/.pas, noms utilitzat per l'IDE no pel compilador)" #: lazarusidestrconsts:dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" -msgstr "" +msgstr "Altres fitxers d'unitats (-Fu) (El delimitador s punt i coma):" #: lazarusidestrconsts:dlgenvotherfiles msgid "Other files" @@ -4324,7 +4324,7 @@ msgstr "Par #: lazarusidestrconsts:lispkgdefsoutputdirectory msgid "Output directory" -msgstr "" +msgstr "Directori de sortida" #: lazarusidestrconsts:dlgcooverflow msgid "Overflow" @@ -4340,111 +4340,111 @@ msgstr "Mode substituir" #: lazarusidestrconsts:lisoverwritefile msgid "Overwrite file?" -msgstr "" +msgstr "Sobrescriure el fitxer?" #: lazarusidestrconsts:lispckeditpackage msgid "Package %s" -msgstr "" +msgstr "Paquet %s" #: lazarusidestrconsts:lispckexplpackagenotfound msgid "Package %s not found" -msgstr "" +msgstr "No trobo el paquet %s" #: lazarusidestrconsts:lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" -msgstr "" +msgstr "El paquet %s%s%s ha canviat. El guardo?" #: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" -msgstr "" +msgstr "El paquet %s%s%s ha canviat.%sEl guardo?" #: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" -msgstr "" +msgstr "El paquet %s%s%s no t un directori de sortida vlid:%s%s%s%s" #: lazarusidestrconsts:lisaf2ppackagenotfound msgid "Package %s%s%s not found." -msgstr "" +msgstr "No trobo el paquet %s%s%s." #: lazarusidestrconsts:lismenupackagegraph msgid "Package Graph" -msgstr "Grfic de paquets" +msgstr "Grfica de paquets" #: lazarusidestrconsts:lisoippackagename msgid "Package Name" -msgstr "" +msgstr "Nom de paquet" #: lazarusidestrconsts:lisprojaddpackagename msgid "Package Name:" -msgstr "" +msgstr "Nom de paquet:" #: lazarusidestrconsts:lispckoptspackageoptions msgid "Package Options" -msgstr "" +msgstr "Opcions del paquet" #: lazarusidestrconsts:lispkgdefssrcdirmark msgid "Package Source Directory Mark" -msgstr "" +msgstr "Marca del Directori Font del Paquet" #: lazarusidestrconsts:lispkgmangpackageconflicts msgid "Package conflicts" -msgstr "" +msgstr "Conflicte de paquets" #: lazarusidestrconsts:lispkgsyspackagefilenotfound msgid "Package file not found" -msgstr "" +msgstr "No trobo el fitxer del paquet" #: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" -msgstr "" +msgstr "El paquet no s un paquet de temps de disseny" #: lazarusidestrconsts:lisaf2ppackageisreadonly msgid "Package is read only" -msgstr "" +msgstr "El paquet s de noms lectura" #: lazarusidestrconsts:lispkgmangpackageisrequired msgid "Package is required" -msgstr "" +msgstr "Es requereix el paquet" #: lazarusidestrconsts:lispkgmangpackagenamealreadyexists msgid "Package name already exists" -msgstr "" +msgstr "El nom de paquet ja existeix" #: lazarusidestrconsts:lispackageneedsinstallation msgid "Package needs installation" -msgstr "" +msgstr "El paquet necessita intallaci" #: lazarusidestrconsts:lisprojaddpackagenotfound msgid "Package not found" -msgstr "" +msgstr "No trobo el paquet" #: lazarusidestrconsts:lispkgmangpackage msgid "Package: %s" -msgstr "" +msgstr "Paquet: %s" #: lazarusidestrconsts:lispckoptspackagetype msgid "PackageType" -msgstr "" +msgstr "Tipus de paquet" #: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" -msgstr "" +msgstr "Els paquets han de tenir l'extensi .lpk" #: lazarusidestrconsts:lispackagestoinstallintheide msgid "Packages to install in the IDE" -msgstr "" +msgstr "Paquets per installar a l'IDE" #: lazarusidestrconsts:lisa2ppagenametoolong msgid "Page Name too long" -msgstr "" +msgstr "Nom de paquet massa llarg" #: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" -msgstr "" +msgstr "Pintar els elements dissenyats noms a l'ide (redueix sobrecrrega a ordinadors lents)" #: lazarusidestrconsts:lisa2ppalettepage msgid "Palette Page:" -msgstr "" +msgstr "Pgina de paleta:" #: lazarusidestrconsts:lissortselparagraphs msgid "Paragraphs" @@ -4452,7 +4452,7 @@ msgstr "Par #: lazarusidestrconsts:lisedtexttoolparameters msgid "Parameters:" -msgstr "" +msgstr "Parmetres:" #: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." @@ -4464,7 +4464,7 @@ msgstr "Analitzaci #: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" -msgstr "" +msgstr "Les unitats pascal han de tenir l'extensi .pp o .pas" #: lazarusidestrconsts:dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" @@ -4480,19 +4480,19 @@ msgstr "Enganxar el porta-retalls a la posici #: lazarusidestrconsts:lisdsgpastecomponents msgid "Paste selected components from clipboard" -msgstr "" +msgstr "Enganxar els components seleccionats des del porta-retalls" #: lazarusidestrconsts:lispatheditpathtemplates msgid "Path templates" -msgstr "" +msgstr "Plantilles de trajectria" #: lazarusidestrconsts:listofpcpath msgid "Path:" -msgstr "" +msgstr "Trajectria" #: lazarusidestrconsts:dlgsearchpaths msgid "Paths" -msgstr "" +msgstr "trajectries" #: lazarusidestrconsts:lisuidpathsreadonly msgid "Paths (Read Only)" @@ -4508,15 +4508,15 @@ msgstr "Tecla de pausa" #: lazarusidestrconsts:dlgpersistentcaret msgid "Persistent caret" -msgstr "" +msgstr "Intercalaci persistent" #: lazarusidestrconsts:lisplzcheckthecompilername msgid "Please check the compiler name" -msgstr "Sisplau, comprova el nom del compilador" +msgstr "Si us plau, comprova el nom del compilador" #: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory msgid "Please check the freepascal source directory" -msgstr "Sisplau, comprova el directori font de FreePascal" +msgstr "Si us plau, comprova el directori del codi font de FreePascal" #: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring msgid "Please choose a resourstring section from the list." @@ -4524,31 +4524,31 @@ msgstr "Si us plau, elegeix una secci #: lazarusidestrconsts:lispleaseopenaunitbeforerun msgid "Please open a unit before run." -msgstr "" +msgstr "Si us plau, obre una unitat abans d'executar." #: lazarusidestrconsts:srkmpresskey msgid "Please press a key ..." -msgstr "Sisplau, prem una tecla" +msgstr "Prem una tecla ..." #: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." -msgstr "" +msgstr "Si us plau, guarda el fitxer abans d'afegir-lo a un paquet." #: lazarusidestrconsts:lisoippleaseselectapackage msgid "Please select a package" -msgstr "" +msgstr "Si us plau, selecciona un paquet" #: lazarusidestrconsts:lisoippleaseselectapackagetoopen msgid "Please select a package to open" -msgstr "" +msgstr "Si us plau, selecciona un paquet per obrir" #: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." -msgstr "" +msgstr "Si us plau, primer selecciona un element." #: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." -msgstr "" +msgstr "Si us plau, selecciona codi per extraure un nou procediment/mtode." #: lazarusidestrconsts:liscodetoolsoptspoint msgid "Point" @@ -4556,15 +4556,15 @@ msgstr "Punt" #: lazarusidestrconsts:rslanguagepolish msgid "Polish" -msgstr "" +msgstr "Polons" #: lazarusidestrconsts:rslanguagepolishwin msgid "Polish(CP1250)" -msgstr "" +msgstr "Polons(CP1250)" #: lazarusidestrconsts:rslanguagepolishiso msgid "Polish(ISO 8859-2)" -msgstr "" +msgstr "Polons(ISO 8859-2)" #: lazarusidestrconsts:dlgwrdpreview msgid "Preview" @@ -4592,15 +4592,15 @@ msgstr "Prioritat" #: lazarusidestrconsts:lisprivatemethod msgid "Private Method" -msgstr "" +msgstr "Mtode privat" #: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "" +msgstr "Probablement necessites installar alguns paquets abans de continuar.%s%sAvs:%sEl projecte depn d'alguns paquets, el quals contenen unitats amb el procediment de registre. El procediment de registre s'utilitza normalment per installar components a l'IDE. Per les segents unitats pertanyen a paquets que encara no estan installats a l'IDE. Si intentes obrir una forma a l'IDE, aix utilitza aquests components, obtindrs errors de falta de components i la crrega de la forma segurament et donar resultats indesitjats.%s%sAix no cause impacte en obrir el projecte o les seves fonts.%s%sNoms vol dir: s una mala idea obrir les formes per dissenyar, abans installa els paquets que falten.%s%s" #: lazarusidestrconsts:lisprocedure msgid "Procedure" -msgstr "" +msgstr "Procediment" #: lazarusidestrconsts:dlgforwardprocsinsertpolicy msgid "Procedure insert policy" @@ -4608,27 +4608,27 @@ msgstr "Pol #: lazarusidestrconsts:lisprocedurewithinterface msgid "Procedure with interface" -msgstr "" +msgstr "Procediment amb interfcie" #: lazarusidestrconsts:lisprogram msgid "Program" -msgstr "" +msgstr "programa" #: lazarusidestrconsts:lisprogramdetected msgid "Program detected" -msgstr "" +msgstr "Programa detectat" #: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "" +msgstr "El codi font del programa han de tenir una extensi pascal com .pas, .pp o .lpr" #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "" +msgstr "Programa%sUn programa FreePascal. El fitxer del programa s mantingut automaticament pel Lazarus." #: lazarusidestrconsts:lisedtexttoolprogramfilename msgid "Programfilename:" -msgstr "" +msgstr "Nom de programa:" #: lazarusidestrconsts:dlgenvproject msgid "Project" @@ -4636,11 +4636,11 @@ msgstr "Projecte" #: lazarusidestrconsts:lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built. :)" -msgstr "" +msgstr "El projecte %s%s%s ha estat muntat amb xit. :)" #: lazarusidestrconsts:lisedtdefprojectincpath msgid "Project IncPath" -msgstr "" +msgstr "IncPath del projecte" #: lazarusidestrconsts:lisprojectincpath msgid "Project Include Path" @@ -4652,7 +4652,7 @@ msgstr "Inspector del projecte" #: lazarusidestrconsts:lisprojinspprojectinspector msgid "Project Inspector - %s" -msgstr "" +msgstr "Inspector del projecte - %s" #: lazarusidestrconsts:dlgprojectoptions msgid "Project Options" @@ -4664,11 +4664,11 @@ msgstr "Opcions del projecte..." #: lazarusidestrconsts:lisprojectsrcpath msgid "Project Src Path" -msgstr "Trajectria de les fonts del projecte" +msgstr "Trajectria del codi font del projecte" #: lazarusidestrconsts:lisedtdefprojectsrcpath msgid "Project SrcPath" -msgstr "" +msgstr "Trajectria del codi font del projecte" #: lazarusidestrconsts:lisprojectunitpath msgid "Project Unit Path" @@ -4676,7 +4676,7 @@ msgstr "Traject #: lazarusidestrconsts:lisedtdefprojectunitpath msgid "Project UnitPath" -msgstr "" +msgstr "Trajectria de les unitats del projecte" #: lazarusidestrconsts:lisprojectchanged msgid "Project changed" @@ -4696,19 +4696,19 @@ msgstr "Fitxers de projecte" #: lazarusidestrconsts:lisprojectinfofiledetected msgid "Project info file detected" -msgstr "" +msgstr "S'ha detectat fitxer d'informac del projecte" #: lazarusidestrconsts:lisprojectisrunnable msgid "Project is runnable" -msgstr "" +msgstr "El projecte s executable" #: lazarusidestrconsts:srkmcatprojectmenu msgid "Project menu commands" -msgstr "Comandaments del men del projecte" +msgstr "Ordres del men del projecte" #: lazarusidestrconsts:lispkgmangproject msgid "Project: %s" -msgstr "" +msgstr "Projecte: %s" #: lazarusidestrconsts:dlgpromptonreplace msgid "Prompt On Replace" @@ -4720,7 +4720,7 @@ msgstr "Demanar valor" #: lazarusidestrconsts:lishlpoptsproperties msgid "Properties:" -msgstr "" +msgstr "Propietats:" #: lazarusidestrconsts:dlgpropertycompletion msgid "Property completion" @@ -4728,15 +4728,15 @@ msgstr "Omplir propietats" #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" -msgstr "" +msgstr "Mtode protegit" #: lazarusidestrconsts:lispublicmethod msgid "Public Method" -msgstr "" +msgstr "Mtode pblic" #: lazarusidestrconsts:lispkgeditpublishpackage msgid "Publish Package" -msgstr "" +msgstr "Publicar paquet" #: lazarusidestrconsts:lismenupublishproject msgid "Publish Project" @@ -4744,11 +4744,11 @@ msgstr "Publicar projecte" #: lazarusidestrconsts:lispublishprojdir msgid "Publish project directory" -msgstr "Directori de publicaci del projecte" +msgstr "Publicaci del directori del projecte" #: lazarusidestrconsts:lispublishedmethod msgid "Published Method" -msgstr "" +msgstr "Mtode publicat" #: lazarusidestrconsts:lismenuquicksyntaxcheck msgid "Quick syntax check" @@ -4764,19 +4764,19 @@ msgstr "Abast" #: lazarusidestrconsts:lispckeditreadddependency msgid "Re-Add dependency" -msgstr "" +msgstr "Afegir de nou la dependncia" #: lazarusidestrconsts:lispckeditreaddfile msgid "Re-Add file" -msgstr "" +msgstr "Afegir de nou el fitxer" #: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" -msgstr "" +msgstr "Tornar a compilar aquest i tots el paquets requerits?" #: lazarusidestrconsts:lisreaderror msgid "Read Error" -msgstr "" +msgstr "Error de lectura" #: lazarusidestrconsts:uemreadonly msgid "Read Only" @@ -4784,7 +4784,7 @@ msgstr "Nom #: lazarusidestrconsts:lispckeditreadonly msgid "Read Only: %s" -msgstr "" +msgstr "Noms de lectura: %s" #: lazarusidestrconsts:liscodetoolsdefsreaderror msgid "Read error" @@ -4800,15 +4800,15 @@ msgstr "Nom #: lazarusidestrconsts:lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" -msgstr "" +msgstr "Muntar de nou el Lazarus?" #: lazarusidestrconsts:lispckeditrecompileallrequired msgid "Recompile all required" -msgstr "" +msgstr "Es requereix recompilar tot" #: lazarusidestrconsts:lispckeditrecompileclean msgid "Recompile clean" -msgstr "" +msgstr "Recompilar en net" #: lazarusidestrconsts:lismenuredo msgid "Redo" @@ -4816,11 +4816,11 @@ msgstr "Refer" #: lazarusidestrconsts:lisfepaintdesigneritemsonidle msgid "Reduce designer painting" -msgstr "" +msgstr "Reduir pintura del disseny" #: lazarusidestrconsts:uemrefactor msgid "Refactoring" -msgstr "" +msgstr "Tornar a factoritzar" #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" @@ -4832,23 +4832,23 @@ msgstr "Refrescar elements ToDo" #: lazarusidestrconsts:lispkgsysregisterprocedureisnil msgid "Register procedure is nil" -msgstr "" +msgstr "El procediment del registre s NIL" #: lazarusidestrconsts:lispckeditregisterunit msgid "Register unit" -msgstr "" +msgstr "Registrar unitat" #: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." -msgstr "" +msgstr "S'ha cridat RegisterUnit, per no hi ha cap paquet registrant." #: lazarusidestrconsts:lispckeditregisteredplugins msgid "Registered plugins" -msgstr "" +msgstr "Connectors registrats" #: lazarusidestrconsts:lispkgsysregistrationerror msgid "Registration Error" -msgstr "" +msgstr "Error de registraci" #: lazarusidestrconsts:dlgregularexpressions msgid "Regular Expressions" @@ -4856,55 +4856,55 @@ msgstr "Expressions regulars" #: lazarusidestrconsts:lisfindfileregularexpressions msgid "Regular expressions" -msgstr "" +msgstr "Expressions regulars" #: lazarusidestrconsts:lispckoptsrelease msgid "Release" -msgstr "" +msgstr "Llenar" #: lazarusidestrconsts:lisdiskdiffrevertall msgid "Reload from disk" -msgstr "" +msgstr "Tornar a carregar del disc" #: lazarusidestrconsts:lisexttoolremove msgid "Remove" -msgstr "" +msgstr "Esborrar" #: lazarusidestrconsts:lispckeditremovedependency2 msgid "Remove Dependency?" -msgstr "" +msgstr "Esborrar dependncia?" #: lazarusidestrconsts:lisremoveallinvalidproperties msgid "Remove all invalid properties" -msgstr "" +msgstr "Esborrar totes les propietats no vlides" #: lazarusidestrconsts:lispckeditremovedependency msgid "Remove dependency" -msgstr "" +msgstr "Esborrar dependncia" #: lazarusidestrconsts:lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" -msgstr "" +msgstr "Esborrar dependncia %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts:lispckeditremovefile msgid "Remove file" -msgstr "" +msgstr "Esborrar fitxer" #: lazarusidestrconsts:lisprojinspremovefilefromproject msgid "Remove file %s from project?" -msgstr "" +msgstr "Esborrar el fitxer %s del projecte?" #: lazarusidestrconsts:lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "" +msgstr "Esborrar el fitxer %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts:lispckeditremovefile2 msgid "Remove file?" -msgstr "" +msgstr "Esborrar el fitxer?" #: lazarusidestrconsts:liscldirremovefilesmatchingfilter msgid "Remove files matching filter" -msgstr "" +msgstr "Esborrar els fitxers que concordin amb el filtre" #: lazarusidestrconsts:lismenuremovefromproject msgid "Remove from Project" @@ -4912,59 +4912,59 @@ msgstr "Esborrar del projecte" #: lazarusidestrconsts:lisremovefromproject msgid "Remove from project" -msgstr "" +msgstr "Esborrar del projecte" #: lazarusidestrconsts:lispckeditremoveselecteditem msgid "Remove selected item" -msgstr "" +msgstr "Esborrar element seleccionat" #: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" -msgstr "" +msgstr "Fitxers esborrats (aquestes entrades no estan guardades en el fitxer lpk)" #: lazarusidestrconsts:lisprojinspremovedrequiredpackages msgid "Removed required packages" -msgstr "" +msgstr "Paquets requerits