From 391e3f7bb57eaa84416f0bb30df9fd037c518232 Mon Sep 17 00:00:00 2001 From: maxim Date: Tue, 1 Jul 2014 22:59:27 +0000 Subject: [PATCH] =?UTF-8?q?Translations:=20Hungarian=20translation=20updat?= =?UTF-8?q?e=20by=20P=C3=A9ter=20G=C3=A1bor,=20bug=20#26425?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit git-svn-id: trunk@45744 - --- .gitattributes | 9 + .../activex/languages/activexstrconsts.hu.po | 49 + .../idehelp/languages/lazchmhelp.hu.po | 12 +- .../education/languages/eduoptions.hu.po | 10 +- .../ide/languages/fpcunitlazideintf.hu.po | 51 + .../ide/languages/strtestcaseopts.hu.po | 42 + .../fpweb/languages/fpwebstrconsts.hu.po | 397 +++++ .../fpweb/languages/fpwebtoolsunit.hu.po | 25 + .../fpweb/languages/frmrpcmoduleoptions.hu.po | 34 + .../fpweb/languages/reglazwebextra.hu.po | 62 + .../fpweb/languages/weblazideintf.hu.po | 142 ++ .../ideintf/languages/objinspstrconsts.hu.po | 341 +++- .../ZeosDB/languages/lrdbzeosconst.hu.po | 6 +- .../lazreport/source/languages/lr_const.hu.po | 73 +- .../lazsvnpkg/languages/svnclasses.hu.po | 28 +- .../leakview/languages/heaptrcview.hu.po | 23 +- .../macroscript/languages/emsstrings.hu.po | 68 + .../memds/languages/frmselectdataset.hu.po | 8 +- .../languages/messagecomposer.hu.po | 7 +- .../pochecker/languages/pocheckerconsts.hu.po | 14 +- .../design/languages/ideprinting.hu.po | 2 +- .../languages/frmtemplatevariables.hu.po | 8 +- .../languages/idetemplateproject.hu.po | 9 +- .../languages/projecttemplates.hu.po | 8 +- .../languages/syndesignstringconstants.hu.po | 2 +- .../synedit/languages/syneditstrconst.hu.po | 4 +- components/tdbf/languages/registerdbf.hu.po | 8 +- doceditor/languages/lazde.hu.po | 8 +- languages/debuggerstrconst.hu.po | 8 +- languages/lazaruside.hu.po | 1583 ++++++----------- lcl/languages/lclstrconsts.hu.po | 117 +- .../languages/lazdatadesktop.hu.po | 28 +- 32 files changed, 1961 insertions(+), 1225 deletions(-) create mode 100644 components/activex/languages/activexstrconsts.hu.po create mode 100644 components/fpcunit/ide/languages/fpcunitlazideintf.hu.po create mode 100644 components/fpcunit/ide/languages/strtestcaseopts.hu.po create mode 100644 components/fpweb/languages/fpwebstrconsts.hu.po create mode 100644 components/fpweb/languages/fpwebtoolsunit.hu.po create mode 100644 components/fpweb/languages/frmrpcmoduleoptions.hu.po create mode 100644 components/fpweb/languages/reglazwebextra.hu.po create mode 100644 components/fpweb/languages/weblazideintf.hu.po create mode 100644 components/macroscript/languages/emsstrings.hu.po diff --git a/.gitattributes b/.gitattributes index 9c612b6fa0..4797265706 100644 --- a/.gitattributes +++ b/.gitattributes @@ -249,6 +249,7 @@ components/activex/importtypelib.lfm svneol=native#text/plain components/activex/importtypelib.pas svneol=native#text/plain components/activex/languages/activexstrconsts.cs.po svneol=native#text/plain components/activex/languages/activexstrconsts.fi.po svneol=native#text/plain +components/activex/languages/activexstrconsts.hu.po svneol=native#text/plain components/activex/languages/activexstrconsts.po svneol=native#text/plain components/activex/languages/activexstrconsts.ru.po svneol=native#text/plain components/activex/lazactivexreg.pas svneol=native#text/plain @@ -1234,6 +1235,7 @@ components/fpcunit/ide/fpcunitlazideintf.pas svneol=native#text/pascal components/fpcunit/ide/fpcunitproject1.inc svneol=native#text/plain components/fpcunit/ide/fpcunitproject1.pas svneol=native#text/plain components/fpcunit/ide/languages/fpcunitlazideintf.cs.po svneol=native#text/plain +components/fpcunit/ide/languages/fpcunitlazideintf.hu.po svneol=native#text/plain components/fpcunit/ide/languages/fpcunitlazideintf.it.po svneol=native#text/plain components/fpcunit/ide/languages/fpcunitlazideintf.lt.po svneol=native#text/plain components/fpcunit/ide/languages/fpcunitlazideintf.po svneol=native#text/plain @@ -1242,6 +1244,7 @@ components/fpcunit/ide/languages/fpcunitlazideintf.ru.po svneol=native#text/plai components/fpcunit/ide/languages/fpcunitlazideintf.uk.po svneol=native#text/plain components/fpcunit/ide/languages/strtestcaseopts.cs.po svneol=native#text/plain components/fpcunit/ide/languages/strtestcaseopts.de.po svneol=native#text/plain +components/fpcunit/ide/languages/strtestcaseopts.hu.po svneol=native#text/plain components/fpcunit/ide/languages/strtestcaseopts.it.po svneol=native#text/plain components/fpcunit/ide/languages/strtestcaseopts.lt.po svneol=native#text/plain components/fpcunit/ide/languages/strtestcaseopts.po svneol=native#text/plain @@ -1526,6 +1529,7 @@ components/fpweb/images/tag_u.png -text svneol=unset#image/png components/fpweb/images/tag_ul.png -text svneol=unset#image/png components/fpweb/languages/fpwebstrconsts.cs.po svneol=native#text/plain components/fpweb/languages/fpwebstrconsts.de.po svneol=native#text/plain +components/fpweb/languages/fpwebstrconsts.hu.po svneol=native#text/plain components/fpweb/languages/fpwebstrconsts.it.po svneol=native#text/plain components/fpweb/languages/fpwebstrconsts.lt.po svneol=native#text/plain components/fpweb/languages/fpwebstrconsts.po svneol=native#text/plain @@ -1534,6 +1538,7 @@ components/fpweb/languages/fpwebstrconsts.ru.po svneol=native#text/plain components/fpweb/languages/fpwebstrconsts.uk.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.cs.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.de.po svneol=native#text/plain +components/fpweb/languages/fpwebtoolsunit.hu.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.it.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.lt.