esborrats" #: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" -msgstr "" +msgstr "Paquets requerits esborrats (aquestes entrades no estan guardades en el fitxer lpk" #: lazarusidestrconsts:lisfrirename msgid "Rename" -msgstr "" +msgstr "Canviar el nom" #: lazarusidestrconsts:lispkgmangrenamefilelowercase msgid "Rename File lowercase?" -msgstr "" +msgstr "Canviar el nom del fitxer a minscules?" #: lazarusidestrconsts:lismenurenameidentifier msgid "Rename Identifier" -msgstr "" +msgstr "Canviar el nom de l'identificador" #: lazarusidestrconsts:lisfrirenameallreferences msgid "Rename all References" -msgstr "" +msgstr "Canviar el nom de totes les referncies" #: lazarusidestrconsts:lisrenamefilefailed msgid "Rename file failed" -msgstr "" +msgstr "Ha fallat el canvi de nom del fitxer" #: lazarusidestrconsts:lispkgmangrenamefileinpackage msgid "Rename file in package?" -msgstr "" +msgstr "Canviar el nom del fitxer en el paquet?" #: lazarusidestrconsts:lisrenamefile msgid "Rename file?" -msgstr "" +msgstr "Canviar el nom del fitxer?" #: lazarusidestrconsts:srkmecrenameidentifier msgid "Rename identifier" -msgstr "" +msgstr "Canviar el nom de l'identificador" #: lazarusidestrconsts:lisfrirenameto msgid "Rename to" -msgstr "" +msgstr "Canviar el nom a" #: lazarusidestrconsts:lismenureplace msgid "Replace" @@ -4972,23 +4972,23 @@ msgstr "Substituir" #: lazarusidestrconsts:dlgreplaceall msgid "Replace All" -msgstr "Reemplaar tot" +msgstr "Substituir-ho tot" #: lazarusidestrconsts:lispkgmangreplacefile msgid "Replace File" -msgstr "" +msgstr "Substituir el fitxer" #: lazarusidestrconsts:lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" -msgstr "" +msgstr "Substituir el fitxer existent %s%s%s?" #: lazarusidestrconsts:srkmecreplace msgid "Replace text" -msgstr "Reemplaar text" +msgstr "Substituir text" #: lazarusidestrconsts:lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "Reemplaar aquesta ocurrncia de %s%s%s%s amb %s%s%s?" +msgstr "Substituir aquesta ocurrncia de %s%s%s%s amb %s%s%s?" #: lazarusidestrconsts:dlgreport msgid "Report" @@ -4996,39 +4996,39 @@ msgstr "Informar" #: lazarusidestrconsts:lispckeditrequiredpackages msgid "Required Packages" -msgstr "" +msgstr "Paquets requerits" #: lazarusidestrconsts:lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" -msgstr "" +msgstr "Escanejar de nou el directori del codi font FPC" #: lazarusidestrconsts:lismenuresetdebugger msgid "Reset debugger" -msgstr "" +msgstr "Reiniciar depurador" #: lazarusidestrconsts:lisresourceloaderror msgid "Resource load error" -msgstr "" +msgstr "Error carregant recurs" #: lazarusidestrconsts:lisresourcesaveerror msgid "Resource save error" -msgstr "" +msgstr "Error guardant recurs" #: lazarusidestrconsts:lismakeresstrresourcestringsection msgid "Resourcestring Section:" -msgstr "Secci de cadena de recursos" +msgstr "Secci de cadena del recurs" #: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" -msgstr "Ja existeix la cadena de recursos" +msgstr "Ja existeix la cadena del recurs" #: lazarusidestrconsts:lismenurestart msgid "Restart" -msgstr "" +msgstr "Reiniciar" #: lazarusidestrconsts:lislazbuildrestartafterbuild msgid "Restart After Successfull Build" -msgstr "" +msgstr "Reiniciar desprs de muntar amb xit" #: lazarusidestrconsts:rsiwprestorewindowgeometry msgid "Restore window geometry" @@ -5048,11 +5048,11 @@ msgstr "Revertir" #: lazarusidestrconsts:lisrevertfailed msgid "Revert failed" -msgstr "" +msgstr "Ha fallat la reversi" #: lazarusidestrconsts:lispkgeditrevertpackage msgid "Revert package?" -msgstr "" +msgstr "Revertir paquet?" #: lazarusidestrconsts:srvk_right msgid "Right" @@ -5060,11 +5060,11 @@ msgstr "Dreta" #: lazarusidestrconsts:dlgrightclickselects msgid "Right Click selects" -msgstr "" +msgstr "Clic dret selecciona" #: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "" +msgstr "Fes un clic amb el bot dret a l'arbre d'elements per obtenir el men emergent amb totes les funcions disponibles del paquet." #: lazarusidestrconsts:dlgrightmargin msgid "Right margin" @@ -5076,15 +5076,15 @@ msgstr "Color del marge dret" #: lazarusidestrconsts:dlgrightmousemovescursor msgid "Right mouse moves caret" -msgstr "" +msgstr "El bot dret del ratol mou intercalaci" #: lazarusidestrconsts:lisrightsides msgid "Right sides" -msgstr "" +msgstr "Costats drets" #: lazarusidestrconsts:lisrightspaceequally msgid "Right space equally" -msgstr "" +msgstr "Igualar espai dret" #: lazarusidestrconsts:dlgrubberbandgroup msgid "Rubber band" @@ -5096,7 +5096,7 @@ msgstr "Executar" #: lazarusidestrconsts:lismenurunfile msgid "Run File" -msgstr "" +msgstr "Executar fitxer" #: lazarusidestrconsts:lismenurunparameters msgid "Run Parameters ..." @@ -5104,7 +5104,7 @@ msgstr "Par #: lazarusidestrconsts:srkmcatrunmenu msgid "Run menu commands" -msgstr "Comandaments del men d'execuci" +msgstr "Ordres del men d'execuci" #: lazarusidestrconsts:dlgrunparameters msgid "Run parameters" @@ -5112,31 +5112,31 @@ msgstr "Executar par #: lazarusidestrconsts:lismenuruntocursor msgid "Run to cursor" -msgstr "Executar des del cursor" +msgstr "Executar al cursor" #: lazarusidestrconsts:lisruntofailed msgid "Run-to failed" -msgstr "" +msgstr "Ha fallat executar a" #: lazarusidestrconsts:lispckoptsruntimeonly msgid "Runtime only" -msgstr "" +msgstr "Noms en temps d'execuci" #: lazarusidestrconsts:rslanguagerussian msgid "Russian" -msgstr "" +msgstr "Rus" #: lazarusidestrconsts:rslanguagerussianwin msgid "Russian(CP1251)" -msgstr "" +msgstr "Rus(CP1251)" #: lazarusidestrconsts:rslanguagerussianutf msgid "Russian(UTF8)" -msgstr "" +msgstr "Rus(UTF8)" #: lazarusidestrconsts:dlgbckupsubdir msgid "Same name (in subdirectory)" -msgstr "Mateix nom (a un sub-directori)" +msgstr "Mateix nom (a un subdirectori)" #: lazarusidestrconsts:lismenusave msgid "Save" @@ -5156,27 +5156,27 @@ msgstr "Guardar com a ..." #: lazarusidestrconsts:lismenueditorsaveastemplate msgid "Save As Template..." -msgstr "" +msgstr "Guardar com a plantilla..." #: lazarusidestrconsts:lispckeditsavechanges msgid "Save Changes?" -msgstr "" +msgstr "Guardar els canvis?" #: lazarusidestrconsts:lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" -msgstr "" +msgstr "Guardar el paquet %s (*.lpk)" #: lazarusidestrconsts:lispkgmangsavepackage msgid "Save Package?" -msgstr "" +msgstr "Guardar el paquet?" #: lazarusidestrconsts:lismenusaveproject msgid "Save Project" -msgstr "Guardar projecte" +msgstr "Guardar el projecte" #: lazarusidestrconsts:lissaveprojectlpi msgid "Save Project %s (*.lpi)" -msgstr "" +msgstr "Guardar el projecte %s (*.pli)" #: lazarusidestrconsts:lismenusaveprojectas msgid "Save Project As..." @@ -5184,11 +5184,11 @@ msgstr "Guardar projecte com a ..." #: lazarusidestrconsts:lishintsaveall msgid "Save all" -msgstr "" +msgstr "Guardar-ho tot" #: lazarusidestrconsts:lissaveallmessagestofile msgid "Save all messages to file" -msgstr "" +msgstr "Guardar tots els missatges al fitxer" #: lazarusidestrconsts:liscodetoolsdefssaveandexit msgid "Save and Exit" @@ -5196,15 +5196,15 @@ msgstr "Guardar i sortir" #: lazarusidestrconsts:lissaveandexitdialog msgid "Save and exit dialog" -msgstr "" +msgstr "Dileg Guardar i sortir" #: lazarusidestrconsts:lissaveandrebuildide msgid "Save and rebuild IDE" -msgstr "" +msgstr "Guardar i remuntar IDE" #: lazarusidestrconsts:srkmecsaveas msgid "Save as" -msgstr "" +msgstr "Guardar com a" #: lazarusidestrconsts:lissavechangestoproject msgid "Save changes to project %s?" @@ -5212,7 +5212,7 @@ msgstr "Guardar els canvis al projecte %s?" #: lazarusidestrconsts:lissavechanges msgid "Save changes?" -msgstr "" +msgstr "Guardar els canvis?" #: lazarusidestrconsts:dlgsavedfile msgid "Save desktop settings to file" @@ -5228,15 +5228,15 @@ msgstr "Guardar informaci #: lazarusidestrconsts:lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "" +msgstr "Guardar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" #: lazarusidestrconsts:lispckeditsavepackage msgid "Save package" -msgstr "" +msgstr "Guardar el paquet" #: lazarusidestrconsts:lispkgmangsavepackage2 msgid "Save package?" -msgstr "" +msgstr "Guardar el paquet?" #: lazarusidestrconsts:fdmscaleword msgid "Scale" @@ -5244,27 +5244,27 @@ msgstr "Escalar" #: lazarusidestrconsts:lisscalingfactor msgid "Scaling factor:" -msgstr "" +msgstr "Factor d'escalat:" #: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" -msgstr "" +msgstr "Explorar unitat per nom d'unitat i procediment de registre" #: lazarusidestrconsts:liscoscanforfpcmessages msgid "Scan for FPC messages" -msgstr "" +msgstr "Explorar missatges FPC" #: lazarusidestrconsts:liscoscanformakemessages msgid "Scan for Make messages" -msgstr "" +msgstr "Explorar missatges de Make" #: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" -msgstr "" +msgstr "Explorar a la sortida els missatges del compilador Free Pascal" #: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" -msgstr "" +msgstr "Explorar a la sortida els missatges de Make" #: lazarusidestrconsts:dlgscope msgid "Scope" @@ -5276,7 +5276,7 @@ msgstr "Despla #: lazarusidestrconsts:dlgscrollbyoneless msgid "Scroll by one less" -msgstr "" +msgstr "Desplaar un menys" #: lazarusidestrconsts:srkmecscrolldown msgid "Scroll down one line" @@ -5288,11 +5288,11 @@ msgstr "Despla #: lazarusidestrconsts:dlgscrollpastendfile msgid "Scroll past end of file" -msgstr "" +msgstr "Desplaar fins el final del fitxer" #: lazarusidestrconsts:dlgscrollpastendline msgid "Scroll past end of line" -msgstr "" +msgstr "Desplaar fins el final de la lnia" #: lazarusidestrconsts:srkmecscrollright msgid "Scroll right one char" @@ -5308,7 +5308,7 @@ msgstr "" #: lazarusidestrconsts:lismenuviewsearchresults msgid "Search Results" -msgstr "" +msgstr "Buscar resultats" #: lazarusidestrconsts:lissearchagain msgid "Search again" @@ -5316,11 +5316,11 @@ msgstr "" #: lazarusidestrconsts:lisfrisearchincommentstoo msgid "Search in comments too" -msgstr "" +msgstr "Buscar tamb als comentaris" #: lazarusidestrconsts:lispatheditsearchpaths msgid "Search paths:" -msgstr "" +msgstr "Trajectries de recerca:" #: lazarusidestrconsts:lisuesearchstringnotfound msgid "Search string '%s' not found!" @@ -5328,15 +5328,15 @@ msgstr "No trobo la cadena '%s'" #: lazarusidestrconsts:dlgsearchabort msgid "Search terminated by user." -msgstr "" +msgstr "Recerca finalitzada per l'usuari." #: lazarusidestrconsts:lisfrisearchwhere msgid "Search where" -msgstr "" +msgstr "On buscar" #: lazarusidestrconsts:dlgsearchcaption msgid "Searching..." -msgstr "" +msgstr "Buscant..." #: lazarusidestrconsts:lisuesearching msgid "Searching: %s" @@ -5344,7 +5344,7 @@ msgstr "Buscant: %s" #: lazarusidestrconsts:lisseemessages msgid "See messages." -msgstr "" +msgstr "Veure missatges." #: lazarusidestrconsts:srkmecselleft msgid "SelLeft" @@ -5360,7 +5360,7 @@ msgstr "Seleccionar" #: lazarusidestrconsts:srkmecselectall msgid "Select All" -msgstr "" +msgstr "Seleccionar-ho tot" #: lazarusidestrconsts:lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" @@ -5384,7 +5384,7 @@ msgstr "Seleccionar al comen #: lazarusidestrconsts:lismenueditorselectmenu msgid "Select Menu:" -msgstr "" +msgstr "Seleccionar men:" #: lazarusidestrconsts:srkmecselpagebottom msgid "Select Page Bottom" @@ -5412,7 +5412,7 @@ msgstr "Seleccionar p #: lazarusidestrconsts:lismenueditorselecttemplate msgid "Select Template:" -msgstr "" +msgstr "Seleccionar plantilla:" #: lazarusidestrconsts:srkmecselup msgid "Select Up" @@ -5428,19 +5428,19 @@ msgstr "Seleccionar una paraula a la dreta" #: lazarusidestrconsts:lisselectahelpitem msgid "Select a help item:" -msgstr "" +msgstr "Seleccionar un element d'ajuda:" #: lazarusidestrconsts:lisselectanode msgid "Select a node" -msgstr "" +msgstr "Seleccionar un node" #: lazarusidestrconsts:lisnpselectaprojecttype msgid "Select a project type" -msgstr "" +msgstr "Seleccionar un tipus de projecte" #: lazarusidestrconsts:lismenuselectall msgid "Select all" -msgstr "Seleccionar Tot" +msgstr "Seleccionar-ho Tot" #: lazarusidestrconsts:lismenuselectcodeblock msgid "Select code block" @@ -5448,11 +5448,11 @@ msgstr "Seleccionar bloc de codi" #: lazarusidestrconsts:lispatheditselectdirectory msgid "Select directory" -msgstr "" +msgstr "Seleccionar directori" #: lazarusidestrconsts:dlgrubberbandselectsgrandchilds msgid "Select grand childs" -msgstr "Selecciona nets" +msgstr "Seleccionar nts" #: lazarusidestrconsts:lismenuselectline msgid "Select line" @@ -5464,7 +5464,7 @@ msgstr "Seleccionar par #: lazarusidestrconsts:lisdsgselectparentcomponent msgid "Select parent component" -msgstr "" +msgstr "Seleccionar component pare" #: lazarusidestrconsts:srkmecseleditortop msgid "Select to absolute beginning" @@ -5488,7 +5488,7 @@ msgstr "Text seleccionat" #: lazarusidestrconsts:lispckexplisrequiredby msgid "Selected package is required by:" -msgstr "" +msgstr "El paquet seleccionat s requerit per:" #: lazarusidestrconsts:dlgruberbandselectioncolor msgid "Selection" @@ -5496,11 +5496,11 @@ msgstr "Selecci #: lazarusidestrconsts:lisselectionexceedsstringconstant msgid "Selection exceeds string constant" -msgstr "" +msgstr "La selecci excedeix la constant de cadena" #: lazarusidestrconsts:lisselectiontool msgid "Selection tool" -msgstr "Eines de selecci" +msgstr "Eina de selecci" #: lazarusidestrconsts:liscodetoolsoptssemicolon msgid "Semicolon" @@ -5528,7 +5528,7 @@ msgstr "Variable de propietat" #: lazarusidestrconsts:lislazbuildsettobuildall msgid "Set to %sBuild All%s" -msgstr "Definir %sConstruir tot%s" +msgstr "Definir %sMuntar-ho tot%s" #: lazarusidestrconsts:srvk_shift msgid "Shift" @@ -5540,19 +5540,19 @@ msgstr "Shift Tab" #: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" -msgstr "" +msgstr "S'ha de canviar a minscules el nom del fitxer a%s%s%s%s?" #: lazarusidestrconsts:lisaf2pshowall msgid "Show All" -msgstr "" +msgstr "Mostar-ho tot" #: lazarusidestrconsts:lisuishowcodetoolsvalues msgid "Show CodeTools Values" -msgstr "" +msgstr "Mostrar Valors CodeTools" #: lazarusidestrconsts:dlgcoshowerr msgid "Show Errors" -msgstr "Mostrar errors" +msgstr "Mostrar els errors" #: lazarusidestrconsts:dlgguidelines msgid "Show Guide Lines" @@ -5564,7 +5564,7 @@ msgstr "Mostrar indicacions" #: lazarusidestrconsts:dlghintsunused msgid "Show Hints for unused units in main source" -msgstr "" +msgstr "Mostrar suggeriments per unitats no utilitzades en la font principal" #: lazarusidestrconsts:dlgshownotes msgid "Show Notes" @@ -5584,11 +5584,11 @@ msgstr "Mostrar avisos" #: lazarusidestrconsts:lisa2pshowall msgid "Show all" -msgstr "" +msgstr "Mostrar-ho tot" #: lazarusidestrconsts:liscoshowallmessages msgid "Show all messages" -msgstr "" +msgstr "Mostrar tots els missatges" #: lazarusidestrconsts:dlgshowprocserror msgid "Show all procs on error" @@ -5596,31 +5596,31 @@ msgstr "Mostrar tots els processos en trobar un error" #: lazarusidestrconsts:dlgclosebuttonsnotebook msgid "Show close buttons in notebook" -msgstr "" +msgstr "Mostrar els botons de tancar en el llibre de notes" #: lazarusidestrconsts:dlgshowcompiledprocedures msgid "Show compiled procedures" -msgstr "" +msgstr "Mostrar procediments compilats" #: lazarusidestrconsts:dlgshowcompileroptions msgid "Show compiler options" -msgstr "Mostra les opcions del compilador" +msgstr "Mostrar les opcions del compilador" #: lazarusidestrconsts:dlgshowcaps msgid "Show component captions" -msgstr "Mostrar els ttols dels components" +msgstr "Mostrar els rtols dels components" #: lazarusidestrconsts:dlgshowconditionals msgid "Show conditionals" -msgstr "" +msgstr "Mostrar els condicionals" #: lazarusidestrconsts:dlgshowdebuginfo msgid "Show debug info" -msgstr "" +msgstr "Mostrar informaci de depuraci" #: lazarusidestrconsts:dlgshowdefinedmacros msgid "Show defined macros" -msgstr "" +msgstr "Mostrar macroinstruccions definides" #: lazarusidestrconsts:dlgshowedrhints msgid "Show editor hints" @@ -5628,11 +5628,11 @@ msgstr "Mostrar els suggeriments de l'editor" #: lazarusidestrconsts:dlgshoweverything msgid "Show everything" -msgstr "" +msgstr "Mostrar-ho tot" #: lazarusidestrconsts:dlgshowgeneralinfo msgid "Show general info" -msgstr "" +msgstr "Mostrar informaci general" #: lazarusidestrconsts:dlgqshowgrid msgid "Show grid" @@ -5640,35 +5640,35 @@ msgstr "Mostrar graella" #: lazarusidestrconsts:dlgshowgutterhints msgid "Show gutter hints" -msgstr "" +msgstr "Mostrar suggeriments sense importncia" #: lazarusidestrconsts:dlgshowlinenumbers msgid "Show line numbers" -msgstr "" +msgstr "Mostrar els nmeros de lnia" #: lazarusidestrconsts:dlgshownothing msgid "Show nothing (only errors)" -msgstr "" +msgstr "No mostrar rs (noms errors)" #: lazarusidestrconsts:dlgshowscrollhint msgid "Show scroll hint" -msgstr "" +msgstr "Mostrar suggeriment deplaat" #: lazarusidestrconsts:dlgshowsummary msgid "Show summary" -msgstr "" +msgstr "Mostrar reportatge" #: lazarusidestrconsts:dlgshowtriedfiles msgid "Show tried files" -msgstr "" +msgstr "Mostrar els fitxers triats" #: lazarusidestrconsts:dlgshowusedfiles msgid "Show used files" -msgstr "" +msgstr "Mostrar els fitxers utilitzats" #: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" -msgstr "" +msgstr "Sintaxi simple (p.e. * en lloc de .