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.po svneol=native#text/plain @@ -1542,6 +1547,7 @@ components/fpweb/languages/fpwebtoolsunit.ru.po svneol=native#text/plain components/fpweb/languages/fpwebtoolsunit.uk.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.cs.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.de.po svneol=native#text/plain +components/fpweb/languages/frmrpcmoduleoptions.hu.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.it.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.lt.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.po svneol=native#text/plain @@ -1549,6 +1555,7 @@ components/fpweb/languages/frmrpcmoduleoptions.pt_BR.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.ru.po svneol=native#text/plain components/fpweb/languages/frmrpcmoduleoptions.uk.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.cs.po svneol=native#text/plain +components/fpweb/languages/reglazwebextra.hu.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.it.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.lt.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.po svneol=native#text/plain @@ -1556,6 +1563,7 @@ components/fpweb/languages/reglazwebextra.pt_BR.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.ru.po svneol=native#text/plain components/fpweb/languages/reglazwebextra.uk.po svneol=native#text/plain components/fpweb/languages/weblazideintf.cs.po svneol=native#text/plain +components/fpweb/languages/weblazideintf.hu.po svneol=native#text/plain components/fpweb/languages/weblazideintf.it.po svneol=native#text/plain components/fpweb/languages/weblazideintf.lt.po svneol=native#text/plain components/fpweb/languages/weblazideintf.po svneol=native#text/plain @@ -2703,6 +2711,7 @@ components/macroscript/emsideoptions.lfm svneol=native#text/pascal components/macroscript/emsideoptions.pas svneol=native#text/pascal components/macroscript/emsselftest.pas svneol=native#text/pascal components/macroscript/emsstrings.pas svneol=native#text/pascal +components/macroscript/languages/emsstrings.hu.po svneol=native#text/plain components/macroscript/languages/emsstrings.po svneol=native#text/plain components/macroscript/languages/emsstrings.ru.po svneol=native#text/plain components/macroscript/registerems.pas svneol=native#text/pascal diff --git a/components/activex/languages/activexstrconsts.hu.po b/components/activex/languages/activexstrconsts.hu.po new file mode 100644 index 0000000000..f0bba5330c --- /dev/null +++ b/components/activex/languages/activexstrconsts.hu.po @@ -0,0 +1,49 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor \n" +"Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" +"X-Generator: Poedit 1.5.4\n" + +#: activexstrconsts.axconvertdependanttypelibs +msgid "Convert dependant typelibs" +msgstr "Alárendelt típustárak átalakítása" + +#: activexstrconsts.axcreatepackage +msgid "Create package" +msgstr "Csomag létrehozása" + +#: activexstrconsts.axcreatevisualcomponenttactivexcontainerdescendant +msgid "Create visual component (TActiveXContainer descendant)" +msgstr "Vizuális komponens létrehozása (TActiveXContainer leszármazott)" + +#: activexstrconsts.axfilecontainingtypelibrary +msgid "File containing type library:" +msgstr "Típustárat tartalmazó fájl:" + +#: activexstrconsts.aximporttypelibrary +msgid "Import Type Library" +msgstr "Típustár importálása" + +#: activexstrconsts.aximporttypelibrarymenu +msgid "Import Type Library ..." +msgstr "Típustár importálása ..." + +#: activexstrconsts.axselectdirectorytostorepackageplpk +msgid "Select directory to store package %sP.lpk" +msgstr "Könyvtár választása a(z) %sP.lpk csomag tárolásához" + +#: activexstrconsts.axtypelibraryfilestlbdllexeocxolbtlbdllexeocxolballf +msgid "" +"Type library files (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;*.ocx;*." +"olb|All Files (*.*)|*.*" +msgstr "" +"Típustár fájlok (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;*.ocx;*." +"olb|Minden fájl (*.*)|*.*" diff --git a/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po b/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po index 83cc2ff742..6fb37487ff 100644 --- a/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po +++ b/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po @@ -28,8 +28,10 @@ msgid "Missing lhelp" msgstr "Hiányzó lhelp" #: lazchmhelp.help_unabletofindthelhelpviewerpleasecompilethelhelppro -#, fuzzy -#| msgid "Unable to find the lhelp viewer:%s%s%s%sPlease compile the lhelp project:%s%s" -msgid "Unable to find the lhelp viewer:%s%s%sPlease compile the lhelp project:%s%s" -msgstr "Az lhelp megjelenítő nem található:%s%s%s%sFordítsa le az lhelp projektet:%s%s" - +#| msgid "" +#| "Unable to find the lhelp viewer:%s%s%s%sPlease compile the lhelp project:" +#| "%s%s" +msgid "" +"Unable to find the lhelp viewer:%s%s%sPlease compile the lhelp project:%s%s" +msgstr "" +"Az lhelp megjelenítő nem található:%s%s%sFordítsa le az lhelp projektet:%s%s" diff --git a/components/education/languages/eduoptions.hu.po b/components/education/languages/eduoptions.hu.po index 62765d3909..d18a898934 100644 --- a/components/education/languages/eduoptions.hu.po +++ b/components/education/languages/eduoptions.hu.po @@ -18,15 +18,15 @@ msgstr "Oktatás" #: eduoptions.ersaddanentrytothenewdialogtocreateanewprogram msgid "Add an entry to the %sNew ...%s dialog to create a new program" -msgstr "" +msgstr "Elem hozzáadása az %sÚj ...%s párbeszédhez új program létrehozására" #: eduoptions.ersaddanidemenuitemtocreateanewprogram msgid "Add an IDE menu item to create a new program" -msgstr "" +msgstr "IDE menüelem hozzáadása új program létrehozására" #: eduoptions.ersaddaspeedbuttontotheidetoolbartocreateanewprogram msgid "Add a speed button to the IDE toolbar to create a new program" -msgstr "" +msgstr "Gyorsgomb hozzáadása az IDE eszköztárához új program létrehozására " #: eduoptions.ersaddicon msgid "Add icon" @@ -38,7 +38,7 @@ msgstr "Menüelem hozzáadása" #: eduoptions.ersaddtonewdialog msgid "Add to %sNew ...