*)" #: lazarusidestrconsts:fdmsizeword msgid "Size" @@ -5676,7 +5676,7 @@ msgstr "Tamany" #: lazarusidestrconsts:liscoskipcallingcompiler msgid "Skip calling Compiler" -msgstr "" +msgstr "No cridar el compilador" #: lazarusidestrconsts:dlgcosmaller msgid "Smaller Code" @@ -5684,11 +5684,11 @@ msgstr "Codi m #: lazarusidestrconsts:dlgcosmartlinkable msgid "Smart Linkable" -msgstr "" +msgstr "Enllaament intelligent" #: lazarusidestrconsts:dlgsmarttabs msgid "Smart tabs" -msgstr "" +msgstr "Tabuladors intelligents" #: lazarusidestrconsts:dlgsnapguidelines msgid "Snap to Guide Lines" @@ -5704,15 +5704,15 @@ msgstr "Instant #: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" -msgstr "" +msgstr "Alguns fitxers han canviat al disc:" #: lazarusidestrconsts:lissorrynotimplementedyet msgid "Sorry, not implemented yet" -msgstr "" +msgstr "Ho sento, encara no est implementat" #: lazarusidestrconsts:lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" -msgstr "" +msgstr "Ho sento, aquest tipus encara no est implementat" #: lazarusidestrconsts:lismenusortselection msgid "Sort selection" @@ -5724,27 +5724,27 @@ msgstr "Editor de codi font" #: lazarusidestrconsts:srkmcatsrcnotebook msgid "Source Notebook commands" -msgstr "Comandaments del llibre del codi font" +msgstr "Ordres del llibre del codi font" #: lazarusidestrconsts:lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" -msgstr "" +msgstr "Font i destinaci son el mateix:%s%s" #: lazarusidestrconsts:lismenuaddbpsource msgid "Source breakpoint" -msgstr "" +msgstr "Punt de trencament de la Font" #: lazarusidestrconsts:lissourcedirectorydoesnotexists msgid "Source directory %s%s%s does not exists." -msgstr "" +msgstr "El directori del codi font %s%s%s no existeix." #: lazarusidestrconsts:lissourcemodified msgid "Source modified" -msgstr "" +msgstr "Codi font modificat" #: lazarusidestrconsts:lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" -msgstr "" +msgstr "El codi font de la pgina %s%s%s ha canviat. La guardo?" #: lazarusidestrconsts:lismakeresstrsourcepreview msgid "Source preview" @@ -5756,7 +5756,7 @@ msgstr "Espai" #: lazarusidestrconsts:lisspaceequally msgid "Space equally" -msgstr "" +msgstr "Igualar espais" #: lazarusidestrconsts:srvk_space msgid "Space key" @@ -5764,11 +5764,11 @@ msgstr "Tecla d'espai" #: lazarusidestrconsts:rslanguagespanish msgid "Spanish" -msgstr "" +msgstr "Espanyol" #: lazarusidestrconsts:rslanguagespanishutf msgid "Spanish (UTF8)" -msgstr "" +msgstr "Espanyol (UTF8)" #: lazarusidestrconsts:lisuidsrc msgid "Src" @@ -5780,19 +5780,19 @@ msgstr "Pila" #: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" -msgstr "" +msgstr "Edici de men normalitzat" #: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" -msgstr "" +msgstr "Edici de fitxer normalitzat" #: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" -msgstr "" +msgstr "Men d'ajuda normalitzat" #: lazarusidestrconsts:lisoipstate msgid "State" -msgstr "" +msgstr "Estat" #: lazarusidestrconsts:dlgstatickeyword msgid "Static Keyword in Objects" @@ -5800,11 +5800,11 @@ msgstr "Paraula clau Static en objectes" #: lazarusidestrconsts:lishintstepinto msgid "Step Into" -msgstr "" +msgstr "Pas a pas per instruccions" #: lazarusidestrconsts:lishintstepover msgid "Step Over" -msgstr "" +msgstr "Pas a pas per funcions" #: lazarusidestrconsts:lismenustepinto msgid "Step into" @@ -5820,7 +5820,7 @@ msgstr "Aturar" #: lazarusidestrconsts:lisstopdebugging msgid "Stop Debugging?" -msgstr "" +msgstr "Aturar la depuraci?" #: lazarusidestrconsts:dlgstopafternrerr msgid "Stop after number of errors:" @@ -5828,19 +5828,19 @@ msgstr "Aturar despr #: lazarusidestrconsts:lisstopthedebugging msgid "Stop the debugging?" -msgstr "" +msgstr "Aturar la depuraci?" #: lazarusidestrconsts:dlgcdtstoredpostfix msgid "Stored postfix" -msgstr "Postfix emmagatzemar" +msgstr "Postfix Guardat" #: lazarusidestrconsts:lisstreamingerror msgid "Streaming error" -msgstr "" +msgstr "Error d'afluent" #: lazarusidestrconsts:lismakeresstrstringconstantinsource msgid "String Constant in source" -msgstr "Constant de cadena a les fonts" +msgstr "Constant de cadena al codi font" #: lazarusidestrconsts:liscodetoolsoptsstringconst msgid "String constant" @@ -5860,23 +5860,23 @@ msgstr "Estil" #: lazarusidestrconsts:lissubprocedure msgid "Sub Procedure" -msgstr "" +msgstr "Subprocediment" #: lazarusidestrconsts:lissubprocedureonsamelevel msgid "Sub Procedure on same level" -msgstr "" +msgstr "Subprocediment en el mateix nivell" #: lazarusidestrconsts:dlgedbsubdir msgid "Sub directory" -msgstr "Sub-directori" +msgstr "Subdirectori" #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" -msgstr "" +msgstr "Commutar trajectries" #: lazarusidestrconsts:srkmectoggleformunit msgid "Switch between form and unit" -msgstr "Canviar entre forma i unitat" +msgstr "Commutar entre forma i unitat" #: lazarusidestrconsts:dlgsymantecchecking msgid "Symantec Checking:" @@ -5896,7 +5896,7 @@ msgstr "S #: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" -msgstr "" +msgstr "SynEdit - el component editor utilitzat pel Lazarus. http://sourceforge.net/projects/synedit/" #: lazarusidestrconsts:srkmecsyntaxcheck msgid "Syntax check" @@ -5916,15 +5916,15 @@ msgstr "Tabulador" #: lazarusidestrconsts:dlgtabindent msgid "Tab indents blocks" -msgstr "" +msgstr "El tabulador sagna blocs" #: lazarusidestrconsts:dlgtabwidths msgid "Tab widths:" -msgstr "Amplades dels tabuladors" +msgstr "Amplada Tab:" #: lazarusidestrconsts:dlgtabstospaces msgid "Tabs to spaces" -msgstr "" +msgstr "Tabuladors a espais" #: lazarusidestrconsts:lismenutabstospacesselection msgid "Tabs to spaces in selection" @@ -5932,23 +5932,23 @@ msgstr "Tabuladors a espais en la selecci #: lazarusidestrconsts:listargetcpu msgid "Target CPU" -msgstr "" +msgstr "CPU destinaci" #: lazarusidestrconsts:lislazbuildtargetdirectory msgid "Target Directory:" -msgstr "" +msgstr "Directori destinaci:" #: lazarusidestrconsts:listargetos msgid "Target OS" -msgstr "SO de destinaci" +msgstr "SO destinaci" #: lazarusidestrconsts:liscotargetosspecificoptions msgid "Target OS specific options" -msgstr "" +msgstr "Opcions especifiques del SO destinaci" #: lazarusidestrconsts:lislazbuildtargetos msgid "Target OS:" -msgstr "SO de destinaci" +msgstr "SO dest:" #: lazarusidestrconsts:dlgtargetproc msgid "Target Processor:" @@ -5968,15 +5968,15 @@ msgstr "Nom del fitxer destinaci #: lazarusidestrconsts:lismenueditortemplatepreview msgid "Template Preview" -msgstr "" +msgstr "Vista preliminar de la plantilla" #: lazarusidestrconsts:dlgtplfname msgid "Template file name" -msgstr "Nom del fitxer" +msgstr "Nom fit. Plantilla" #: lazarusidestrconsts:liscomptest msgid "Test" -msgstr "" +msgstr "Prova" #: lazarusidestrconsts:listestdirectory msgid "Test directory" @@ -5984,7 +5984,7 @@ msgstr "Directori de proves" #: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." -msgstr "No trobo el directori de prova \"%s\"" +msgstr "No trobo el directori de proves \"%s\"." #: lazarusidestrconsts:lispkgfiletypetext msgid "Text" @@ -5996,23 +5996,23 @@ msgstr "Atributs del text" #: lazarusidestrconsts:srkmcatediting msgid "Text editing commands" -msgstr "Comandaments d'edici de text" +msgstr "Ordres d'edici de text" #: lazarusidestrconsts:srkmcatmarker msgid "Text marker commands" -msgstr "Comandaments de marcadors de text" +msgstr "Ordres de marcadors de text" #: lazarusidestrconsts:srkmcatsearchreplace msgid "Text search and replace commands" -msgstr "Comandaments de recerca i reemplaament" +msgstr "Ordres de recerca i reemplaament de text" #: lazarusidestrconsts:srkmcatselection msgid "Text selection commands" -msgstr "Comandaments de selecci de text" +msgstr "Ordres de selecci de text" #: lazarusidestrconsts:lisfindfiletexttofind msgid "Text to find:" -msgstr "" +msgstr "Text a trobar:" #: lazarusidestrconsts:lisdiffdlgtext1 msgid "Text1" @@ -6024,7 +6024,7 @@ msgstr "Text2" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" -msgstr "" +msgstr "El directori principal %s,%son Borland ha installat totes les fonts %s,%sles quals son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" @@ -6032,7 +6032,7 @@ msgstr "El directori principal %s, on Borland ha instal #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" -msgstr "" +msgstr "El directori principal %s,%son Borland ha installat totes les fonts %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" @@ -6044,23 +6044,23 @@ msgstr "El directori del projecte %s, %s el qual cont #: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "" +msgstr "La FCL - FreePascal Component Library, proveeix les classes base per l'object pascal" #: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." -msgstr "El directori font del FPC \"%s\" no sembla correcte. Normalment cont directoris com rtl, fcl, packages, compiler, ... ." +msgstr "El directori del codi font del FPC \"%s\" no sembla correcte. Normalment cont directoris com rtl, fcl, packages, compiler, ... ." #: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedir msgid "The Free Pascal CVS source directory." -msgstr "El directori CVS de les fonts del Free Pascal" +msgstr "El directori CVS del codi font del Free Pascal" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal CVS source directory. Not required. This will improve find declarationand debugging." -msgstr "El directori CVS de les fonts del FPC. No es requereix. " +msgstr "El directori font CVS del Free Pascal. No es requereix. Aix millorar el trobar depuraci a les declaracions." #: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "" +msgstr "El compilador Free Pascal (nom de fitxer: %s) no ha estat trobat.%sRecomano que installis fpc." #: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." @@ -6068,19 +6068,19 @@ msgstr "El directori del projecte Free Pascal" #: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "" +msgstr "No trobo el directori del codi font del Free Pascal.%sAlgunes funcions codificades no funcionaran.%sRecomano que les installis i posis la trajectria%SEntorn -> Opcions de l'entorn -> Fitxers" #: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "" +msgstr "La LCL - Lazarus Component Library cont tots els components base per editar formes." #: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "" +msgstr "El fitxer LFM (Lazarus Form) cont propietats no vlides. Aix vol dir, per exemple, que cont algunes propietats/classes les quals no existeixen en la LCL actual. La manera normar de corregir aix s esborrar aquestes propietats de la LFM i corregir manualment el codi pascal." #: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "" +msgstr "El directori Lazarus no ha estat trobat.%sNo prodrs crear aplicacions LCL.%sSi us plau, comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." @@ -6088,55 +6088,55 @@ msgstr "El directori principal del Lazarus" #: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "" +msgstr "La versi mxima %s%s%s no s vlida.%sSi us plau, utilitza el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." -msgstr "" +msgstr "La versi mxima s menor que la versi mnima" #: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "" +msgstr "La versi mnima %s%s%s no s vlida.%sSi us plau, utilitza el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "" +msgstr "No trobo el directori de proves:%s%s%s%s%s(mira les opcions de l'entorn" #: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "" +msgstr "El tipus avantpassat %s%s%s t el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "El tipus avantpassat %s%s%s no s un identificador pascal vlid." #: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "" +msgstr "La classe %s%s%s s un TControl i no pot ser enganxat dins un no-control%sNo es pot enganxar." #: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." -msgstr "" +msgstr "El nom de classe %s%s%s i tipus avantpassat %s%s%s son el mateix." #: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" -msgstr "" +msgstr "El nom de classe %s%s%s ja existeix en%s el paquet %s%sFitxer: %s%s%s" #: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "" +msgstr "El nom de classe %s%s%s t el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "El nom de classe %s%s%s no s un identificador pascal vlid." #: lazarusidestrconsts:listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." -msgstr "" +msgstr "L'ordre de desprs de %s%s%s no s executable." #: lazarusidestrconsts:listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "" +msgstr "L'ordre desprs de publicar s invlida:%s%s%s%s" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." @@ -6144,47 +6144,47 @@ msgstr "El fitxer del compilador \"%s\" no #: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" -msgstr "" +msgstr "El fitxer de compilador pel paquet %s no s un executable vlid:%s%s" #: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" -msgstr "" +msgstr "L'editor de component de classe %s%s%s%sinvocat amb el verb #%s %s%s%s%s ha generat l'error:%s%s%s%s" #: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" -msgstr "" +msgstr "L'editor de component de classe %s%s%s ha generat l'error:%s%s%s%s" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "" +msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte.%sComprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "" +msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podrs crear aplicacions LCL.%s Comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podrs crear aplicacions LCL.%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "El nom del compilador actual %s%s%s%s no s un executable vlid.%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "" +msgstr "El nom del compilador actual %s%s%s%sno s un executable vlid.%s Si us plau, comprova Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "" +msgstr "La trajectria d'unitat actual pel fitxer%s%s%s%s s %s%s%s%s.%s%sFalta la trajectria a les unitats LCL %s%s%s.%s%sSuggeriment per aprenents:%sCrear una aplicaci Lazarus i posar el fitxer dins del directori del projecte." #: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exists or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "" +msgstr "El depurador %s%s%s%sno existeix o no s executable.%s%sComprova Entorn -> Opcions del Depurador" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." @@ -6192,11 +6192,11 @@ msgstr "El fitxer del depurador \"%s\" no #: lazarusidestrconsts:lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "" +msgstr "No he trobat la dependncia %s%s%s.%sSi us plau, escull un paquet existent" #: lazarusidestrconsts:listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." -msgstr "" +msgstr "El directori destinaci%s%s%s%s no existeix." #: lazarusidestrconsts:dlgthedirectory msgid "The directory \"" @@ -6204,55 +6204,55 @@ msgstr "El directori \"" #: lazarusidestrconsts:listhefile msgid "The file %s%s%s" -msgstr "" +msgstr "El fitxer %s%s%s" #: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." -msgstr "" +msgstr "El fitxer %s%s%s ja s al paquet." #: lazarusidestrconsts:listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" -msgstr "" +msgstr "El fitxer %s%s%s no s un projecte Delphi (.dpr)" #: lazarusidestrconsts:listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." -msgstr "" +msgstr "El fitxer %s%s%s no s una unitat Delphi." #: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." -msgstr "" +msgstr "El fitxer %s%s%s no s un paquet Lazarus." #: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." -msgstr "" +msgstr "El fitxer %s%s%s s part del projecte actual.%ss una mala idea compartir fitxers entre projectes i paquets." #: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." -msgstr "" +msgstr "El fitxer %s%s%s%sja s al paquet %s." #: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "" +msgstr "El fitxer %s%s%s%sja no est en la trajectria d'unitats del paquet.%s%sAfegir %s%s%s a la trajectria d'unitats? " #: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "" +msgstr "El fitxer %s%s%s%ssembla ser un programa. Tanco el projecte actual i creo un nou projecte Lazarus per aquest programa?