%s dialog" -msgstr "" +msgstr "Hozzáadás az %sÚj ...%s párbeszédhez" #: eduoptions.ersasimpleprogramonlyonefileiscreatedandaddedtothecur msgid "" @@ -175,7 +175,7 @@ msgstr "Objektumfelügyelő-lapok megjelenítése" #: eduoptions.ersshowselection msgid "Show Selection" -msgstr "" +msgstr "Kijelölés megjelenítése" #: eduoptions.erssinglefileprogram msgid "Single file program" diff --git a/components/fpcunit/ide/languages/fpcunitlazideintf.hu.po b/components/fpcunit/ide/languages/fpcunitlazideintf.hu.po new file mode 100644 index 0000000000..f695c3ee93 --- /dev/null +++ b/components/fpcunit/ide/languages/fpcunitlazideintf.hu.po @@ -0,0 +1,51 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor \n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: fpcunitlazideintf.sfpcunconsoletestapp +msgid "FPCUnit Console Test Application" +msgstr "FPCUnit Parancssoros Teszt Alkalmazás" + +#: fpcunitlazideintf.sfpcunconsoletestdesc +msgid "" +"FPCUnit Console Test Application%sAn application to run FPCUnit test cases " +"in console mode.%sThe application source is automatically maintained by " +"Lazarus." +msgstr "" +"FPCUnit Parancssoros Teszt Alkalmazás%sEgy alkalmazás FPCUnit tesztek " +"futtatására parancssoros módban.%sAz alkalmazás forráskódját a Lazarus " +"automatikusan karbantartja." + +#: fpcunitlazideintf.sfpcuntestapp +msgid "FPCUnit Test Application" +msgstr "FPCUnit Teszt Alkalmazás" + +#: fpcunitlazideintf.sfpcuntestappdesc +msgid "" +"FPCUnit Test Application%sAn application to run FPCUnit test cases.%sThe " +"application source is automatically maintained by Lazarus." +msgstr "" +"FPCUnit Teszt Alkalmazás%sEgy alkalmazás FPCUnit tesztek futtatására.%sAz " +"alkalmazás forráskódját a Lazarus automatikusan karbantartja." + +#: fpcunitlazideintf.sfpcuntestcase +msgid "FPCUnit Test Case" +msgstr "FPCUnit Teszt" + +#: fpcunitlazideintf.sfpcuntestcasedesc +msgid "FPCUnit Test Case%sA unit containing a FPCUnit Test Case." +msgstr "FPCUnit Teszt%sEgy unit, amely FPCUnit tesztet tartalmaz." + +#: fpcunitlazideintf.swriteyourowntest +msgid "Write your own test" +msgstr "Saját teszt írása" diff --git a/components/fpcunit/ide/languages/strtestcaseopts.hu.po b/components/fpcunit/ide/languages/strtestcaseopts.hu.po new file mode 100644 index 0000000000..b47e3c80ff --- /dev/null +++ b/components/fpcunit/ide/languages/strtestcaseopts.hu.po @@ -0,0 +1,42 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor \n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: strtestcaseopts.sbtncreate +msgid "Create unit" +msgstr "Unit létrehozása" + +# (értsd: teszt felépítése) +#: strtestcaseopts.schksetup +msgid "Create Setup Method" +msgstr "Felépítési eljárás létrehozása" + +#: strtestcaseopts.schktear +msgid "Create TearDown method" +msgstr "Bontási eljárás létrehozása" + +#: strtestcaseopts.sfrmtest +msgid "TestCase Options" +msgstr "Teszt beállítások" + +#: strtestcaseopts.sgrpfixture +msgid "Fixture" +msgstr "Kellékek" + +#: strtestcaseopts.sgrpnames +msgid "Names" +msgstr "Nevek" + +#: strtestcaseopts.slbldefault +msgid "Default Test Name" +msgstr "Alapértelmezett teszt neve" diff --git a/components/fpweb/languages/fpwebstrconsts.hu.po b/components/fpweb/languages/fpwebstrconsts.hu.po new file mode 100644 index 0000000000..8d2cda8cf9 --- /dev/null +++ b/components/fpweb/languages/fpwebstrconsts.hu.po @@ -0,0 +1,397 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor \n" +"Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" +"X-Generator: Poedit 1.5.4\n" + +#: fpwebstrconsts.scssfile +msgid "CSS file" +msgstr "CSS fájl" + +#: fpwebstrconsts.scssfiledesc +msgid "Create new CSS file ..." +msgstr "Új CSS fájl létrehozása ..." + +#: fpwebstrconsts.scsssource +msgid "Enter your classes/style definitions here" +msgstr "Írja ide az osztály/stílus meghatározásokat" + +#: fpwebstrconsts.sdocumentlocation +msgid "&Location" +msgstr "&Hely" + +#: fpwebstrconsts.sdocumentroot +msgid "&Directory" +msgstr "&Könyvtár" + +#: fpwebstrconsts.senteryoutext +msgid "Enter your text ..." +msgstr "Írja be a szöveget ..." + +#: fpwebstrconsts.shtmlautor +msgid "Html &author - " +msgstr "HTML &szerző - " + +#: fpwebstrconsts.shtmlcharset +msgid "HTML chars&et" +msgstr "HTML &karakterkészlet" + +#: fpwebstrconsts.shtmlcopyright +msgid "Html cop&yright - meta name=\"copyright\">" +msgstr "HTML sze&rzői jog - meta name=\"copyright\">" + +#: fpwebstrconsts.shtmlcssfile +msgid "&CSS file" +msgstr "&CSS fájl" + +#: fpwebstrconsts.shtmldesign +msgid "HTML design" +msgstr "HTML tervezés" + +#: fpwebstrconsts.shtmlfile +msgid "HTML file" +msgstr "HTML fájl" + +#: fpwebstrconsts.shtmlfiledesc +msgid "Create new HTML file ..." +msgstr "Új HTML fájl létrehozása ..." + +#: fpwebstrconsts.shtmlinputformaccesskey +msgid "Access key" +msgstr "Hozzáférési billentyű" + +#: fpwebstrconsts.shtmlinputformalign +msgid "Align" +msgstr "Igazítás" + +#: fpwebstrconsts.shtmlinputformalt +msgid "Alt" +msgstr "Alt" + +#: fpwebstrconsts.shtmlinputformcaption +msgid "Tag property: INPUT" +msgstr "Cimke tulajdonság: INPUT" + +#: fpwebstrconsts.shtmlinputformimagesrc +msgid "Image src" +msgstr "Kép forrás" + +#: fpwebstrconsts.shtmlinputformmaxlen +msgid "Max length" +msgstr "Maximális hossz" + +#: fpwebstrconsts.shtmlinputformname +msgid "Name" +msgstr "Név" + +#: fpwebstrconsts.shtmlinputformsize +msgid "Size" +msgstr "Méret" + +#: fpwebstrconsts.shtmlinputformtabindex +msgid "Tab Index" +msgstr "Tab