%s\"No\" carregar el fitxer com un codi font normal." #: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source." -msgstr "" +msgstr "El fitxer %s%s%s%ssembla ser un fitxer de programa d'un projecte Lazarus existent.%sObrir el projecte?%sCancellar carregar el fitxer com un codi font normal." #: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambigious file?" -msgstr "" +msgstr "He trobat el fitxer %s%s%s%s en un dels directoris font del paquet %s i sembla una unitat compilada. Les unitats compilades han d'estar en el directori sortida del paquet, si no, altres paquets poden tenir problemes utilitzant aquest paquet.%s%sEsborrar el fitxer ambigu?" #: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "" +msgstr "No he trobat el fitxer %s%s%s%s.%sEl vols buscar tu mateix ?%s" #: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "" +msgstr "No he trobat el fitxer %s%s%s%s.Ignorar, carregar el projecte.%sAvortar aturar la crrega." #: lazarusidestrconsts:uefilerotext1 msgid "The file \"" @@ -6260,19 +6260,19 @@ msgstr "El fitxer \"" #: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." -msgstr "" +msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no haurien de compartir fitxers." #: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." -msgstr "" +msgstr "El nom de fitxer %s%s%s est essent utilitzat pel%s paquet %s%s%s%s en el fitxer %s%s%s." #: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" -msgstr "" +msgstr "El nom de fitxer %s%s%s no correspon al nom de paquet %s%s%s en el fitxer. %sCanviar nom de paquet a %s%s%s?" #: lazarusidestrconsts:lisa2pthefilenameisambigiouspleasespecifiyafilename msgid "The filename %s%s%s is ambigious.%sPlease specifiy a filename with full path." -msgstr "" +msgstr "El nom de fitxer %s%s%s s ambigu.%sSi us plau especifica un nom de fitxer amb la trajectria completa." #: lazarusidestrconsts:listhefollowingpackagesfailedtoload msgid "The following package(s) failed to load:%s%s" @@ -6280,15 +6280,15 @@ msgstr "" #: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" -msgstr "" +msgstr "Les segents unitats no han estat trobades:%s%s%s%s1)O b, aquestes unitats no estan en la trajectria corresponent, en aquest cas pots avortar ara mateix, corregir la trajectria d'unitats i provar de nou.%s2) O les unitats venent d'un sistema de fitxers no sensible a majs/mins (windows/Delphi) i ara estan a un sistema sensible (linux, bsd, macosx). En aquest cas hauries d'avortar, canviar el nom de totes les unitats a minscules i tornar a provar.%s3) O pots ignorar les unitats que falten i continuar.%s%sComentar les unitats que falten?" #: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." -msgstr "L'aplicaci de l'ordinador central %s%s%s no s executable" +msgstr "L'aplicaci amfitriona %s%s%s no s executable" #: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exists or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "" +msgstr "L'aplicaci llenadora %s%s%s%ssembla no existir o no s executable.%s%sMira Executar -> Parmetres d'Execuci -> Local" #: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." @@ -6296,19 +6296,19 @@ msgstr "El directori del Lazarus \"%s\" no sembla correcte. Normalment cont #: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." -msgstr "" +msgstr "El fitxer make \"%s\" no s executable." #: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "" +msgstr "La versi mxima %s%s%s no s una versi vlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "" +msgstr "La versi mnima %s%s%s no s una versi vlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts:listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "El nom %s%s%s no s un identificador pascal vlid." #: lazarusidestrconsts:lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." @@ -6316,247 +6316,247 @@ msgstr "El nom \"%s\" no #: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "" +msgstr "El paquet %s s noms un paquet de temps d'execuci.%sAquests tipus de paquets no poden ser installats a l'IDE." #: lazarusidestrconsts:lisaf2pthepackageisreadonly msgid "The package %s is read only." -msgstr "" +msgstr "El paquet %s s de noms lectura." #: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "" +msgstr "El paquet %s s requerit per %s, el qual est marcat per la installaci.%sMira la grfica del paquet." #: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "" +msgstr "El paquet %s s propietari del fitxer%s%s%s%s.%sS'ha de canviar el nom del fitxer en el paquet tamb?" #: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." -msgstr "" +msgstr "El paquet %s%s%s t el senyalador d'auto-intallar.%sAix vol dir que s'installar a l'IDE. Els paquets d'intallaci%shan de ser paquets de temps de disseny." #: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file was found.%sA broken dummy package was created." -msgstr "" +msgstr "El paquet %s%s%s est installat, per no s'ha trobat cap fitxer de paquet vlid.%sS'ha creat un paquet fals" #: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "" +msgstr "S'ha marcat el paquet %s%s%s per installar, per no s'ha trobat.%sEsborrar dependncia de la llista de paquets de la installaci?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "El paquet %s%s%s ha estat marcat per installar.%sActualment el Lazarus noms suporta paquets enllaats estticament. La installaci real necessita el remuntatge i reinici del Lazarus.%s%sVols remuntar el Lazarus ara?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "El paquet %s%s%s est marcat.%sActualment el Lazarus noms suporta paquets enllaats estticament. La des-installaci real necessita el remuntatge i reinici del Lazarus.%s%sVols remuntar el Lazarus ara?" #: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." -msgstr "" +msgstr "El nom de fitxer de paquet %s%s%s en %s%s%s no s un nom de paquet Lazarus vlid." #: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." -msgstr "" +msgstr "El paquet ja t una dependncia pel paquet %s%s%s." #: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "" +msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escull un paquet existent." #: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." -msgstr "" +msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escull un paquet existent." #: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "" +msgstr "El nom de paquet %s%s%s no s un nom de paquet vlid%sSi us plau, escull-ne un altre (p.e. paquet1.lpk)" #: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." -msgstr "" +msgstr "El nom del paquet %s%s%s del%sfitxer %s%s%s no s vlid." #: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." -msgstr "" +msgstr "El nom de pgina %s%s%s s massa llarg (max 100 car.)" #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC CVS source below. Used to autocreate macros." -msgstr "La trajectria del Free Pascal per aquest projecte. Noms es requereix si has definit el codi font del FPC CVS. Utilitzat per auto-crear macros." +msgstr "La trajectria del Free Pascal per aquest projecte. Noms es requereix si has definit el codi font del FPC CVS. Utilitzat per auto-crear macrosinstruccions." #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." -msgstr "" +msgstr "La trajectria al compilador Free Pascal.%s Per exemple %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etcfpc.cfg%s." #: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" -msgstr "" +msgstr "No s'ha trobat el programa %sMake%s.%sEs necessita aquesta eina per muntar el Lazarus.%s" #: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." -msgstr "" +msgstr "El projecte ja t una dependncia pel paquet %s%s%s." #: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "" +msgstr "El fitxer d'informaci del projecte %s%s%s%ss igual al fitxer principal del codi font del projecte!" #: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "" +msgstr "S'ha de guardar el projecte abans de muntar de nou%sSi fiques el directori de proves en les opcions de l'entorn,%spots crear projectes nous i muntar-los al mateix temps.%sGuardar el projecte?" #: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "" +msgstr "El projecte requereix el paquet %s%s%s.%sPer no ha estat trobat. Mira Projecte -> Inspector del Projecte." #: lazarusidestrconsts:lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "La cadena de recursos %s%s%s ja existeix. Sisplau escull un altre nom. %s Fes servir Ignorar per afegir-la de tota manera" +msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escull un altre nom. %s Fes servir Ignorar per afegir-la de tota manera" #: lazarusidestrconsts:listherootcomponentcannotbedeleted msgid "The root component can not be deleted." -msgstr "" +msgstr "No es pot esborrar el component arrel." #: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "" +msgstr "Ja existeix la unitat %s%s%s.%sIgnorar forar el canvi de nom,%sCancellar no guardar el codi font i%sAvortar no guardar cap cnvi." #: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" -msgstr "" +msgstr "La unitat %s%s%s no est en minscules.%sEl compilador FreePascal 1.0.x necessita noms de fitxer en minscules. Si no utilitzes aquest compilador, pots ignorar el missatge.%s%sCanviar el nom del fitxer?" #: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "" +msgstr "La mateixa unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser nics." #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." -msgstr "" +msgstr "El nom d'unitat %s%s%s ja existeix en el projecte%sen el fitxer: %s%s%s." #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." -msgstr "" +msgstr "El nom d'unitat %s%s%s ja existeix en la selecci%s en el fitxer: %s%s%s." #: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s and filename differ." -msgstr "" +msgstr "El nom d'unitat %s%s%s i el nom de fitxer son diferents." #: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." -msgstr "" +msgstr "El nom d'unitat %s%s%s no correspon al nom de fitxer." #: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "El nom d'unitat %s%s%s no s un identificador pascal vlid." #: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." -msgstr "" +msgstr "El nom d'unitat %s%s%s s el mateix que el d'un component registrat.%sUtilitzar-lo pot causar missatges d'error estranys." #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" -msgstr "" +msgstr "El nom d'unitat %s%s%s ja existeix en el paquet:%s%s" #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." -msgstr "" +msgstr "El nom d'unitat %s%s%s ja existeix en aquest paquet." #: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" -msgstr "" +msgstr "Hi ha ms funcions en el men emergent" #: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "" +msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no ms son diferents en la capitalitzaci:%s%s%sEsborrar-los?" #: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" -msgstr "" +msgstr "Hi ha dues unitats amb el mateix nom:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s" #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "" +msgstr "Hi ha una unitat FPC amb el mateix nom que un paquet:%s%s%s%s%s%s" #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "" +msgstr "Hi ha una unitat FPC amb el mateix nom que:%s%s%s%s%s de %s%s%s" #: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." -msgstr "" +msgstr "Hi ha un cercle en els paquets requerits. Mira la grfica de paquets." #: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbigious File: %s%s%sDelete ambigious file?" -msgstr "" +msgstr "Hi ha un fitxer amb el mateix nom i extensi similar en el disc%sFitxer: %s%sFitxer ambigu: %s%s%sEsborrar fitxer ambigu?" #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." -msgstr "" +msgstr "Hi ha un mxim de %s eines." #: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" -msgstr "" +msgstr "Hi ha una unitat amb el nom %s%s%s en el projecte.%sSi us plau, escull un nom diferent." #: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" -msgstr "" +msgstr "Hi ha una unitat amb el mateix nom que un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s" #: lazarusidestrconsts:listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" -msgstr "" +msgstr "Ja hi ha una forma amb el nom %s%s%s" #: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "" +msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMira Components -> Grfica dels paquets.%sReemplaar s impossible." #: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "" +msgstr "Ja hi ha una unitat amb el nom %s%s%s. Els identificadors pascal han de ser nics." #: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" -msgstr "" +msgstr "Ja hi ha un altre paquet amb el nom %s%s%s.%sPaquet amb conficte: %s%s%s%sFitxer: %s%s%s" #: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." -msgstr "" +msgstr "Hi ha un paquet no guardat en els paquets requerits. Mira grfica de paquets." #: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "" +msgstr "Hi ha un error escrivint el component seleccionat %s:%s:%s%s" #: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "" +msgstr "Hi ha hagut un error convertint l'afluent binari del component seleccionat %s:%s:%s%s" #: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "" +msgstr "Hi ha hagut un error convertint l'afluent del component al porta-retalls:%s%s" #: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." -msgstr "" +msgstr "Aquest fitxer no s cap paquet carregat." #: lazarusidestrconsts:lisresourcefilecomment msgid "This is an automatically generated lazarus resource file" -msgstr "Aquest s un fitxer de recursos de Lazarus generat automticament" +msgstr "Aquest s un fitxer de recurs de Lazarus generat automticament" #: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "" +msgstr "Aquest s el paquet predeterminat. Utilitzat noms per components sense paquet. Aquests components estan desfasats." #: lazarusidestrconsts:listhislookslikeapascalfilefpc10xexpectspascalfiles msgid "This looks like a pascal file.%sfpc 1.0.x expects pascal files lowercase.%sRename it to lowercase?" -msgstr "" +msgstr "Aix sembla un fitxer pascal.%sfpc 1.0.x espera fitxers pascal en minscules.%sCanviar el nom a minscules?" #: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found.All its components are deactivated. Please fix this." -msgstr "" +msgstr "Aquest paquet est installat, per no s'ha trobat el fitxer lpk. Tots els seus components estan desactivats. Si us plau, corregeix aix." #: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "" +msgstr "No es pot extraure aquesta declaraci.%sSi us plau, selecciona codi per extreure'n un nou procediment/mtode." #: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" -msgstr "" +msgstr "Es requereix ttol i nom de fitxer" #: lazarusidestrconsts:dlgpotitle msgid "Title:" @@ -6588,11 +6588,11 @@ msgstr "Testimoni" #: lazarusidestrconsts:lisctdefstools msgid "Tools" -msgstr "" +msgstr "Eines" #: lazarusidestrconsts:srkmcattoolmenu msgid "Tools menu commands" -msgstr "Comandaments del men de les eines" +msgstr "Ordres del men de les eines" #: lazarusidestrconsts:dlgtooltipeval msgid "Tooltip expression evaluation" @@ -6600,19 +6600,19 @@ msgstr "Avaluaci #: lazarusidestrconsts:dlgtooltiptools msgid "Tooltip symbol Tools" -msgstr "Eines del smbol del rtol indicador de funci" +msgstr "Eines del smbol del rtol indicador de funcions" #: lazarusidestrconsts:listopspaceequally msgid "Top space equally" -msgstr "" +msgstr "Igualar espai superior" #: lazarusidestrconsts:dlgtoppos msgid "Top:" -msgstr "Amunt:" +msgstr "Lmit superior:" #: lazarusidestrconsts:listops msgid "Tops" -msgstr "" +msgstr "Lmits superiors" #: lazarusidestrconsts:dlgtrimtrailingspaces msgid "Trim trailing spaces" @@ -6620,7 +6620,7 @@ msgstr "" #: lazarusidestrconsts:lismenutemplatetutorial msgid "Tutorial" -msgstr "" +msgstr "Programa d'aprenentatge" #: lazarusidestrconsts:dlgenvtype msgid "Type" @@ -6636,291 +6636,291 @@ msgstr "MAJ #: lazarusidestrconsts:lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" -msgstr "" +msgstr "No es pot convertir afluent binari a text" #: lazarusidestrconsts:lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" -msgstr "" +msgstr "No es pot copiar els components al porta-retalls" #: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." -msgstr "" +msgstr "No es pot afegir %s al projecte, ja hi ha una unitat amb el mateix nom al projecte." #: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "" +msgstr "No es pot afegir el recurs T%s:FORMDATA al fitxer de recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "" +msgstr "No es pot afegir el comentari de capalera del recurs al fitxer del recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts:lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" -msgstr "" +msgstr "No es pot fer copia de seguretat del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." -msgstr "No puc canviar la llista de les formes creades automticament en el codi font del programa. %s Sisplau arregla els errors primer." +msgstr "No es pot canviar la llista de les formes creades automticament en el codi font del programa. %s Si us plau, corregeix els errors primer." #: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." -msgstr "" +msgstr "No es pot netejar %s%s%s.