sorszám" + +#: fpwebstrconsts.shtmlinputformtype +msgid "Type" +msgstr "Típus" + +#: fpwebstrconsts.shtmlinputformvalue +msgid "Value" +msgstr "Érték" + +#: fpwebstrconsts.shtmljsfile +msgid "&Javascript file" +msgstr "&Javascript fájl" + +#: fpwebstrconsts.shtmltableformborderwidth +msgid "Border width" +msgstr "Szegély szélessége" + +#: fpwebstrconsts.shtmltableformcaption +msgid "New HTML table ..." +msgstr "Új HTML táblázat ..." + +#: fpwebstrconsts.shtmltableformcellpadding +msgid "Cell padding" +msgstr "Cellamargó" + +#: fpwebstrconsts.shtmltableformcellspacing +msgid "Cell spacing" +msgstr "Cellatávolság" + +#: fpwebstrconsts.shtmltableformcolumncount +msgid "Column count" +msgstr "Oszlopszám" + +#: fpwebstrconsts.shtmltableformheaderbgcolor +msgid "Header bg color" +msgstr "Fejléc háttérszíne" + +#: fpwebstrconsts.shtmltableformrowcount +msgid "Row count" +msgstr "Sorszám" + +#: fpwebstrconsts.shtmltableformuseheader +msgid "Use header row" +msgstr "Fejlécsor használata" + +#: fpwebstrconsts.shtmltableformwidth +msgid "Width" +msgstr "Szélesség" + +#: fpwebstrconsts.shtmltagcaptionreset +msgid "Reset" +msgstr "Alaphelyzet" + +#: fpwebstrconsts.shtmltagcaptionsubmit +msgid "Submit" +msgstr "Küldés" + +#: fpwebstrconsts.shtmltagproperty +msgid "Tag property: %s" +msgstr "Cimke tulajdonság: %s" + +#: fpwebstrconsts.shtmltitle +msgid "Html &title - " +msgstr "Html &cím - <title>" + +#: fpwebstrconsts.shttpport +msgid "&Port to listen for requests:" +msgstr "A kérések figyelésére használt &port:" + +#: fpwebstrconsts.sjsfile +msgid "Javascript file" +msgstr "Javascript fájl" + +#: fpwebstrconsts.sjsfiledesc +msgid "Create new javascript file ..." +msgstr "Új javascript fájl létrehozása ..." + +#: fpwebstrconsts.sjssource +msgid "Enter your javascript code here" +msgstr "Írja ide a javascript kódot" + +#: fpwebstrconsts.smihtmleditor +msgid "HTML Editor" +msgstr "HTML-szerkesztő" + +#: fpwebstrconsts.smihtmlformbuttton +msgid "Insert Button control" +msgstr "Gomb beszúrása" + +#: fpwebstrconsts.smihtmlformcheckbox +msgid "Insert CheckBox control" +msgstr "Jelölőnégyzet beszúrása" + +#: fpwebstrconsts.smihtmlformfieldset +msgid "Insert HTML FIELDSET tag" +msgstr "HTML FIELDSET címke beszúrása" + +#: fpwebstrconsts.smihtmlformlegend +msgid "Insert HTML LEGEND tag" +msgstr "HTML LEGEND címke beszúrása" + +#: fpwebstrconsts.smihtmlformradiobtn +msgid "Insert RadioBtn control" +msgstr "Rádiógomb beszúrása" + +#: fpwebstrconsts.smihtmlforms +msgid "Forms" +msgstr "Űrlapok" + +#: fpwebstrconsts.smihtmlformselect +msgid "Insert Select control" +msgstr "Választólista beszúrása" + +#: fpwebstrconsts.smihtmlformselectopt +msgid "Insert Select options" +msgstr "Választási lehetőség beszúrása" + +#: fpwebstrconsts.smihtmlformselectoptwd +msgid "Insert Select options with dialog" +msgstr "Választási lehetőség beszúrása párbeszéddel" + +#: fpwebstrconsts.smihtmlinsertbr +msgid "Insert new line" +msgstr "Új sor beszúrása" + +#: fpwebstrconsts.smihtmlinsertcolor +msgid "Insert HTML color value" +msgstr "HTML színérték beszúrása" + +#: fpwebstrconsts.smihtmlinsertcomment +msgid "Insert HTML comment" +msgstr "HTML megjegyzés beszúrása" + +#: fpwebstrconsts.smihtmlinsertdivblock +msgid "Insert HTML DIV tag" +msgstr "HTML DIV címke beszúrása" + +#: fpwebstrconsts.smihtmlinsertform +msgid "Insert HTML Form" +msgstr "HTML FORM beszúrása" + +#: fpwebstrconsts.smihtmlinsertheader1level +msgid "Insert HTML level 1 header" +msgstr "HTML 1. szintű fejléc beszúrása" + +#: fpwebstrconsts.smihtmlinsertheader2level +msgid "Insert HTML level 2 header" +msgstr "HTML 2. szintű fejléc beszúrása" + +#: fpwebstrconsts.smihtmlinsertheader3level +msgid "Insert HTML level 3 header" +msgstr "HTML 3. szintű fejléc beszúrása" + +#: fpwebstrconsts.smihtmlinsertheader4level +msgid "Insert HTML level 4 header" +msgstr "HTML 4. szintű fejléc beszúrása" + +#: fpwebstrconsts.smihtmlinsertheader5level +msgid "Insert HTML level 5 header" +msgstr "HTML 5. szintű fejléc beszúrása" + +#: fpwebstrconsts.smihtmlinserthr +msgid "Insert horizontal line" +msgstr "Vízszintes vonal beszúrása" + +#: fpwebstrconsts.smihtmlinsertimg +msgid "Insert image" +msgstr "Kép beszúrása" + +#: fpwebstrconsts.smihtmlinsertinput +msgid "Insert HTML INPUT tag" +msgstr "HTML INPUT címke beszúrása" + +#: fpwebstrconsts.smihtmlinsertinputreset +msgid "Insert \"Reset\" button" +msgstr "\"Alaphelyzet\" gomb beszúrása" + +#: fpwebstrconsts.smihtmlinsertinputsubmit +msgid "Insert \"Submit\" button " +msgstr "\"Küldés\" gomb beszúrása" + +#: fpwebstrconsts.smihtmlinsertlink +msgid "Insert link (HREF)" +msgstr "Hivatkozás beszúrása (HREF)" + +#: fpwebstrconsts.smihtmlinsertlist +msgid "Insert HTML list" +msgstr "HTML lista beszúrása" + +#: fpwebstrconsts.smihtmlinsertnbsp +msgid "Insert Non Breaking Space" +msgstr "Nem tördelhető szóköz beillesztése" + +#: fpwebstrconsts.smihtmlinsertpre +msgid "Insert HTML PRE tag" +msgstr "HTML PRE címke beszúrása" + +#: fpwebstrconsts.smihtmlinsertspantext +msgid "Insert HTML SPAN tag" +msgstr "HTML SPAN címke beszúrása" + +#: fpwebstrconsts.smihtmlinsertsub +msgid "Insert Subscript" +msgstr "Alsó index beszúrása" + +#: fpwebstrconsts.smihtmlinsertsuper +msgid "Insert Superscript" +msgstr "Felső index beszúrása" + +#: fpwebstrconsts.smihtmlinserttable +msgid "Insert HTML table" +msgstr "HTML táblázat beszúrása" + +#: fpwebstrconsts.smihtmlinserttabledata +msgid "Insert HTML table data" +msgstr "HTML táblázatadat beszúrása" + +#: fpwebstrconsts.smihtmlinserttabledatawd +msgid "Insert HTML table data with dialog" +msgstr "HTML táblázatadat beszúrása párbeszéddel" + +#: fpwebstrconsts.smihtmlinserttablerow +msgid "Insert HTML table row" +msgstr "HTML táblázatsor beszúrása" + +#: fpwebstrconsts.smihtmlinserttablerowwd +msgid "Insert HTML table row with dialog" +msgstr "HTML táblázatsor beszúrása párbeszéddel" + +#: fpwebstrconsts.smihtmllists +msgid "Lists" +msgstr "Listák" + +#: fpwebstrconsts.smihtmlother +msgid "Other" +msgstr "Egyéb" + +#: fpwebstrconsts.smihtmlstandart +msgid "Standard" +msgstr "Szabványos" + +#: fpwebstrconsts.smihtmlstyle +msgid "Styles" +msgstr "Stílusok" + +#: fpwebstrconsts.smihtmltables +msgid "Tables" +msgstr "Táblázatok" + +#: fpwebstrconsts.smihtmltextaligncenter +msgid "Text align center" +msgstr "Szöveg igazítása középre" + +#: fpwebstrconsts.smihtmltextalignjustify +msgid "Text align justify" +msgstr "Szöveg igazítása egyenletesen (sorkizárt)" + +#: fpwebstrconsts.smihtmltextalignleft +msgid "Text align left" +msgstr "Szöveg igazítása balra" + +#: fpwebstrconsts.smihtmltextalignright +msgid "Text align right" +msgstr "Szöveg igazítása jobbra" + +#: fpwebstrconsts.smihtmltextbold +msgid "Bold" +msgstr "Félkövér" + +#: fpwebstrconsts.smihtmltextitalic +msgid "Italic" +msgstr "Dőlt" + +#: fpwebstrconsts.smihtmltextunderline +msgid "Underline" +msgstr "Aláhúzott" + +#: fpwebstrconsts.smiotherinsertfn +msgid "Insert file name" +msgstr "Fájlnév beszúrása" + +#: fpwebstrconsts.snewhtmlfileprops +msgid "New Html file properties" +msgstr "Új HTML fájl tulajdonságok" + +#: fpwebstrconsts.snewhttpapp +msgid "New HTTP application" +msgstr "Új HTTP alkalmazás" + +#: fpwebstrconsts.sregisterfiles +msgid "&Register location to serve files from" +msgstr "Hely &bejegyzése a fájlok kiszolgálására" + +#: fpwebstrconsts.susethreads +msgid "Use &threads to serve requests in" +msgstr "Szá&lak használata a kérések kiszolgálására" diff --git a/components/fpweb/languages/fpwebtoolsunit.hu.po b/components/fpweb/languages/fpwebtoolsunit.hu.po new file mode 100644 index 0000000000..8aa36fedaf --- /dev/null +++ b/components/fpweb/languages/fpwebtoolsunit.hu.po @@ -0,0 +1,25 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: rxwebtoolsunit.shtmldesign +msgid "HTML design" +msgstr "HTML tervezés" + +#: rxwebtoolsunit.shtmlfile +msgid "HTML file" +msgstr "HTML fájl" + +#: rxwebtoolsunit.shtmlfiledesc +msgid "Create new HTML file..." +msgstr "Új HTML fájl létrehozása..." diff --git a/components/fpweb/languages/frmrpcmoduleoptions.hu.po b/components/fpweb/languages/frmrpcmoduleoptions.hu.po new file mode 100644 index 0000000000..01fcd9e1b5 --- /dev/null +++ b/components/fpweb/languages/frmrpcmoduleoptions.hu.po @@ -0,0 +1,34 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: frmrpcmoduleoptions.scaption +msgid "Create a new JSON-RPC module" +msgstr "Új JSON-RPC modul létrehozása" + +#: frmrpcmoduleoptions.shttppath +msgid "HTTP Path" +msgstr "HTTP útvonal" + +#: frmrpcmoduleoptions.sjsonclass +msgid "JSON-RPC class" +msgstr "JSON-RPC osztály" + +#: frmrpcmoduleoptions.sregisterjson +#, fuzzy +msgid "Register JSON-RPC handlers in factory" +msgstr "JSON-RPC kezelők regisztrálása a gyárban" + +#: frmrpcmoduleoptions.sregisterwebm +msgid "Register web module" +msgstr "Web modul regisztrálása" diff --git a/components/fpweb/languages/reglazwebextra.hu.po b/components/fpweb/languages/reglazwebextra.hu.po new file mode 100644 index 0000000000..7deaf27fd6 --- /dev/null +++ b/components/fpweb/languages/reglazwebextra.hu.po @@ -0,0 +1,62 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: reglazwebextra.rshttpappli +msgid "HTTP server Application" +msgstr "HTTP kiszolgáló alkalmazás" + +#: reglazwebextra.rshttpappli2 +msgid "" +"HTTP server Application. Complete HTTP Server program in Free Pascal using " +"webmodules. The program source is automatically maintained by Lazarus." +msgstr "" +"HTTP kiszolgáló alkalmazás. Teljes HTTP kiszolgáló program Free Pascal-ban " +"webmodulok használatával. Az program forráskódját a Lazarus automatikusan " +"karbantartja." + +#: reglazwebextra.rswebdataprovi +msgid "Web DataProvider Module" +msgstr "Web adatszolgáltató modul" + +#: reglazwebextra.rswebdataprovi2 +msgid "" +"WEB DataProvider Module%sA datamodule to handle data requests for WEB (HTTP) " +"applications using WebDataProvider components." +msgstr "" +"Web adatszolgáltató modul%sEgy adatmodul WEB (HTTP) alkalmazások számára az " +"adatkérések kezelésére WebDataProvider komponensek haszálatával." + +#: reglazwebextra.rswebextdirect +msgid "Web Ext.Direct Module" +msgstr "Web Ext.Direct modul" + +#: reglazwebextra.rswebextdirect2 +msgid "" +"WEB Ext.Direct Module%sA datamodule to dispatch Ext.Direct requests in WEB " +"(HTTP) applications using TJSONRPCHandler components." +msgstr "" +"Web Ext.Direct modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban az Ext." +"Direct kéréseket kezeli TJSONRPCHandler komponensek használatával." + +#: reglazwebextra.rswebjsonrpcmo +msgid "Web JSON-RPC Module" +msgstr "Web JSON-RPC modul" + +#: reglazwebextra.rswebjsonrpcmo2 +msgid "" +"WEB JSON-RPC Module%sA datamodule to dispatch JSON-RPC requests in WEB " +"(HTTP) applications using TJSONRPCHandler components." +msgstr "" +"Web JSON-RPC modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban a JSON-" +"RPC kéréseket kezeli TJSONRPCHandler komponensek használatával." diff --git a/components/fpweb/languages/weblazideintf.hu.po b/components/fpweb/languages/weblazideintf.hu.po new file mode 100644 index 0000000000..9b429811ff --- /dev/null +++ b/components/fpweb/languages/weblazideintf.hu.po @@ -0,0 +1,142 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: weblazideintf.rsapachemodule +msgid "Apache Module" +msgstr "Apache modul" + +#: weblazideintf.rsapachemodule2 +msgid "" +"Apache module%sAn Apache loadable