%sSi us plau, comprova els permisos." #: lazarusidestrconsts:lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" -msgstr "" +msgstr "No es pot netejar el directori destinaci" #: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" -msgstr "" +msgstr "No es pot convertir el component de text a format binari:%s%s" #: lazarusidestrconsts:lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" -msgstr "" +msgstr "No es pot convetir el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." -msgstr "" +msgstr "No es pot convertir lfm a lrs i escriure fitxer lrs." #: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" -msgstr "" +msgstr "No es pot convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" #: lazarusidestrconsts:lisunabletocopyfile msgid "Unable to copy file" -msgstr "" +msgstr "No es pot copiar el fitxer" #: lazarusidestrconsts:lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" -msgstr "" +msgstr "No es pot copiar el fitxer %s%s%s%sa %s%s%s" #: lazarusidestrconsts:lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." -msgstr "" +msgstr "No es pot copiar el fitxer %s%s%s%sa %s%s%s." #: lazarusidestrconsts:lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." -msgstr "" +msgstr "No es pot crear el directori de resguard %s%s%s." #: lazarusidestrconsts:lispkgmangunabletocreatedirectory msgid "Unable to create directory" -msgstr "" +msgstr "No es pot crear el directori" #: lazarusidestrconsts:lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" -msgstr "" +msgstr "No es pot crear el directori %s%s%s" #: lazarusidestrconsts:lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." -msgstr "" +msgstr "No es pot crear el directori %s%s%s" #: lazarusidestrconsts:lisunabletocreatefile msgid "Unable to create file" -msgstr "" +msgstr "No es pot crear el fitxer" #: lazarusidestrconsts:lisunabletocreatefile2 msgid "Unable to create file %s%s%s" -msgstr "" +msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts:lisunabletocreatefilename msgid "Unable to create file %s%s%s." -msgstr "" +msgstr "No es pot crear el fitxer %s%s%s." #: lazarusidestrconsts:lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" -msgstr "" +msgstr "No es pot crear el fitxer%s%s%s%s" #: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin msgid "Unable to create new method. Plz fix the error shown in the message window." -msgstr "" +msgstr "No es pot crear nou mtode. Si us plau, corregeix l'error de la finestra de missatges." #: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." -msgstr "" +msgstr "No es pot crear el directori de sortida %s%s%s%spel paquet %s." #: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." -msgstr "" +msgstr "No es pot crear el directori sortida font %s%s%s%s pel paquet %s." #: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." -msgstr "" +msgstr "No es pot crear directori destinaci lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els teus paquets personalitzats." #: lazarusidestrconsts:lisunabletodeleteambigiousfile msgid "Unable to delete ambigious file %s%s%s" -msgstr "" +msgstr "No es pot esborrar fitxer ambigu %s%s%s" #: lazarusidestrconsts:lispkgmangunabletodeletefilename msgid "Unable to delete file" -msgstr "" +msgstr "No es pot esborrar el fitxer" #: lazarusidestrconsts:lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." -msgstr "" +msgstr "No es pot esborrar el fitxer %s%s%s." #: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." -msgstr "" +msgstr "No pus esborrar fitxer vell %s%s%s%spel paquet %s." #: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." -msgstr "" +msgstr "No es pot trobar una secci de cadena del recurs en aquesta ni en cap de les unitats utilitzades." #: lazarusidestrconsts:lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" -msgstr "" +msgstr "No es pot trobar un nom de classe vlid a %s%s%s" #: lazarusidestrconsts:lisunabletofindfile msgid "Unable to find file %s%s%s." -msgstr "" +msgstr "No es pot trobar el fitxer %s%s%s." #: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" -msgstr "" +msgstr "No es pot trobar el fitxer %s%s%s.%sComprova trajectria a%sProjecte->Opcions del Compilador...->Trajectries de Recerca->Altres Fitxers d'unitats" #: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage msgid "Unable to find method. Plz fix the error shown in the message window." -msgstr "" +msgstr "No es pot trobar mtode. Si us plau, comprova l'error mostrat a la finestra de missatges." #: lazarusidestrconsts:lisdebugunabletoloadfile msgid "Unable to load file" -msgstr "" +msgstr "No es pot carregar el fitxer" #: lazarusidestrconsts:lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." -msgstr "" +msgstr "No es pot carregar el fitxer %s%s%s." #: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "" +msgstr "No es pot carregar fitxer del recurs vell.%sEl fitxer del recurs s el primer fitxer incls en la%ssecci d'inicialitzaci.%sPer exemple {$I %s.lrs}.%sProblable error de sintaxi. " #: lazarusidestrconsts:lispkgmangunabletoloadpackage msgid "Unable to load package" -msgstr "" +msgstr "No es pot carregar el paquet" #: lazarusidestrconsts:lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for for installation." -msgstr "" +msgstr "No es pot carregar el paquet %s%s%s.%sAquest paquet est marcat per installar." #: lazarusidestrconsts:lisunabletoreadfile msgid "Unable to read file" -msgstr "" +msgstr "No es pot llegir el fitxer" #: lazarusidestrconsts:lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" -msgstr "" +msgstr "No es pot llegir el fitxer %s%s%s!" #: lazarusidestrconsts:lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" -msgstr "" +msgstr "No es pot llegir el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts:lisunabletoreadfilename msgid "Unable to read file %s%s%s." -msgstr "" +msgstr "No es pot llegir el fitxer %s%s%s." #: lazarusidestrconsts:lispkgmangunabletoreadpackagefile msgid "Unable to read package file %s%s%s." -msgstr "" +msgstr "No es pot llegir el fitxer de paquet %s%s%s." #: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" -msgstr "" +msgstr "No es pot llegir fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts:lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" -msgstr "" +msgstr "No es pot esborrar el fitxer de resguard vell %s%s%s!" #: lazarusidestrconsts:lisunabletorenameambigiousfileto msgid "Unable to rename ambigious file %s%s%s%sto %s%s%s" -msgstr "" +msgstr "No es pot canviar el nom del fitxer ambigu %s%s%s%sa %s%s%s" #: lazarusidestrconsts:lisunabletorenamefile msgid "Unable to rename file" -msgstr "" +msgstr "No es pot canviar el nom del fitxer" #: lazarusidestrconsts:lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" -msgstr "" +msgstr "No es pot canviar el nom del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts:lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." -msgstr "" +msgstr "No es pot canviar el nom del fitxer %s%s%s%sa %s%s%s." #: lazarusidestrconsts:lisunabletorenameforminsource msgid "Unable to rename form in source." -msgstr "" +msgstr "No es pot canviar el nom de la forma en el codi font" #: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag msgid "Unable to rename method. Plz fix the error shown in the message window." -msgstr "" +msgstr "No es pot canviar el nom del mtode. Si us plau, corregeix l'error de la finestra de missatges." #: lazarusidestrconsts:lisunabletorenamevariableinsource msgid "Unable to rename variable in source." -msgstr "" +msgstr "No es pot canviar el nom de variable en el codi font." #: lazarusidestrconsts:lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" -msgstr "" +msgstr "No es pot executar l'eina %s%s%s:%s%s" #: lazarusidestrconsts:lisunabletosavefile msgid "Unable to save file %s%s%s" -msgstr "" +msgstr "No es pot guardar el fitxer %s%s%s" #: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage msgid "Unable to show method. Plz fix the error shown in the message window." -msgstr "" +msgstr "No es pot mostrar mtode. Si us plau, corregeix l'error de la finestra de missatges." #: lazarusidestrconsts:lisunabletostreamt msgid "Unable to stream %s:T%s." -msgstr "" +msgstr "No es pot afluir %s:T%s." #: lazarusidestrconsts:lisunabletostreamselectedcomponents msgid "Unable to stream selected components" -msgstr "" +msgstr "No es pot afluir els components seleccionats" #: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." -msgstr "" +msgstr "No es pot transformar afluent de component binari de %s:T%s a text." #: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" -msgstr "" +msgstr "No es pot actualitzar declaraci CreateForm en el codi font del projecte" #: lazarusidestrconsts:lisunabletowrite msgid "Unable to write %s%s%s%s%s." -msgstr "" +msgstr "No es pot escriure %s%s%s%s%s." #: lazarusidestrconsts:lisunabletowritefile msgid "Unable to write file" -msgstr "" +msgstr "No es pot escriure el fitxer" #: lazarusidestrconsts:lisunabletowritefile2 msgid "Unable to write file %s%s%s" -msgstr "" +msgstr "No es pot escriure el fitxer %s%s%s" #: lazarusidestrconsts:lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" -msgstr "" +msgstr "No es pot escriure el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts:lisunabletowritefilename msgid "Unable to write file %s%s%s." -msgstr "" +msgstr "No es pot escriure el fitxer %s%s%s." #: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" -msgstr "" +msgstr "No es pot escriure el paquet %s%s%s%sal fitxer %s%s%s.%sError: %s" #: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" -msgstr "" +msgstr "No es pot escriure el fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts:lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" -msgstr "" +msgstr "No es pot escriure al fitxer %s%s%s" #: lazarusidestrconsts:lisunabletowritetofile msgid "Unable to write to file %s%s%s!" -msgstr "" +msgstr "No es pot escriure al fitxer %s%s%s!" #: lazarusidestrconsts:dlguncertopt msgid "Uncertain Optimizations" @@ -6932,15 +6932,15 @@ msgstr "Treure comentari de la selecci #: lazarusidestrconsts:liscodetoolsdefsundefine msgid "Undefine" -msgstr "Des-definir" +msgstr "Indefinir" #: lazarusidestrconsts:liscodetoolsdefsundefineall msgid "Undefine All" -msgstr "Des-definir tot" +msgstr "Indefinir-ho tot" #: lazarusidestrconsts:liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" -msgstr "Des-definir el recurs" +msgstr "Indefinir el recurs" #: lazarusidestrconsts:dlgedunder msgid "Underline" @@ -6956,11 +6956,11 @@ msgstr "Desfer despr #: lazarusidestrconsts:dlgundolimit msgid "Undo limit:" -msgstr "Lmit de desfer" +msgstr "Desfer:" #: lazarusidestrconsts:srkmecblockunindent msgid "Unindent block" -msgstr "Dessagna bloc" +msgstr "Dessagnar bloc" #: lazarusidestrconsts:lismenuunindentselection msgid "Unindent selection" @@ -6968,23 +6968,23 @@ msgstr "Dessagnar selecci #: lazarusidestrconsts:lispckedituninstall msgid "Uninstall" -msgstr "" +msgstr "Desinstallar" #: lazarusidestrconsts:lispckexpluninstallonnextstart msgid "Uninstall on next start" -msgstr "" +msgstr "Desinstallar en el proper inici" #: lazarusidestrconsts:lispkgmanguninstallpackage2 msgid "Uninstall package %s?" -msgstr "" +msgstr "Desinstallar el paquet %s?" #: lazarusidestrconsts:lispkgmanguninstallpackage msgid "Uninstall package?" -msgstr "" +msgstr "Desinstallar el paquet?" #: lazarusidestrconsts:lisuninstallselection msgid "Uninstall selection" -msgstr "" +msgstr "desinstallar la selecci" #: lazarusidestrconsts:lispkgfiletypeunit msgid "Unit" @@ -6992,15 +6992,15 @@ msgstr "Unitat" #: lazarusidestrconsts:lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" -msgstr "" +msgstr "La unitat %s%s%s ha canviat. Guardar-la?" #: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" -msgstr "" +msgstr "La unitat %s%s%s ha estat esborrada del paquet" #: lazarusidestrconsts:lisa2punitfilename2 msgid "Unit File Name:" -msgstr "" +msgstr "Nom de fitxer d'unitat:" #: lazarusidestrconsts:uemunitinfo msgid "Unit Info" @@ -7008,23 +7008,23 @@ msgstr "Informaci #: lazarusidestrconsts:lisa2punitnameinvalid msgid "Unit Name Invalid" -msgstr "" +msgstr "Nom d'unitat no vlid" #: lazarusidestrconsts:lisa2punitname msgid "Unit Name:" -msgstr "" +msgstr "Nom d'unitat:" #: lazarusidestrconsts:lisaf2punitname msgid "Unit Name: " -msgstr "" +msgstr "Nom d'unitat: " #: lazarusidestrconsts:lisunitoutputdirectory msgid "Unit Output directory" -msgstr "" +msgstr "Directori sortida d'unitat" #: lazarusidestrconsts:lispkgdefsunitpath msgid "Unit Path" -msgstr "" +msgstr "Trajectria d'unitat" #: lazarusidestrconsts:dlgcounitstyle msgid "Unit Style:" @@ -7036,35 +7036,35 @@ msgstr "Depend #: lazarusidestrconsts:lisa2punitfilename msgid "Unit file name:" -msgstr "" +msgstr "Nom de fitxer d'unitat:" #: lazarusidestrconsts:lisunitidentifierexists msgid "Unit identifier exists" -msgstr "" +msgstr "Ja existeix identificador d'unitat" #: lazarusidestrconsts:lisprojaddunitnamealreadyexists msgid "Unit name already exists" -msgstr "" +msgstr "Ja existeix el nom d'unitat" #: lazarusidestrconsts:lispkgsysunitnotfound msgid "Unit not found: %s%s%s" -msgstr "" +msgstr "Unitat no trobada: %s%s%s" #: lazarusidestrconsts:dlgunitoutp msgid "Unit output directory (-FE):" -msgstr "" +msgstr "Directori sortida d'unitat (-FE):" #: lazarusidestrconsts:lisunitsnotfound msgid "Unit(s) not found" -msgstr "" +msgstr "Unitat(s) no trobada(es)" #: lazarusidestrconsts:lisunitlfmfile msgid "Unit: %s%sLFM file: %s" -msgstr "" +msgstr "Unitat: %s%sfitxer LFM: %s" #: lazarusidestrconsts:lisa2punitnamealreadyexists msgid "Unitname already exists" -msgstr "" +msgstr "Ja existeix el nom d'unitat" #: lazarusidestrconsts:lisunitnamealreadyexistscap msgid "Unitname already in project" @@ -7080,11 +7080,11 @@ msgstr "Desconegut" #: lazarusidestrconsts:lisunknownerrorpleasereportthisbug msgid "Unknown Error, please report this bug" -msgstr "" +msgstr "Error desconegut, si us plau comunica'l" #: lazarusidestrconsts:lispkgmangunsavedpackage msgid "Unsaved package" -msgstr "" +msgstr "Paquet no guardat" #: lazarusidestrconsts:dlgupword msgid "Up" @@ -7092,7 +7092,7 @@ msgstr "Amunt" #: lazarusidestrconsts:lispckoptsupdaterebuild msgid "Update/Rebuild" -msgstr "" +msgstr "Actualitzar/Muntar de nou" #: lazarusidestrconsts:lismenuuppercaseselection msgid "Uppercase selection" @@ -7100,7 +7100,7 @@ msgstr "Ficar a maj #: lazarusidestrconsts:lispckoptsusage msgid "Usage" -msgstr "" +msgstr "Utilitzaci" #: lazarusidestrconsts:dlgcoansistr msgid "Use Ansi Strings" @@ -7112,11 +7112,11 @@ msgstr "Utilitzar unitat Heaptrc" #: lazarusidestrconsts:dlgusecustomconfig msgid "Use addional Compiler Config File" -msgstr "" +msgstr "Utilitzar fitxer de configuraci addicional del compilador" #: lazarusidestrconsts:dlgedusedefcolor msgid "Use default color" -msgstr "Utilitzar color per defecte" +msgstr "Utilitzar color per omissi" #: lazarusidestrconsts:dlgrunousedisplay msgid "Use display" @@ -7124,11 +7124,11 @@ msgstr "Utilitzar pantalla" #: lazarusidestrconsts:dlguselaunchingapp msgid "Use launching application" -msgstr "Utilitzar aplicaci executada" +msgstr "Utilitzar aplicaci llanadora" #: lazarusidestrconsts:dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" -msgstr "" +msgstr "Utilitzar fitxer de configuraci normalitzat (fpc.cfg)" #: lazarusidestrconsts:dlgusesyntaxhighlight msgid "Use syntax highlight" @@ -7140,7 +7140,7 @@ msgstr "Utilitzar par #: lazarusidestrconsts:srkmecuserfirst msgid "User First" -msgstr "Primer l'usuari" +msgstr "Primer usuari" #: lazarusidestrconsts:dlgedcustomext msgid "User defined extension" @@ -7172,7 +7172,7 @@ msgstr "Variable" #: lazarusidestrconsts:lisctdefvariablename msgid "Variable Name" -msgstr "" +msgstr "Nom de variable" #: lazarusidestrconsts:dlgcdtvariableprefix msgid "Variable prefix" @@ -7184,11 +7184,11 @@ msgstr "variable:" #: lazarusidestrconsts:lisctdefvariable msgid "Variable: %s" -msgstr "" +msgstr "Variable: %s" #: lazarusidestrconsts:dlgverbosity msgid "Verbosity during compilation:" -msgstr "" +msgstr "Verbositat durant la compilaci:" #: lazarusidestrconsts:lisversion msgid "Version" @@ -7196,31 +7196,31 @@ msgstr "Versi #: lazarusidestrconsts:lisvertical msgid "Vertical" -msgstr "" +msgstr "Vertical" #: lazarusidestrconsts:dlggridyhint msgid "Vertical grid step size" -msgstr "" +msgstr "Tamany vertical de pas de graella" #: lazarusidestrconsts:lismenuviewanchoreditor msgid "View Anchor Editor" -msgstr "" +msgstr "Mostrar editor d'ncores" #: lazarusidestrconsts:uemviewcallstackcursor msgid "View Call Stack" -msgstr "" +msgstr "Mostrar la pila de les crides" #: lazarusidestrconsts:srkmectogglecodeexpl msgid "View Code Explorer" -msgstr "" +msgstr "Mostrar explorador de codi" #: lazarusidestrconsts:lishintviewforms msgid "View Forms" -msgstr "Visualitzar formes" +msgstr "Mostrar formes" #: lazarusidestrconsts:lismenuviewjumphistory msgid "View Jump-History" -msgstr "Visualitzar histria de salts" +msgstr "Mostrar histria de salts" #: lazarusidestrconsts:srkmectoggleobjectinsp msgid "View Object Inspector" @@ -7228,43 +7228,43 @@ msgstr "Mostrar l'inspector d'objectes" #: lazarusidestrconsts:lispckeditviewpackgesource msgid "View Package Source" -msgstr "" +msgstr "Mostrar fonts dels paquets" #: lazarusidestrconsts:lisviewprojectunits msgid "View Project Units" -msgstr "" +msgstr "Mostrar unitats del projecte" #: lazarusidestrconsts:srkmectogglesearchresults msgid "View Search Results" -msgstr "" +msgstr "Mostrar resultats de recerca" #: lazarusidestrconsts:lismenuviewsource msgid "View Source" -msgstr "Visualitzar font" +msgstr "Mostrar font" #: lazarusidestrconsts:srkmectogglesourceeditor msgid "View Source Editor" -msgstr "" +msgstr "Mostrar editor del codi font" #: lazarusidestrconsts:lismenuviewprojecttodos msgid "View ToDo List" -msgstr "Visualitzar llista de coses a fer" +msgstr "Mostrar llista ToDo" #: lazarusidestrconsts:lismenuviewunitdependencies msgid "View Unit Dependencies" -msgstr "Visualitza dependncies de les unitats" +msgstr "Mostrar dependncies de les unitats" #: lazarusidestrconsts:lismenuviewunitinfo msgid "View Unit Information" -msgstr "" +msgstr "Mostrar informaci d'unitats" #: lazarusidestrconsts:lishintviewunits msgid "View Units" -msgstr "Visualitzar unitats" +msgstr "Mostrar unitats" #: lazarusidestrconsts:srkmecviewanchoreditor msgid "View anchor editor" -msgstr "" +msgstr "Mostrar editor d'ncores" #: lazarusidestrconsts:srkmectogglebreakpoints msgid "View breakpoints" @@ -7272,7 +7272,7 @@ msgstr "Mostrar punts de control" #: lazarusidestrconsts:srkmectogglecallstack msgid "View call stack" -msgstr "Mostrar les crides a la pila" +msgstr "Mostrar la pila de les crides" #: lazarusidestrconsts:srkmectoggledebuggerout msgid "View debugger output" @@ -7280,7 +7280,7 @@ msgstr "Mostrar la sortida del depurador" #: lazarusidestrconsts:srkmecviewforms msgid "View forms" -msgstr "" +msgstr "Mostrar formes" #: lazarusidestrconsts:srkmectogglelocals msgid "View local variables" @@ -7288,7 +7288,7 @@ msgstr "Mostrar les variables locals" #: lazarusidestrconsts:srkmcatviewmenu msgid "View menu commands" -msgstr "Mostrar comandaments de men" +msgstr "Mostrar ordres de men" #: lazarusidestrconsts:srkmectogglemessages msgid "View messages" @@ -7304,15 +7304,15 @@ msgstr "Mostrar les unitats del projecte" #: lazarusidestrconsts:srkmecviewunitdependencies msgid "View unit dependencies" -msgstr "" +msgstr "Mostrar dependncies de les unitats" #: lazarusidestrconsts:srkmecviewunitinfo msgid "View unit information" -msgstr "" +msgstr "Mostrar informaci d'unitat" #: lazarusidestrconsts:srkmecviewunits msgid "View units" -msgstr "" +msgstr "Mostrar unitats" #: lazarusidestrconsts:srkmectogglewatches msgid "View watches" @@ -7320,15 +7320,15 @@ msgstr "Mostrar vigilants" #: lazarusidestrconsts:lishlpoptsviewers msgid "Viewers" -msgstr "" +msgstr "Visualitzadors" #: lazarusidestrconsts:lispkgfiletypevirtualunit msgid "Virtual Unit" -msgstr "" +msgstr "Unitat virtual" #: lazarusidestrconsts:lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" -msgstr "" +msgstr "Unitat virtual (el codi font no s al paquet)" #: lazarusidestrconsts:dlgvisiblegutter msgid "Visible gutter" @@ -7344,15 +7344,15 @@ msgstr "Avisar al compilar" #: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." -msgstr "" +msgstr "Avs: El fitxer de configuraci addicional del compilador t el mateix nom que un dels fitxers normalitzats de configuraci que utilitza el FreePascal. Aix pot comportar que NOMS s'analitzi el fitxer addicional i es salti el normalitzat." #: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." -msgstr "" +msgstr "Avs: El fitxer %s%s%s%spertany al projecte actual." #: lazarusidestrconsts:liswarningambigiousfilefoundsourcefileis msgid "Warning: ambigious file found: %s%s%s. Source file is: %s%s%s" -msgstr "" +msgstr "Avs: s'ha trobat el fitxer ambigu: %s%s%s. El fitxer font s: %s%s%s" #: lazarusidestrconsts:lismenuviewwatches msgid "Watches" @@ -7364,7 +7364,7 @@ msgstr "En crear noves formes, afegir-les a les formes creades autom #: lazarusidestrconsts:lisfindfilewhere msgid "Where" -msgstr "" +msgstr "On" #: lazarusidestrconsts:dlgwholewordsonly msgid "Whole Words Only" @@ -7372,7 +7372,7 @@ msgstr "Nom #: lazarusidestrconsts:lisfindfilewholewordsonly msgid "Whole words only" -msgstr "" +msgstr "Noms paraules senceres" #: lazarusidestrconsts:dlgwidthpos msgid "Width:" @@ -7384,11 +7384,11 @@ msgstr "Posicions de les finestres" #: lazarusidestrconsts:dlgwindows msgid "Windows" -msgstr "" +msgstr "Finestres" #: lazarusidestrconsts:lislazbuildwithstaticpackages msgid "With Packages" -msgstr "Amb paquets" +msgstr "En paquets" #: lazarusidestrconsts:liswordatcursorincurrenteditor msgid "Word at cursor in current editor" @@ -7404,7 +7404,7 @@ msgstr "Paraules" #: lazarusidestrconsts:lisedtexttoolworkingdirectory msgid "Working Directory:" -msgstr "" +msgstr "Directori de treball:" #: lazarusidestrconsts:dlgroworkingdirectory msgid "Working directory" @@ -7412,11 +7412,11 @@ msgstr "Directori de treball" #: lazarusidestrconsts:liswriteerror msgid "Write Error" -msgstr "" +msgstr "Error d'escriptura" #: lazarusidestrconsts:dlgwritefpclogo msgid "Write an FPC logo" -msgstr "" +msgstr "Escriure un logotipus FPC" #: lazarusidestrconsts:liscodetoolsdefswriteerror msgid "Write error" @@ -7428,7 +7428,7 @@ msgstr "Prefix d'escriure" #: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." -msgstr "" +msgstr "No pots muntar el lazarus mentre s'est depurant o compilant." #: lazarusidestrconsts:dlgdoesnotexist msgid "\" does not exist." @@ -7440,39 +7440,39 @@ msgstr "\" no es pot escriure" #: lazarusidestrconsts:srkmecabortbuild msgid "abort build" -msgstr "" +msgstr "avortar el muntatje" #: lazarusidestrconsts:srkmecaddbreakpoint msgid "add break point" -msgstr "" +msgstr "afegir punt de ruptura" #: lazarusidestrconsts:srkmecaddwatch msgid "add watch" -msgstr "" +msgstr "afegir vigilant" #: lazarusidestrconsts:srvk_apps msgid "application key" -msgstr "Tecla d'aplicaci" +msgstr "tecla d'aplicaci" #: lazarusidestrconsts:lisoipautoinstalldynamic msgid "auto install dynamic" -msgstr "" +msgstr "auto intallar dinmicament" #: lazarusidestrconsts:lisoipautoinstallstatic msgid "auto install static" -msgstr "" +msgstr "auto intallar estticament" #: lazarusidestrconsts:srkmecbuildall msgid "build all files of program/project" -msgstr "Construir tot els fitxers del programa/projecte" +msgstr "muntar tot els fitxers del programa/projecte" #: lazarusidestrconsts:srkmecbuildfile msgid "build file" -msgstr "" +msgstr "muntar fitxer" #: lazarusidestrconsts:srkmecbuild msgid "build program/project" -msgstr "Construir el programa/projecte" +msgstr "muntar el programa/projecte" #: lazarusidestrconsts:dlglefttopclr msgid "color for left, top" @@ -7484,27 +7484,27 @@ msgstr "Color per dreta, avall" #: lazarusidestrconsts:srkmeccompileroptions msgid "compiler options" -msgstr "" +msgstr "opcions del compilador" #: lazarusidestrconsts:liscodetoolsdefscompilerpath msgid "compiler path" -msgstr "Trajectria del compilador" +msgstr "trajectria del compilador" #: lazarusidestrconsts:srkmecconfigbuildfile msgid "config build file" -msgstr "" +msgstr "fitxer de configuraci de muntatje" #: lazarusidestrconsts:liscustomoptions msgid "custom options" -msgstr "" +msgstr "opcions personalitzades" #: lazarusidestrconsts:liscodefault msgid "default (%s)" -msgstr "" +msgstr "pred. (%s)" #: lazarusidestrconsts:srkmecevaluate msgid "evaluate/modify" -msgstr "" +msgstr "avaluar/modificar" #: lazarusidestrconsts:lisuidinproject msgid "in Project:" @@ -7512,55 +7512,55 @@ msgstr "en projecte:" #: lazarusidestrconsts:lisfriinallopenpackagesandprojects msgid "in all open packages and projects" -msgstr "" +msgstr "en tots els projectes i paquets oberts" #: lazarusidestrconsts:lisfriincurrentunit msgid "in current unit" -msgstr "" +msgstr "en la unitat actual" #: lazarusidestrconsts:lisfriinmainproject msgid "in main project" -msgstr "" +msgstr "en el projecte principal" #: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" -msgstr "" +msgstr "en el projecte/paquet que es propietari de la unitat actual" #: lazarusidestrconsts:lisincludepath msgid "include path" -msgstr "" +msgstr "trajectria d'inclosos" #: lazarusidestrconsts:srkmecinspect msgid "inspect" -msgstr "" +msgstr "inspeccionar" #: lazarusidestrconsts:lisoipinstalleddynamic msgid "installed dynamic" -msgstr "" +msgstr "dinmicament installat" #: lazarusidestrconsts:lisoipinstalledstatic msgid "installed static" -msgstr "" +msgstr "estticament installat" #: lazarusidestrconsts:lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" -msgstr "" +msgstr "nom de fitxer de compilador no vlid" #: lazarusidestrconsts:lislazarusoptionsprojectfilename msgid "lazarus [options] " -msgstr "" +msgstr "lazarus [opcions] " #: lazarusidestrconsts:srvk_lwin msgid "left windows key" -msgstr "Tecles de finestres esquerres" +msgstr "tecla de finestres esquerres" #: lazarusidestrconsts:lislibrarypath msgid "library path" -msgstr "" +msgstr "trajectria de biblioteques" #: lazarusidestrconsts:lislinkeroptions msgid "linker options" -msgstr "" +msgstr "opcions de l'enllaador" #: lazarusidestrconsts:dlgcdtlower msgid "lowercase" @@ -7568,87 +7568,87 @@ msgstr "min #: lazarusidestrconsts:lisoipmissing msgid "missing" -msgstr "" +msgstr "falta" #: lazarusidestrconsts:lisoipmodified msgid "modified" -msgstr "" +msgstr "modificat" #: lazarusidestrconsts:lisuidno msgid "no" -msgstr "No" +msgstr "no" #: lazarusidestrconsts:lisnoname msgid "noname" -msgstr "" +msgstr "sense nom" #: lazarusidestrconsts:liscodetoolsdefsnoneselected msgid "none selected" -msgstr "Cap de seleccionat" +msgstr "cap de seleccionat" #: lazarusidestrconsts:lisobjectpath msgid "object path" -msgstr "" +msgstr "trajectria d'objectes" #: lazarusidestrconsts:lispckeditpackagenotsaved msgid "package %s not saved" -msgstr "" +msgstr "paquet %s no guardat" #: lazarusidestrconsts:lispkgmangpackagemainsourcefile msgid "package main source file" -msgstr "" +msgstr "fitxer de codi font principal del paquet" #: lazarusidestrconsts:srkmecpause msgid "pause program" -msgstr "Pausar el programa" +msgstr "pausar el programa" #: lazarusidestrconsts:lisoipreadonly msgid "readonly" -msgstr "" +msgstr "noms de lectura" #: lazarusidestrconsts:srkmecremovebreakpoint msgid "remove break point" -msgstr "" +msgstr "esborrar punt de ruptura" #: lazarusidestrconsts:srkmecresetdebugger msgid "reset debugger" -msgstr "" +msgstr "reiniciar depurador" #: lazarusidestrconsts:srvk_rwin msgid "right windows key" -msgstr "Tecles de finestres dretes" +msgstr "tecla de finestres dretes" #: lazarusidestrconsts:srkmecrunfile msgid "run file" -msgstr "" +msgstr "executar fitxer" #: lazarusidestrconsts:srkmecrunparameters msgid "run parameters" -msgstr "" +msgstr "executar parmetres" #: lazarusidestrconsts:srkmecrun msgid "run program" -msgstr "Executar el programa" +msgstr "executar el programa" #: lazarusidestrconsts:lissaveallmodified msgid "save all modified files" -msgstr "Guardar tots els fitxers modificats" +msgstr "guardar tots els fitxers modificats" #: lazarusidestrconsts:lissavecurrenteditorfile msgid "save current editor file" -msgstr "Guardar fitxer editor actual" +msgstr "guardar fitxer editor actual" #: lazarusidestrconsts:lisfindfilesearchallfilesinproject msgid "search all files in project" -msgstr "" +msgstr "buscar tots els fitxers en el projecte" #: lazarusidestrconsts:lisfindfilesearchallopenfiles msgid "search all open files" -msgstr "" +msgstr "buscar tots els fitxers oberts" #: lazarusidestrconsts:lisfindfilesearchindirectories msgid "search in directories" -msgstr "" +msgstr "buscar en directoris" #: lazarusidestrconsts:dlgtimesecondunit msgid "sec" @@ -7656,57 +7656,57 @@ msgstr "segons" #: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" -msgstr "" +msgstr "ficar mode FPC a DELPHI" #: lazarusidestrconsts:lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" -msgstr "" +msgstr "ficar mode FPC a GPC" #: lazarusidestrconsts:lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" -msgstr "" +msgstr "ficar mode FPC aTP" #: lazarusidestrconsts:lisedtdefsetiocheckson msgid "set IOCHECKS on" -msgstr "" +msgstr "activar IOCHECKS" #: lazarusidestrconsts:lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" -msgstr "" +msgstr "activar OVERFLOWCHECKS" #: lazarusidestrconsts:lisedtdefsetrangecheckson msgid "set RANGECHECKS on" -msgstr "" +msgstr "activar RANGECHECKS" #: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile msgid "static packages config file" -msgstr "" +msgstr "fitxer de configuraci de paquets esttics" #: lazarusidestrconsts:srkmecstopprogram msgid "stop program" -msgstr "Aturar el programa" +msgstr "aturar el programa" #: lazarusidestrconsts:listhishelpmessage msgid "this help message" -msgstr "" +msgstr "aquest missatge d'ajuda" #: lazarusidestrconsts:lisunitpath msgid "unit path" -msgstr "" +msgstr "trajectria d'unitats" #: lazarusidestrconsts:srkmecunknown msgid "unknown editor command" -msgstr "Comandament de l'editor desconegut" +msgstr "ordre de l'editor desconeguda" #: lazarusidestrconsts:lisedtdefuseheaptrcunit msgid "use HeapTrc unit" -msgstr "" +msgstr "utilitzar unitat HeapTrc" #: lazarusidestrconsts:lisedtdefuselineinfounit msgid "use LineInfo unit" -msgstr "" +msgstr "utilitzar unitat LineInfo" #: lazarusidestrconsts:lisuidyes msgid "yes" -msgstr "S" +msgstr "s" diff --git a/languages/lazaruside.de.po b/languages/lazaruside.de.po index 8072c1a5a0..122594fdc8 100644 --- a/languages/lazaruside.de.po +++ b/languages/lazaruside.de.po @@ -253,7 +253,7 @@ msgid "(unknown macro: %s)" msgstr "(unbekanntes Makro: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -264,6 +264,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Die Datei %s%s%s exitiert bereits.%sErsetzen?" @@ -3520,10 +3524,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" diff --git a/languages/lazaruside.es.po b/languages/lazaruside.es.po index 8d03059dfd..a2b3f5366d 100644 --- a/languages/lazaruside.es.po +++ b/languages/lazaruside.es.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(macro desconocida: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Ya existe el archivo %s%s%s.%sReemplazarlo?" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Editor v%s de Lazarus" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Lazarus Info Proyecto (*.lpi)|*.lpi|Todos los archivos|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Editor Lazarus del cdigo fuente" diff --git a/languages/lazaruside.esutf.po b/languages/lazaruside.esutf.po index 5436c14e8e..203b3ba5a2 100644 --- a/languages/lazaruside.esutf.po +++ b/languages/lazaruside.esutf.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(macro desconocida: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Ya existe el archivo %s%s%s.%s¿Reemplazarlo?" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Editor v%s de Lazarus" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Lazarus Info Proyecto (*.lpi)|*.lpi|Todos los archivos|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Editor Lazarus del código fuente" diff --git a/languages/lazaruside.fi.po b/languages/lazaruside.fi.po index 3622a54b84..055b0bca66 100644 --- a/languages/lazaruside.fi.po +++ b/languages/lazaruside.fi.po @@ -243,7 +243,7 @@ msgid "(unknown macro: %s)" msgstr "" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -254,6 +254,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? " @@ -3510,10 +3514,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" diff --git a/languages/lazaruside.fiwin.po b/languages/lazaruside.fiwin.po index ef988d2a63..a7a006659d 100644 --- a/languages/lazaruside.fiwin.po +++ b/languages/lazaruside.fiwin.po @@ -243,7 +243,7 @@ msgid "(unknown macro: %s)" msgstr "" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -254,6 +254,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? " @@ -3510,10 +3514,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" diff --git a/languages/lazaruside.fr.po b/languages/lazaruside.fr.po index b500a770c5..49f3e63420 100644 --- a/languages/lazaruside.fr.po +++ b/languages/lazaruside.fr.po @@ -253,7 +253,7 @@ msgid "(unknown macro: %s)" msgstr "(macro inconnue: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -264,6 +264,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Le fichier %s%s%s existe dj.%Le remplacer ?" @@ -3520,10 +3524,6 @@ msgstr "R msgid "Lazarus Editor v%s" msgstr "Editeur Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Info projet Lazarus (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Editeur de source Lazarus" diff --git a/languages/lazaruside.he.po b/languages/lazaruside.he.po index d147f29eb3..8727fd98e7 100644 --- a/languages/lazaruside.he.po +++ b/languages/lazaruside.he.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(%s :מקרו לא מוכר)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "<בחר קובץ קיים>" msgid "" msgstr "<לא נחבר משתנה>" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "?האם להחליפו%s.כבר קיים %s%s%s הקובץ" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" diff --git a/languages/lazaruside.it.po b/languages/lazaruside.it.po index 900b5c5f8c..4a48ba7ada 100644 --- a/languages/lazaruside.it.po +++ b/languages/lazaruside.it.po @@ -253,7 +253,7 @@ msgid "(unknown macro: %s)" msgstr "(macro sconosciuta: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -264,6 +264,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Un file %s%s%s esiste gia.%sLo rimpiazzo?" @@ -3520,10 +3524,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Editor Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Informazioni progetto Lazarus (*.lpi)|*.lpi|Tutti i file|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Editor sorgente di Lazarus" diff --git a/languages/lazaruside.itiso.po b/languages/lazaruside.itiso.po index 5bac23e07f..b7f3327ab0 100644 --- a/languages/lazaruside.itiso.po +++ b/languages/lazaruside.itiso.po @@ -253,7 +253,7 @@ msgid "(unknown macro: %s)" msgstr "(macro sconosciuta: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -264,6 +264,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Un file %s%s%s esiste gia.%sLo rimpiazzo?" @@ -3520,10 +3524,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Editor Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Informazioni progetto Lazarus (*.lpi)|*.lpi|Tutti i file|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Editor sorgente di Lazarus" diff --git a/languages/lazaruside.pl.po b/languages/lazaruside.pl.po index 847f111919..31e92deb67 100644 --- a/languages/lazaruside.pl.po +++ b/languages/lazaruside.pl.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(nieznane makro: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgid "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Plik %s%s%s już istnieje.%sChcesz go zastąpić?" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Lazarus wersja %s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Informacja o projekcie lazarusa (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Edytor źródeł" diff --git a/languages/lazaruside.pliso.po b/languages/lazaruside.pliso.po index 40cdf1d0f9..81be6b4143 100644 --- a/languages/lazaruside.pliso.po +++ b/languages/lazaruside.pliso.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(nieznane makro: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Plik %s%s%s ju istnieje.%sChcesz go zastpi?" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Lazarus wersja %s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Informacja o projekcie lazarusa (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Edytor rde" diff --git a/languages/lazaruside.plwin.po b/languages/lazaruside.plwin.po index cf78d6f2ed..a4f282eb38 100644 --- a/languages/lazaruside.plwin.po +++ b/languages/lazaruside.plwin.po @@ -254,7 +254,7 @@ msgid "(unknown macro: %s)" msgstr "(nieznane makro: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -265,6 +265,10 @@ msgstr "" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Plik %s%s%s ju istnieje.%sChcesz go zastpi?" @@ -3521,10 +3525,6 @@ msgstr "" msgid "Lazarus Editor v%s" msgstr "Lazarus wersja %s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Informacja o projekcie lazarusa (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Edytor rde" diff --git a/languages/lazaruside.po b/languages/lazaruside.po index 11ffc301fb..00978965fe 100644 --- a/languages/lazaruside.po +++ b/languages/lazaruside.po @@ -3,7 +3,7 @@ msgid "Enter translation language" msgstr "" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisleaveemptyfo @@ -830,10 +830,6 @@ msgstr "" msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "" - #: lazarusidestrconsts:liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "" @@ -5214,6 +5210,10 @@ msgstr "" msgid "Invalid parent" msgstr "" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "" diff --git a/languages/lazaruside.ru.po b/languages/lazaruside.ru.po index c69c3ea820..ce726b4904 100644 --- a/languages/lazaruside.ru.po +++ b/languages/lazaruside.ru.po @@ -243,7 +243,7 @@ msgid "(unknown macro: %s)" msgstr "( : %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -254,6 +254,10 @@ msgstr "< msgid "" msgstr "< >" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr " %s%s%s .%s ?" @@ -3510,10 +3514,6 @@ msgstr " msgid "Lazarus Editor v%s" msgstr " Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr " Lazarus (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr " Lazarus" diff --git a/languages/lazaruside.ruutf.po b/languages/lazaruside.ruutf.po index f891bc57f5..b9b7d31f1c 100644 --- a/languages/lazaruside.ruutf.po +++ b/languages/lazaruside.ruutf.po @@ -243,7 +243,7 @@ msgid "(unknown macro: %s)" msgstr "(неизвестный макрос: %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -254,6 +254,10 @@ msgstr "<выберите существующий файл>" msgid "" msgstr "<Не выбрано переменных>" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Файл %s%s%s уже существует.%s Заменить?" @@ -3510,10 +3514,6 @@ msgstr "Каталог Lazarus" msgid "Lazarus Editor v%s" msgstr "Редактор Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr "Сведения о проекте Lazarus (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "Редактор исходного кода Lazarus" diff --git a/languages/lazaruside.ruwin.po b/languages/lazaruside.ruwin.po index 4e450e72fb..6327b547ad 100644 --- a/languages/lazaruside.ruwin.po +++ b/languages/lazaruside.ruwin.po @@ -243,7 +243,7 @@ msgid "(unknown macro: %s)" msgstr "( : %s)" #: lazarusidestrconsts:lislazarusversionstring -msgid "0.9.5 beta" +msgid "0.9.7 beta" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile @@ -254,6 +254,10 @@ msgstr "< msgid "" msgstr "< >" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr " %s%s%s .%s ?" @@ -3510,10 +3514,6 @@ msgstr " msgid "Lazarus Editor v%s" msgstr " Lazarus v%s" -#: lazarusidestrconsts:lislazarusprojectinfolpilpiallfiles -msgid "Lazarus Project Info (*.lpi)|*.lpi|All Files|*.*" -msgstr " Lazarus (*.lpi)|*.lpi|All Files|*.*" - #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr " Lazarus" diff --git a/languages/objinspstrconsts.ca.po b/languages/objinspstrconsts.ca.po index a71307320a..d9ccf9ce1f 100644 --- a/languages/objinspstrconsts.ca.po +++ b/languages/objinspstrconsts.ca.po @@ -16,15 +16,15 @@ msgstr " Imatge seleccionada " #: objinspstrconsts:oishelpalreadyregistered msgid "%s: Already registered" -msgstr "" +msgstr "%s: Ja registrat" #: objinspstrconsts:oishelpnotregistered msgid "%s: Not registered" -msgstr "" +msgstr "%s: No registrat" #: objinspstrconsts:oisitemsselected msgid "%u items selected" -msgstr "" +msgstr "%u elements seleccionats" #: objinspstrconsts:oiscadd msgid "&Add" @@ -32,43 +32,43 @@ msgstr "&Afegir" #: objinspstrconsts:oiscancel msgid "&Cancel" -msgstr "" +msgstr "&Cancellar" #: objinspstrconsts:oiscdelete msgid "&Delete" -msgstr "&Esborrar" +msgstr "E&sborrar" #: objinspstrconsts:oisload msgid "&Load" -msgstr "" +msgstr "Ca&rregar" #: objinspstrconsts:oisok msgid "&OK" -msgstr "" +msgstr "D'ac&ord" #: objinspstrconsts:oissave msgid "&Save" -msgstr "" +msgstr "&Guardar" #: objinspstrconsts:cactionlisteditorallcategory msgid "(All)" -msgstr "" +msgstr "(Tot)" #: objinspstrconsts:cactionlisteditorunknowncategory msgid "(Unknown)" -msgstr "" +msgstr "(Desconegut)" #: objinspstrconsts:oisaction msgid "Action" -msgstr "" +msgstr "Acci" #: objinspstrconsts:oisactionlisteditor msgid "Action List Editor" -msgstr "" +msgstr "Editor de llista d'accions" #: objinspstrconsts:oisadd msgid "Add" -msgstr "" +msgstr "Afegir" #: objinspstrconsts:sccsilbtnadd msgid "Add ..." @@ -76,43 +76,43 @@ msgstr "Afegir ..." #: objinspstrconsts:oisall msgid "All" -msgstr "" +msgstr "Tot" #: objinspstrconsts:oisallfiles msgid "All files (*.*)|*.*" -msgstr "" +msgstr "Tots els fitxers (*.*)|*.*" #: objinspstrconsts:oisarray msgid "Array" -msgstr "" +msgstr "Conjunt" #: objinspstrconsts:oisboolean msgid "Boolean" -msgstr "" +msgstr "Boole" #: objinspstrconsts:oishelpbrowsernotexecutable msgid "Browser %s%s%s not executable." -msgstr "" +msgstr "Navegador %s%s%s no executable." #: objinspstrconsts:oishelpbrowsernotfound msgid "Browser %s%s%s not found." -msgstr "" +msgstr "Navegador %s%s%s no trobat." #: objinspstrconsts:oisclear msgid "C&lear" -msgstr "" +msgstr "Ne&tejar" #: objinspstrconsts:oiscategory msgid "Category" -msgstr "" +msgstr "Categoria" #: objinspstrconsts:oischar msgid "Char" -msgstr "" +msgstr "Carcter" #: objinspstrconsts:oisclass msgid "Class" -msgstr "" +msgstr "Classe" #: objinspstrconsts:sccsilbtnclear msgid "Clear" @@ -120,7 +120,7 @@ msgstr "Netejar" #: objinspstrconsts:oisconfirmdelete msgid "Confirm delete" -msgstr "" +msgstr "Confirmar esborrar" #: objinspstrconsts:sccsilconfirme msgid "Confirme clear all images ?" @@ -128,7 +128,7 @@ msgstr "Confirmar esborrar totes les imatges ?" #: objinspstrconsts:oiscreatedefaultevent msgid "Create default event" -msgstr "" +msgstr "Crear esdeveniment predeterminat" #: objinspstrconsts:sccslvedtbtndel msgid "Delete" @@ -136,31 +136,31 @@ msgstr "Esborrar" #: objinspstrconsts:oisdeleteitem msgid "Delete item %s%s%s?" -msgstr "" +msgstr "Esborrar element %s%s%s?" #: objinspstrconsts:oiseditactionlist msgid "Edit action list..." -msgstr "" +msgstr "Editar llista d'accions..." #: objinspstrconsts:oisenumeration msgid "Enumeration" -msgstr "" +msgstr "Enumeraci" #: objinspstrconsts:oiserror msgid "Error" -msgstr "" +msgstr "Error" #: objinspstrconsts:oiserrorloadingimage msgid "Error loading image" -msgstr "" +msgstr "Error carregant imatge" #: objinspstrconsts:oiserrorloadingimage2 msgid "Error loading image %s%s%s:%s%s" -msgstr "" +msgstr "Error carregant imatge %s%s%s:%s%s" #: objinspstrconsts:oishelperrorwhileexecuting msgid "Error while executing %s%s%s:%s%s" -msgstr "" +msgstr "Error executant %s%s%s:%s%s" #: objinspstrconsts:oisevents msgid "Events" @@ -168,35 +168,35 @@ msgstr "Esdeveniments" #: objinspstrconsts:oisfloat msgid "Float" -msgstr "" +msgstr "Float" #: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" -msgstr "" +msgstr "La base de dades d'ajuda %s%s%s no ha trobat un visor per a la pgina d'ajuda del tipus %s" #: objinspstrconsts:oishelphelpdatabasenotfound msgid "Help Database %s%s%s not found" -msgstr "" +msgstr "No s'ha trobat la base de dades de l'ajuda %s%s%s" #: objinspstrconsts:oishelphelpcontextnotfoundindatabase msgid "Help context %s not found in Database %s%s%s." -msgstr "" +msgstr "El context d'ajuda %s no s'ha trobat en la base de dades %s%s%s." #: objinspstrconsts:oishelphelpcontextnotfound msgid "Help context %s not found." -msgstr "" +msgstr "No s'ha trobat el context d'ajuda %s." #: objinspstrconsts:oishelphelpkeywordnotfoundindatabase msgid "Help keyword %s%s%s not found in Database %s%s%s." -msgstr "" +msgstr "Paraula clau d'ajuda %s%s%s no trobada en base de dades %s%s%s." #: objinspstrconsts:oishelphelpkeywordnotfound msgid "Help keyword %s%s%s not found." -msgstr "" +msgstr "Paraula clau d'ajuda %s%s%s no trobada." #: objinspstrconsts:oishelphelpnodehasnohelpdatabase msgid "Help node %s%s%s has no Help Database" -msgstr "" +msgstr "El node d'ajuda %s%s%s no t base de dades d'ajuda" #: objinspstrconsts:sccslvedtimgindexcaption msgid "Image index" @@ -208,15 +208,15 @@ msgstr "Editor de llista d'imatges" #: objinspstrconsts:oisint64 msgid "Int64" -msgstr "" +msgstr "Int64" #: objinspstrconsts:oisinteger msgid "Integer" -msgstr "" +msgstr "Integer" #: objinspstrconsts:oisinterface msgid "Interface" -msgstr "" +msgstr "Interface" #: objinspstrconsts:sccslvedtlabcaption msgid "Label" @@ -228,11 +228,11 @@ msgstr "Editor de ListView" #: objinspstrconsts:oisloadimagedialog msgid "Load Image Dialog" -msgstr "" +msgstr "Carregar dileg d'imatge" #: objinspstrconsts:oismethod msgid "Method" -msgstr "" +msgstr "Mtode" #: objinspstrconsts:sccslvedtbtnadd msgid "New" @@ -240,15 +240,15 @@ msgstr "Nou" #: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" -msgstr "" +msgstr "No s'ha trobat navegador HTML.%sSi us plau, defineix-ne un a Ajuda -> Configurar Ajuda -> Visors" #: objinspstrconsts:oishelpnohelpfoundforsource msgid "No help found for line %d, column %d of %s." -msgstr "" +msgstr "No s'ha trobat ajuda per la lnia %d, columna %d de %s." #: objinspstrconsts:oisobject msgid "Object" -msgstr "" +msgstr "Objecte" #: objinspstrconsts:oisobjectinspector msgid "Object Inspector" @@ -260,69 +260,69 @@ msgstr "Propietats" #: objinspstrconsts:oisrecord msgid "Record" -msgstr "" +msgstr "Registre" #: objinspstrconsts:oisselectafile msgid "Select a file" -msgstr "" +msgstr "Seleccionar un fitxer" #: objinspstrconsts:oisset msgid "Set" -msgstr "" +msgstr "Ficar" #: objinspstrconsts:oissettodefaultvalue msgid "Set to default value" -msgstr "" +msgstr "Ficar a valor predeterminat" #: objinspstrconsts:oissettodefault msgid "Set to default: %s" -msgstr "" +msgstr "Ficar a predeterminat: %s" #: objinspstrconsts:oissort msgid "Sort" -msgstr "" +msgstr "Classificar" #: objinspstrconsts:oisstring msgid "String" -msgstr "" +msgstr "Cadena" #: objinspstrconsts:cesstringgrideditor2 msgid "StringGrid Editor" -msgstr "" +msgstr "Editor de Cadena De la Graella" #: objinspstrconsts:cesstringgrideditor msgid "StringGrid Editor ..." -msgstr "" +msgstr "Editor de Cadena de la Graella ..." #: objinspstrconsts:oisstringseditordialog msgid "Strings Editor Dialog" -msgstr "" +msgstr "Dileg editor de cadenes" #: objinspstrconsts:sccslvedtbtnaddsub msgid "Sub item" -msgstr "Sub-element" +msgstr "Sot-element" #: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile msgid "The help database %s%s%s was unable to find file %s%s%s." -msgstr "" +msgstr "La base de dades de l'ajuda %s%s%s no pot trobat el fitxer %s%s%s." #: objinspstrconsts:oishelpthemacrosinbrowserparamswillbereplacedbytheurl msgid "The macro %s in BrowserParams will be replaced by the URL." -msgstr "" +msgstr "La macroinstrucci %s en el parmetres del navegador ser reemplaada per la URL." #: objinspstrconsts:oisunknown msgid "Unknown" -msgstr "" +msgstr "Desconegut" #: objinspstrconsts:oisvalue msgid "Value:" -msgstr "" +msgstr "Valor" #: objinspstrconsts:oisvariant msgid "Variant" -msgstr "" +msgstr "Variant" #: objinspstrconsts:oisword msgid "Word" -msgstr "" +msgstr "Paraula" diff --git a/lcl/languages/lcl.ca.po b/lcl/languages/lcl.ca.po index b03367cdeb..ab5d750618 100644 --- a/lcl/languages/lcl.ca.po +++ b/lcl/languages/lcl.ca.po @@ -1,26 +1,26 @@ #: lclstrconsts:rsmodified msgid " modified " -msgstr "" +msgstr " modificat " #: lclstrconsts:rssize msgid " size " -msgstr "" +msgstr " tamany " #: lclstrconsts:rswarningunreleasedtimerinfos msgid " WARNING: There are %d TimerInfo structures left, I'll free them" -msgstr " Avs: s'ha deixat %s estructures TimerInfo, les allibero" +msgstr " Avs: s'han perdut %d estructures TimerInfo, les allibero" #: lclstrconsts:rswarningunreleasedmessagesinqueue msgid " WARNING: There are %d messages left in the queue! I'll free them" -msgstr " Avs: Hi ha %d missatges a la cua!, els allibero" +msgstr " Avs: Hi ha %d missatges perduts a la cua!, els allibero" #: lclstrconsts:rswarningunreleaseddcsdump msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" -msgstr " Avs: hi ha %d DCs no llenats, informaci detallada :" +msgstr " Avs: hi ha %d DCs no llenats, informaci detallada segueix:" #: lclstrconsts:rswarningunreleasedgdiobjectsdump msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:" -msgstr " Avs: hi ha %d GDIObjects no llenats, informaci detallada segueix:" +msgstr " Avs: Hi ha %d GDIObjects no llenats, informaci detallada segueix:" #: lclstrconsts:rswarningunremovedpaintmessages msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left." @@ -56,7 +56,7 @@ msgstr "&No" #: lclstrconsts:rsmbok msgid "&OK" -msgstr "&Ok" +msgstr "D'ac&Ord" #: lclstrconsts:rsmbretry msgid "&Retry" @@ -72,7 +72,7 @@ msgstr "(fitxer no trobat: \"%s\")" #: lclstrconsts:rsgtkoptionclass msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." -msgstr "" +msgstr "--class nomdeclasse Seguint les convencions Xt, la classe d'un programa s el nom del programa amb el primer carcter amb majscules. Per exemple, el nom de classe pel gimp s \"Gimp\". Si s'especifica --class, la classe del programa s'ha de ficar a \"classname\"." #: lclstrconsts:rsgtkoptiondisplay msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." @@ -80,7 +80,7 @@ msgstr "--display h:s:d Connectar al servidor X especificat, on \"h\" #: lclstrconsts:rsgoptionfatalwarnings msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." -msgstr "" +msgstr "--g-fatal-warnings Avisos i error generats per Gtk+/GDK aturaran la aplicaci." #: lclstrconsts:rsgdkoptiondebug msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." @@ -96,11 +96,11 @@ msgstr "--gtk-debug senyaladors Activar missatges de seguiment/depuraci #: lclstrconsts:rsgtkoptionmodule msgid "--gtk-module module Load the specified module at startup." -msgstr "--gtk-module mdul Carregar el mdul especificat a l'engegar" +msgstr "--gtk-module mdul Carregar el mdul especificat a l'inici" #: lclstrconsts:rsgtkoptionnodebug msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." -msgstr "--gtk-no-debug senyaladors Desactivar missatges de seguiment/depuraci especfics de Gtk+" +msgstr "--gtk-no-debug assenyaladors Desactivar missatges de seguiment/depuraci especfics de Gtk+" #: lclstrconsts:rsgtkoptionnotransient msgid "--lcl-no-transient Do not set transient order for modal forms" @@ -116,7 +116,7 @@ msgstr "--no-xshm Deshabilitar l' #: lclstrconsts:rsgtkoptionsync msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." -msgstr "--sync Cridar XSyncronize (pantalla, True) desprs d'establir la connexi amb el servidor X. Aix fa la depuraci del protocol X, ms fcil, per que els errors de X es reben immediatament." +msgstr "--sync Cridar XSyncronize (display, True) desprs d'establir la connexi amb el servidor X. Aix fa la depuraci del protocol X, ms fcil, per que els errors de X es reben immediatament." #: lclstrconsts:rsacontrolcannothaveitselfasparent msgid "A control can't have itself as parent" @@ -128,15 +128,15 @@ msgstr "Avortar" #: lclstrconsts:ifsvk_accept msgid "Accept" -msgstr "" +msgstr "Acceptar" #: lclstrconsts:rsallfiles msgid "All files (%s)|%s|%s" -msgstr "" +msgstr "Tots els fitxers (%s)|%s|%s" #: lclstrconsts:ifsvk_back msgid "Backspace" -msgstr "" +msgstr "Retrocs" #: lclstrconsts:rsblank msgid "Blank" @@ -144,7 +144,7 @@ msgstr "Blanc" #: lclstrconsts:rscalculator msgid "Calculator" -msgstr "" +msgstr "Calculadora" #: lclstrconsts:rscannotfocus msgid "Can not focus" @@ -164,11 +164,11 @@ msgstr "Els patrons no permeten dibuixar" #: lclstrconsts:ifsvk_capital msgid "Capital" -msgstr "" +msgstr "Majscula" #: lclstrconsts:ifsvk_clear msgid "Clear" -msgstr "" +msgstr "Netejar" #: lclstrconsts:rsmtconfirmation msgid "Confirmation" @@ -176,11 +176,11 @@ msgstr "Confirmaci #: lclstrconsts:ifsvk_control msgid "Control" -msgstr "" +msgstr "Control" #: lclstrconsts:ifsvk_convert msgid "Convert" -msgstr "" +msgstr "Convertir" #: lclstrconsts:rscreatinggdbcatchableerror msgid "Creating gdb catchable error:" @@ -192,15 +192,15 @@ msgstr "Personalitzar" #: lclstrconsts:ifsvk_delete msgid "Delete" -msgstr "" +msgstr "Esborrar" #: lclstrconsts:rsfddirectorymustexist msgid "Directory must exist" -msgstr "" +msgstr "El directori ha d'existir" #: lclstrconsts:ifsvk_down msgid "Down" -msgstr "" +msgstr "Avall" #: lclstrconsts:sduplicatemenus msgid "Duplicate menus" @@ -212,7 +212,7 @@ msgstr "Error a la LCL" #: lclstrconsts:ifsvk_end msgid "End" -msgstr "" +msgstr "Final" #: lclstrconsts:rsmterror msgid "Error" @@ -220,7 +220,7 @@ msgstr "Error" #: lclstrconsts:rserrorcreatingdevicecontext msgid "Error creating device context for %s.%s" -msgstr "Error creant dispositiu de context per %s.%s" +msgstr "Error creant context de dispositiu per %s.%s" #: lclstrconsts:rserroroccurredinataddressframe msgid "Error occurred in %s at %sAddress %s%s Frame %s" @@ -236,7 +236,7 @@ msgstr "Error" #: lclstrconsts:ifsvk_escape msgid "Escape" -msgstr "" +msgstr "Escapar" #: lclstrconsts:rsexception msgid "Exception" @@ -244,7 +244,7 @@ msgstr "Excepci #: lclstrconsts:ifsvk_execute msgid "Execute" -msgstr "" +msgstr "Executar" #: lclstrconsts:rsfileinformation msgid "File information" @@ -260,11 +260,11 @@ msgstr "El fitxer ha d'existir" #: lclstrconsts:rsgtkfilter msgid "Filter:" -msgstr "" +msgstr "Filtre:" #: lclstrconsts:ifsvk_final msgid "Final" -msgstr "" +msgstr "Final" #: lclstrconsts:rsfixedcolstoobig msgid "FixedCols can't be >= ColCount" @@ -276,7 +276,7 @@ msgstr "FixedRows no pot ser >= RowCount" #: lclstrconsts:rsformstreamingerror msgid "Form streaming \"%s\" error: %s" -msgstr "Fluid de formes \"%s\" error: %s" +msgstr "Afluent de formes \"%s\" error: %s" #: lclstrconsts:rsgridfiledoesnotexists msgid "Grid file doesn't exists" @@ -288,23 +288,23 @@ msgstr "GroupIndex no pot ser menys que un GroupIndex d'un element anterior del #: lclstrconsts:ifsvk_hanja msgid "Hanja" -msgstr "" +msgstr "Hanja" #: lclstrconsts:ifsvk_help msgid "Help" -msgstr "" +msgstr "Ajuda" #: lclstrconsts:rsgtkhistory msgid "History:" -msgstr "" +msgstr "Histria:" #: lclstrconsts:ifsvk_home msgid "Home" -msgstr "" +msgstr "Inici" #: lclstrconsts:rsindexoutofrange msgid "Index Out of range Cell[Col=%d Row=%d]" -msgstr "ndex fora de rang Cell[Col=%d Row=%d]" +msgstr "ndex fora de l'abast Cell[Col=%d Row=%d]" #: lclstrconsts:rsmtinformation msgid "Information" @@ -312,11 +312,15 @@ msgstr "Informaci #: lclstrconsts:ifsvk_insert msgid "Insert" -msgstr "" +msgstr "Inserir" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Data no vlida:%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" @@ -336,7 +340,7 @@ msgstr "Enregistrament d'acci #: lclstrconsts:sinvalidactionunregistration msgid "Invalid action unregistration" -msgstr "Desenregistrament d'acci no vlid" +msgstr "Des-enregistrament d'acci no vlid" #: lclstrconsts:sinvalidimagesize msgid "Invalid image size" @@ -348,23 +352,23 @@ msgstr "Valor de propietat no v #: lclstrconsts:rsinvalidstreamformat msgid "Invalid stream format" -msgstr "Format de corrent no vlid" +msgstr "Format d'afluent no vlid" #: lclstrconsts:ifsvk_junja msgid "Junja" -msgstr "" +msgstr "Junja" #: lclstrconsts:ifsvk_kana msgid "Kana" -msgstr "" +msgstr "Kana" #: lclstrconsts:ifsvk_left msgid "Left" -msgstr "" +msgstr "Esquerra" #: lclstrconsts:rslistindexexceedsbounds msgid "List index exceeds bounds (%d)" -msgstr "" +msgstr "La llista d'index excedeix el lmit (%d)" #: lclstrconsts:rslistmustbeempty msgid "List must be empty" @@ -372,11 +376,11 @@ msgstr "La llista ha d'estar buida" #: lclstrconsts:ifsvk_menu msgid "Menu" -msgstr "" +msgstr "Men" #: lclstrconsts:smenuindexerror msgid "Menu index out of range" -msgstr "ndex de men fora de rang" +msgstr "ndex de men fora d'abast" #: lclstrconsts:smenuitemisnil msgid "MenuItem is nil" @@ -384,27 +388,27 @@ msgstr "El MenuItem #: lclstrconsts:ifsvk_modechange msgid "Mode Change" -msgstr "" +msgstr "Mode canvi" #: lclstrconsts:ifsvk_lbutton msgid "Mouse Button Left" -msgstr "" +msgstr "Boto esquerra del ratol" #: lclstrconsts:ifsvk_mbutton msgid "Mouse Button Middle" -msgstr "" +msgstr "Boto mig del ratol" #: lclstrconsts:ifsvk_rbutton msgid "Mouse Button Right" -msgstr "" +msgstr "Boto dret del ratol" #: lclstrconsts:ifsvk_next msgid "Next" -msgstr "" +msgstr "Segent" #: lclstrconsts:snomdiform msgid "No MDI form present." -msgstr "" +msgstr "No hi ha forma MDI present." #: lclstrconsts:rsnointerfaceobject msgid "No interface object. Plz check if the unit \"interfaces\" was added to the programs uses clause." @@ -420,7 +424,7 @@ msgstr "No a tot" #: lclstrconsts:ifsvk_nonconvert msgid "Nonconvert" -msgstr "" +msgstr "No convertir" #: lclstrconsts:rsnotavalidgridfile msgid "Not a valid grid file" @@ -428,11 +432,11 @@ msgstr "No #: lclstrconsts:ifsvk_numlock msgid "Numlock" -msgstr "" +msgstr "Bloqueig numric" #: lclstrconsts:ifsvk_numpad msgid "Numpad %d" -msgstr "" +msgstr "Teclat Numric %d" #: lclstrconsts:rsfdopenfile msgid "Open existing file" @@ -448,15 +452,15 @@ msgstr "La traject #: lclstrconsts:ifsvk_pause msgid "Pause key" -msgstr "" +msgstr "Tecla de pausa" #: lclstrconsts:ifsvk_print msgid "Print" -msgstr "" +msgstr "Imprimir" #: lclstrconsts:ifsvk_prior msgid "Prior" -msgstr "" +msgstr "Anterior" #: lclstrconsts:rspropertydoesnotexist msgid "Property %s does not exist" @@ -464,15 +468,15 @@ msgstr "La propietat %s no existeix" #: lclstrconsts:lislclresourcesnotfound msgid "Resource %s not found" -msgstr "" +msgstr "Recurs %s no trobat" #: lclstrconsts:ifsvk_return msgid "Return" -msgstr "" +msgstr "Retorn" #: lclstrconsts:ifsvk_right msgid "Right" -msgstr "" +msgstr "Dret" #: lclstrconsts:rsfdfilesaveas msgid "Save file as" @@ -480,23 +484,23 @@ msgstr "Guardar fitxer com a " #: lclstrconsts:ifsvk_scroll msgid "Scroll" -msgstr "" +msgstr "Desplaar" #: lclstrconsts:rsscrollbaroutofrange msgid "ScrollBar property out of range" -msgstr "Propietat de la barra desplaadora fora de rang" +msgstr "Propietat de la barra desplaadora fora d'abast" #: lclstrconsts:ifsvk_select msgid "Select" -msgstr "" +msgstr "Seleccionar" #: lclstrconsts:rsfdselectdirectory msgid "Select Directory" -msgstr "" +msgstr "Seleccionar directori" #: lclstrconsts:rspickdate msgid "Select a date" -msgstr "" +msgstr "Seleccionar una data" #: lclstrconsts:rsselectfonttitle msgid "Select a font" @@ -508,27 +512,27 @@ msgstr "Seleccionar color" #: lclstrconsts:ifsvk_shift msgid "Shift" -msgstr "" +msgstr "Tecla de majscules" #: lclstrconsts:ifsvk_snapshot msgid "Snapshot" -msgstr "" +msgstr "Instantnia" #: lclstrconsts:ifsvk_space msgid "Space key" -msgstr "" +msgstr "Tecla d'espai" #: lclstrconsts:smenunotfound msgid "Sub-menu is not in menu" -msgstr "El sub-men no s al men" +msgstr "El submen no s al men" #: lclstrconsts:ifsvk_tab msgid "Tab" -msgstr "" +msgstr "Tabulador" #: lclstrconsts:rsfddirectorynotexist msgid "The directory \"%s\" does not exist." -msgstr "" +msgstr "El directori \"%s\" no existeix." #: lclstrconsts:rsfdfilealreadyexists msgid "The file \"%s\" already exists.\015Overwrite ?" @@ -548,11 +552,11 @@ msgstr "La traject #: lclstrconsts:rsunabletoloaddefaultfont msgid "Unable to load default font" -msgstr "No sc capa de carregar la font predeterminada" +msgstr "No es pot carregar la font predeterminada" #: lclstrconsts:ifsvk_unknown msgid "Unknown" -msgstr "" +msgstr "Desconegut" #: lclstrconsts:rsunknownpictureextension msgid "Unknown picture extension" @@ -568,7 +572,7 @@ msgstr "Format de porta-retalls no suportat: %s" #: lclstrconsts:ifsvk_up msgid "Up" -msgstr "" +msgstr "Amunt" #: lclstrconsts:rsmtwarning msgid "Warning" @@ -584,15 +588,15 @@ msgstr "Si a tot" #: lclstrconsts:ifsvk_apps msgid "application key" -msgstr "" +msgstr "tecla d'aplicaci" #: lclstrconsts:rsinvalidformobjectstream msgid "invalid Form object stream" -msgstr "Fluid d'objectes de forma no vlid" +msgstr "afluent d'objecte de forma no vlid" #: lclstrconsts:ifsvk_lwin msgid "left windows key" -msgstr "" +msgstr "tecla de finestres esquerres" #: lclstrconsts:rsdefaultfileinfovalue msgid "permissions user group size date time" @@ -600,5 +604,5 @@ msgstr "permisos usuari grup tamany dia hora" #: lclstrconsts:ifsvk_rwin msgid "right windows key" -msgstr "" +msgstr "tecla de finestres dretes" diff --git a/lcl/languages/lcl.de.po b/lcl/languages/lcl.de.po index 1d104bea35..5734c01d06 100644 --- a/lcl/languages/lcl.de.po +++ b/lcl/languages/lcl.de.po @@ -321,7 +321,11 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" msgstr "" #: lclstrconsts:sinvalidindex diff --git a/lcl/languages/lcl.es.po b/lcl/languages/lcl.es.po index 40cfbc9200..d5625f4deb 100644 --- a/lcl/languages/lcl.es.po +++ b/lcl/languages/lcl.es.po @@ -325,8 +325,12 @@ msgid "Insert" msgstr "Insertar" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Fecha invlida: %s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.esutf.po b/lcl/languages/lcl.esutf.po index 2597d1451a..1f014ec678 100644 --- a/lcl/languages/lcl.esutf.po +++ b/lcl/languages/lcl.esutf.po @@ -325,8 +325,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Fecha inválida: %s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.fi.po b/lcl/languages/lcl.fi.po index b51fdf326a..149b26d247 100644 --- a/lcl/languages/lcl.fi.po +++ b/lcl/languages/lcl.fi.po @@ -315,7 +315,11 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" msgstr "" #: lclstrconsts:sinvalidindex diff --git a/lcl/languages/lcl.fiwin.po b/lcl/languages/lcl.fiwin.po index b8f834f1c0..8c80b910cd 100644 --- a/lcl/languages/lcl.fiwin.po +++ b/lcl/languages/lcl.fiwin.po @@ -315,7 +315,11 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" msgstr "" #: lclstrconsts:sinvalidindex diff --git a/lcl/languages/lcl.fr.po b/lcl/languages/lcl.fr.po index ce44c46873..f92ef2ce8d 100644 --- a/lcl/languages/lcl.fr.po +++ b/lcl/languages/lcl.fr.po @@ -325,8 +325,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Date %s non valide" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.it.po b/lcl/languages/lcl.it.po index 10645a0bc9..34a672ef4a 100644 --- a/lcl/languages/lcl.it.po +++ b/lcl/languages/lcl.it.po @@ -325,8 +325,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Data non valida: %s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.itiso.po b/lcl/languages/lcl.itiso.po index 7bd56fa1f2..20176b9745 100644 --- a/lcl/languages/lcl.itiso.po +++ b/lcl/languages/lcl.itiso.po @@ -325,8 +325,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Data non valida: %s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.pl.po b/lcl/languages/lcl.pl.po index 12f35e5fe5..7a20c390a5 100644 --- a/lcl/languages/lcl.pl.po +++ b/lcl/languages/lcl.pl.po @@ -326,8 +326,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Błędna data :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.pliso.po b/lcl/languages/lcl.pliso.po index a2622ef0b9..1b154d906f 100644 --- a/lcl/languages/lcl.pliso.po +++ b/lcl/languages/lcl.pliso.po @@ -326,8 +326,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Bdna data :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.plwin.po b/lcl/languages/lcl.plwin.po index 091e756607..3ce04c5b02 100644 --- a/lcl/languages/lcl.plwin.po +++ b/lcl/languages/lcl.plwin.po @@ -326,8 +326,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Bdna data :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.po b/lcl/languages/lcl.po index 7867866083..267f50479d 100644 --- a/lcl/languages/lcl.po +++ b/lcl/languages/lcl.po @@ -315,7 +315,11 @@ msgid "ScrollBar property out of range" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" msgstr "" #: lclstrconsts:rserroroccurredinataddressframe diff --git a/lcl/languages/lcl.ru.po b/lcl/languages/lcl.ru.po index 5e3ba4ca79..1284786bce 100644 --- a/lcl/languages/lcl.ru.po +++ b/lcl/languages/lcl.ru.po @@ -315,8 +315,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr " :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.ruutf.po b/lcl/languages/lcl.ruutf.po index ba8f7bc990..642fd13270 100644 --- a/lcl/languages/lcl.ruutf.po +++ b/lcl/languages/lcl.ruutf.po @@ -315,8 +315,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr "Неправильная дата :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" diff --git a/lcl/languages/lcl.ruwin.po b/lcl/languages/lcl.ruwin.po index d3b7e38a2d..c5b4bf5ce2 100644 --- a/lcl/languages/lcl.ruwin.po +++ b/lcl/languages/lcl.ruwin.po @@ -315,8 +315,12 @@ msgid "Insert" msgstr "" #: lclstrconsts:rsinvaliddate -msgid "Invalid Date :%s" -msgstr " :%s" +msgid "Invalid Date : %s" +msgstr "" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index"