module in Free Pascal using webmodules. " +"The main library file is automatically maintained by Lazarus." +msgstr "" +"Apache modul%sEgy az Apache által betölthető modul Free Pascal-ban " +"webmodulok használatával. A fő fügvénytár forráskódját a Lazarus " +"automatikusan karbantartja." + +#: weblazideintf.rscgiapplicati +msgid "CGI Application" +msgstr "CGI alkalmazás" + +#: weblazideintf.rscgiapplicati2 +msgid "" +"CGI Application%sA CGI (Common Gateway Interface) program in Free Pascal " +"using webmodules. The program source is automatically maintained by Lazarus." +msgstr "" +"CGI alkalmazás%sEgy CGI (Common Gateway Interface) program Free Pascal-ban " +"webmodulok használatával. A program forráskódját a Lazarus automatikusan " +"karbantartja." + +#: weblazideintf.rscustomcgiapp +msgid "Custom CGI Application" +msgstr "Egyéni CGI alkalmazás" + +#: weblazideintf.rscustomcgiapp2 +msgid "" +"Custom CGI Application%sA CGI (Common Gateway Interface) program in Free " +"Pascal. The program source is automatically maintained by Lazarus." +msgstr "" +"Egyéni CGI alkalmazás%sEgy CGI (Common Gateway Interface) program Free " +"Pascal-ban. A program forráskódját a Lazarus automatikusan karbantartja." + +#: weblazideintf.rscustomfastcg +msgid "Custom FastCGI Application" +msgstr "Egyéni FastCGI alkalmazás" + +#: weblazideintf.rscustomfastcg2 +msgid "" +"Custom FastCGI Application%sA FastCGI (Common Gateway Interface) program in " +"Free Pascal. The program source is automatically maintained by Lazarus." +msgstr "" +"Egyéni FastCGI alkalmazás%sEgy FastCGI (Common Gateway Interface) program " +"Free Pascal-ban. A program forráskódját a Lazarus automatikusan karbantartja." + +#: weblazideintf.rsfastcgiappli +msgid "FastCGI Application" +msgstr "FastCGI alkalmazás" + +#: weblazideintf.rsfastcgiappli2 +msgid "" +"FastCGI Application%sA FastCGI (Common Gateway Interface) program in Free " +"Pascal using webmodules. The program source is automatically maintained by " +"Lazarus." +msgstr "" +"FastCGI alkalmazás%sEgy FastCGI (Common Gateway Interface) program Free " +"Pascal-ban webmodulok használatával. A program forráskódját a Lazarus " +"automatikusan karbantartja." + +#: weblazideintf.rshtmlwebmodul +msgid "HTML Web Module" +msgstr "HTTP web modul" + +#: weblazideintf.rshtmlwebmodul2 +msgid "HTML WEB Module%sA Web datamodule for producing strict HTML." +msgstr "HTML WEB modul%sEgy web adatmodul szigorú HTML létrehozására." + +#: weblazideintf.rshttpappli +msgid "HTTP server Application" +msgstr "HTTP kiszolgáló alkalmazás" + +#: weblazideintf.rshttpappli2 +msgid "" +"HTTP server Application. Complete HTTP Server program in Free Pascal using " +"webmodules. The program source is automatically maintained by Lazarus." +msgstr "" +"HTTP kiszolgáló alkalmazás. Teljes HTTP kiszolgáló program Free Pascal-ban " +"webmodulok használatával. Az program forráskódját a Lazarus automatikusan " +"karbantartja." + +#: weblazideintf.rswebdataprovi +msgid "Web DataProvider Module" +msgstr "Web adatszolgáltató modul" + +#: weblazideintf.rswebdataprovi2 +msgid "" +"WEB DataProvider Module%sA datamodule to handle data requests for WEB (HTTP) " +"applications using WebDataProvider components." +msgstr "" +"WEB adatszolgáltató modul%sEgy adatmodul WEB (HTTP) alkalmazások számára az " +"adatkérések kezelésére WebDataProvider komponensek haszálatával." + +#: weblazideintf.rswebextdirect +msgid "Web Ext.Direct Module" +msgstr "Web Ext.Direct modul" + +#: weblazideintf.rswebextdirect2 +msgid "" +"WEB Ext.Direct Module%sA datamodule to dispatch Ext.Direct requests in WEB " +"(HTTP) applications using TJSONRPCHandler components." +msgstr "" +"Web Ext.Direct modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban az Ext." +"Direct kéréseket kezeli TJSONRPCHandler komponensek használatával." + +#: weblazideintf.rswebjsonrpcmo +msgid "Web JSON-RPC Module" +msgstr "Web JSON-RPC modul" + +#: weblazideintf.rswebjsonrpcmo2 +msgid "" +"WEB JSON-RPC Module%sA datamodule to dispatch JSON-RPC requests in WEB " +"(HTTP) applications using TJSONRPCHandler components." +msgstr "" +"Web JSON-RPC modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban a JSON-" +"RPC kéréseket kezeli TJSONRPCHandler komponensek használatával." + +#: weblazideintf.rswebmodule +msgid "Web Module" +msgstr "Web modul" + +#: weblazideintf.rswebmoduleada +msgid "WEB Module%sA datamodule for WEB (HTTP) applications." +msgstr "Web modul%sEgy adatmodul WEB (HTTP) alkalmazások számára." diff --git a/components/ideintf/languages/objinspstrconsts.hu.po b/components/ideintf/languages/objinspstrconsts.hu.po index 7a9856d991..d02a47a22c 100644 --- a/components/ideintf/languages/objinspstrconsts.hu.po +++ b/components/ideintf/languages/objinspstrconsts.hu.po @@ -5,11 +5,11 @@ msgstr "" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: Poedit 1.5.4\n" -"Language: hu\n" #: objinspstrconsts.cactionlisteditorallcategory msgid "(All)" @@ -132,7 +132,6 @@ msgid "Up" msgstr "Fel" #: objinspstrconsts.fescalculated -#, fuzzy msgid "&Calculated" msgstr "Számított" @@ -150,7 +149,6 @@ msgid "&Data" msgstr "A&datok" #: objinspstrconsts.fesdataset -#, fuzzy msgid "&Dataset:" msgstr "&Dataset:" @@ -192,7 +190,6 @@ msgid "Lookup definition" msgstr "Definíció keresése" #: objinspstrconsts.feslookupkeys -#, fuzzy msgid "L&ookup keys:" msgstr "Keresési kulcsok:" @@ -206,7 +203,8 @@ msgstr "Nem sikerült összegyűjteni a Dataset mezőinek listáját" #: objinspstrconsts.fesnofieldsnote msgid "Field's list is not available, can't check for duplicates" -msgstr "A mezők listája nem érhető el, nem lehet többszörös előfordulásokat keresni" +msgstr "" +"A mezők listája nem érhető el, nem lehet többszörös előfordulásokat keresni" #: objinspstrconsts.fesokbtn msgctxt "objinspstrconsts.fesokbtn" @@ -218,7 +216,6 @@ msgid "Co&mponent Name:" msgstr "Komponens neve:" #: objinspstrconsts.fesresultfield -#, fuzzy msgid "&Result Fields:" msgstr "Visszaadott mezők:" @@ -265,7 +262,7 @@ msgstr "Érték megadása" #: objinspstrconsts.lisunabletofindparserfortool msgid "Unable to find parser for tool \"%s\"" -msgstr "" +msgstr "Nem található elemző az eszközhöz: \"%s\"" #: objinspstrconsts.nbcesaddpage msgid "Add Page" @@ -409,10 +406,8 @@ msgid "Clear picture" msgstr "Kép tisztítása" #: objinspstrconsts.oiscomponentnameisnotavalididentifier -#, fuzzy -#| msgid "Component name %s%s%s is not a valid identifier" msgid "Component name \"%s\" is not a valid identifier" -msgstr "A(z) %s%s%s komponens név nem érvényes azonosító" +msgstr "A(z) \"%s\" komponens név nem érvényes azonosító" #: objinspstrconsts.oiscomponentrestrictions msgid "Component restrictions: " @@ -455,10 +450,8 @@ msgid "&Delete" msgstr "&Törlés" #: objinspstrconsts.oisdeleteitem -#, fuzzy -#| msgid "Delete item %s%s%s?" msgid "Delete item \"%s\"?" -msgstr "Törli a(z) %s%s%s elemet?" +msgstr "Törli a(z) \"%s\" elemet?" #: objinspstrconsts.oisdeleteselectedfields msgid "Delete selected field(s)" @@ -485,10 +478,8 @@ msgid "Error loading image" msgstr "Hiba kép betöltése közben" #: objinspstrconsts.oiserrorloadingimage2 -#, fuzzy -#| msgid "Error loading image %s%s%s:%s%s" msgid "Error loading image \"%s\":%s%s" -msgstr "Hiba a(z) %s%s%s kép betöltése közben:%s%s" +msgstr "Hiba a(z) \"%s\" kép betöltése közben:%s%s" #: objinspstrconsts.oiserrorwhiledeletingaction msgid "Error while deleting action:%s%s" @@ -547,10 +538,8 @@ msgid "Invalid property value" msgstr "Érvénytelen tulajdonság érték" #: objinspstrconsts.oisisnotavalidmethodname -#, fuzzy -#| msgid "%s%s%s is not a valid method name." msgid "\"%s\" is not a valid method name." -msgstr "A(z) %s%s%s nem egy érvényes metódusnév." +msgstr "A(z) \"%s\" nem egy érvényes metódusnév." #: objinspstrconsts.oisitemsselected msgid "%u items selected" @@ -727,7 +716,6 @@ msgid "Set MaxHeight=%d, MaxWidth=%d" msgstr "Legyen MaxHeight=%d, MaxWidth=%d" #: objinspstrconsts.oissetmaxconstraintshint -#, fuzzy msgid "Use current size as Max Constraints" msgstr "Az aktuális méret használata legnagyobb méretként" @@ -736,7 +724,6 @@ msgid "Set MinHeight=%d, MinWidth=%d" msgstr "Legyen MinHeight=%d, MinWidth=%d" #: objinspstrconsts.oissetminconstraintshint -#, fuzzy msgid "Use current size as Min Constraints" msgstr "Az aktuális méret használata legkisebb méretként" @@ -1076,28 +1063,34 @@ msgid "Test Input" msgstr "Teszt bemenet" #: objinspstrconsts.oistheidentifierisnotamethodpresscanceltoundopressign -#, fuzzy -#| msgid "The identifier %s%s%s is not a method.%sPress Cancel to undo,%spress Ignore to force it." -msgid "The identifier \"%s\" is not a method.%sPress Cancel to undo,%spress Ignore to force it." -msgstr "A(z) %s%s%s azonosító nem metódus.%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." +msgid "" +"The identifier \"%s\" is not a method.%sPress Cancel to undo,%spress Ignore " +"to force it." +msgstr "" +"A(z) \"%s\" azonosító nem metódus.%sKattintson a Mégse gombra a " +"visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." #: objinspstrconsts.oisthemethodisincompatibletothiseventpresscanceltound -#, fuzzy -#| msgid "The method %s%s%s is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it." -msgid "The method \"%s\" is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it." -msgstr "A(z) %s%s%s metódus nem kompatibilis ezzel az eseménnyel (%s).%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." +msgid "" +"The method \"%s\" is incompatible to this event (%s).%sPress Cancel to undo," +"%spress Ignore to force it." +msgstr "" +"A(z) \"%s\" metódus nem kompatibilis ezzel az eseménnyel (%s).%sKattintson a " +"Mégse gombra a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." #: objinspstrconsts.oisthemethodisnotpublishedpresscanceltoundopressignor -#, fuzzy -#| msgid "The method %s%s%s is not published.%sPress Cancel to undo,%spress Ignore to force it." -msgid "The method \"%s\" is not published.%sPress Cancel to undo,%spress Ignore to force it." -msgstr "A(z) %s%s%s metódus nincs publikálva.%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." +msgid "" +"The method \"%s\" is not published.%sPress Cancel to undo,%spress Ignore to " +"force it." +msgstr "" +"A(z) \"%s\" metódus nincs publikálva.%sKattintson a Mégse gombra a " +"visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez." #: objinspstrconsts.oisunabletochangeparentofcontroltonewparent -#, fuzzy -#| msgid "Unable to change parent of control %s%s%s to new parent %s%s%s.%s%s" msgid "Unable to change parent of control \"%s\" to new parent \"%s\".%s%s" -msgstr "A(z) %s%s%s vezérlő szülőjét nem lehet megváltoztatni az új szülőre: %s%s%s.%s%s" +msgstr "" +"A(z) \"%s\" vezérlő szülőjét nem lehet megváltoztatni az új szülőre: \"%s\"." +"%s%s" #: objinspstrconsts.oisundo msgctxt "objinspstrconsts.oisundo" @@ -1391,9 +1384,7 @@ msgstr "Betöltés ..." #: objinspstrconsts.sccssgedtmoverowscols msgid "Move Rows/Cols" -msgstr "" -"Sorok/Oszlopok\n" -"mozgatása\n" +msgstr "Sorok/Oszlopok mozgatása" #: objinspstrconsts.sccssgedtopendialog msgctxt "objinspstrconsts.sccssgedtopendialog" @@ -1512,7 +1503,6 @@ msgid "New Button" msgstr "Új gomb" #: objinspstrconsts.tbcenewcheckbutton -#, fuzzy msgid "New CheckButton" msgstr "Új beragadó-gomb" @@ -1544,3 +1534,274 @@ msgstr "Fül mozgatása eggyel balra" msgid "Move tab right" msgstr "Fül mozgatása eggyel jobbra" +#~ msgid "OEM 1" +#~ msgstr "OEM 1" + +#~ msgid "OEM 2" +#~ msgstr "OEM 2" + +#~ msgid "OEM 3" +#~ msgstr "OEM 3" + +#~ msgid "OEM 4" +#~ msgstr "OEM 4" + +#~ msgid "OEM 5" +#~ msgstr "OEM 5" + +#~ msgid "OEM 6" +#~ msgstr "OEM 6" + +#~ msgid "OEM 7" +#~ msgstr "OEM 7" + +#~ msgid "OEM 8" +#~ msgstr "OEM 8" + +#~ msgid "OEM comma" +#~ msgstr "OEM vessző" + +#~ msgid "OEM minus" +#~ msgstr "OEM minusz" + +#~ msgid "OEM period" +#~ msgstr "OEM pont" + +#~ msgid "OEM plus" +#~ msgstr "OEM plusz" + +#~ msgid "All" +#~ msgstr "Mind" + +#~ msgctxt "objinspstrconsts.oiscancel" +#~ msgid "&Cancel" +#~ msgstr "Mégsem" + +#~ msgid "Copy components" +#~ msgstr "Komponensek másolása" + +#~ msgid "Cut components" +#~ msgstr "Komponensek kivágása" + +#~ msgid "Delete components" +#~ msgstr "Komponensek törlése" + +#~ msgid "Edit action list..." +#~ msgstr "Műveletlista szerkesztése..." + +#~ msgid "Index out of bounds" +#~ msgstr "Az index kívül esik a határokon" + +#~ msgid "not supported" +#~ msgstr "nem támogatott" + +#~ msgid "Paste components" +#~ msgstr "Komponensek beillesztése" + +#~ msgid "Set to default value" +#~ msgstr "Beállítás alapértelmezett értékre" + +#~ msgid "Custom options" +#~ msgstr "Saját beállítások" + +#~ msgid "Debug search path" +#~ msgstr "Hibakereső keresési útvonala" + +#~ msgid "Include search path" +#~ msgstr "Include fájlok keresési útvonala" + +#~ msgid "Library search path" +#~ msgstr "Függvénytár keresési útvonal" + +#~ msgid "Linker options" +#~ msgstr "Linker opciók" + +#~ msgid "Object search path" +#~ msgstr "Objektum keresési útvonal" + +#~ msgid "Result" +#~ msgstr "Eredmény" + +#~ msgid "Unit" +#~ msgstr "Unit" + +#~ msgid "Unit search path" +#~ msgstr "Unit keresési útvonal" + +#~ msgid "Unit source search path" +#~ msgstr "Unit forrás keresési útvonal" + +#~ msgid "Add..." +#~ msgstr "Hozzáadás..." + +#~ msgctxt "objinspstrconsts.sccsiledtdelete" +#~ msgid "Delete" +#~ msgstr "Törlés" + +#~ msgid "Edit ListView Items..." +#~ msgstr "ListView elemek szerkesztése..." + +#~ msgid "Edit TreeView Items..." +#~ msgstr "TreeView elemeinek szerkesztése..." + +#~ msgid "Alt" +#~ msgstr "Alt" + +#~ msgid "Ctrl" +#~ msgstr "Ctrl" + +#~ msgid "Accept" +#~ msgstr "Elfogadás" + +#~ msgid "Application Key" +#~ msgstr "Alkalmazás gomb" + +#~ msgid "Backspace" +#~ msgstr "Backspace" + +#~ msgctxt "objinspstrconsts.srvk_cancel" +#~ msgid "Cancel" +#~ msgstr "Mégsem" + +#~ msgid "Capital" +#~ msgstr "Capital" + +#~ msgctxt "objinspstrconsts.srvk_clear" +#~ msgid "Clear" +#~ msgstr "Clear" + +#~ msgid "Cmd" +#~ msgstr "Cmd" + +#~ msgid "Control" +#~ msgstr "Control" + +#~ msgid "Convert" +#~ msgstr "Convert" + +#~ msgctxt "objinspstrconsts.srvk_delete" +#~ msgid "Delete" +#~ msgstr "Törlés" + +#~ msgctxt "objinspstrconsts.srvk_down" +#~ msgid "Down" +#~ msgstr "Le" + +#~ msgid "End" +#~ msgstr "End" + +#~ msgid "Escape" +#~ msgstr "Escape" + +#~ msgid "Execute" +#~ msgstr "Execute" + +#~ msgid "Hanja" +#~ msgstr "Hanja" + +#~ msgctxt "objinspstrconsts.srvk_help" +#~ msgid "Help" +#~ msgstr "Súgó" + +#~ msgid "Home" +#~ msgstr "Home" + +#~ msgctxt "objinspstrconsts.srvk_insert" +#~ msgid "Insert" +#~ msgstr "Insert" + +#~ msgid "Junja" +#~ msgstr "Junja" + +#~ msgid "Kana" +#~ msgstr "Kana" + +#~ msgid "Mouse Button Left" +#~ msgstr "Bal egérgomb" + +#~ msgctxt "objinspstrconsts.srvk_left" +#~ msgid "Left" +#~ msgstr "Balra" + +#~ msgid "Left Windows Key" +#~ msgstr "Bal Windows gomb" + +#~ msgid "Mouse Button Middle" +#~ msgstr "Középső egérgomb" + +#~ msgid "Menu" +#~ msgstr "Menü" + +#~ msgid "Meta" +#~ msgstr "Meta" + +#~ msgid "Mode Change" +#~ msgstr "Mód váltása" + +#~ msgctxt "objinspstrconsts.srvk_next" +#~ msgid "Next" +#~ msgstr "Következő" + +#~ msgid "Nonconvert" +#~ msgstr "Nonconvert" + +#~ msgid "none" +#~ msgstr "semmi" + +#~ msgid "Numlock" +#~ msgstr "Num Lock" + +#~ msgid "Numpad %d" +#~ msgstr "Numpad %d" + +#~ msgid "Pause key" +#~ msgstr "Pause gomb" + +#~ msgid "Print" +#~ msgstr "Nyomtatás" + +#~ msgctxt "objinspstrconsts.srvk_prior" +#~ msgid "Prior" +#~ msgstr "Előző" + +#~ msgid "Mouse Button Right" +#~ msgstr "Jobb egérgomb" + +#~ msgid "Return" +#~ msgstr "Enter" + +#~ msgctxt "objinspstrconsts.srvk_right" +#~ msgid "Right" +#~ msgstr "Jobbra" + +#~ msgid "Right Windows Key" +#~ msgstr "Jobb Windows gomb" + +#~ msgid "Scroll" +#~ msgstr "Görgetés" + +#~ msgid "Select" +#~ msgstr "Kijelölés" + +#~ msgid "Shift" +#~ msgstr "Shift" + +#~ msgid "Snapshot" +#~ msgstr "Snapshot" + +#~ msgid "Space key" +#~ msgstr "Szóköz" + +#~ msgid "Super" +#~ msgstr "Super" + +#~ msgid "Tab" +#~ msgstr "Tab" + +#~ msgctxt "objinspstrconsts.srvk_unknown" +#~ msgid "Unknown" +#~ msgstr "Ismeretlen" + +#~ msgctxt "objinspstrconsts.srvk_up" +#~ msgid "Up" +#~ msgstr "Fel" diff --git a/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po b/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po index 72806e4a9b..3133dce287 100644 --- a/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po +++ b/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po @@ -2,14 +2,15 @@ msgid "" msgstr "" "MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=utf-8\n" +"Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" -"Language-Team: \n" +"Language-Team: Magyar (Hungarian)\n" "X-Generator: Poedit 1.5.4\n" +"Language: hu\n" #: lrdbzeosconst.slreditparamsform_caption msgid "Edit query param list" @@ -28,6 +29,5 @@ msgid "Param value" msgstr "Paraméter értéke" #: lrdbzeosconst.slreditparamsform_selectexpresion -#, fuzzy msgid "Select expresion" msgstr "Kifejezés választása" diff --git a/components/lazreport/source/languages/lr_const.hu.po b/components/lazreport/source/languages/lr_const.hu.po index 426cb658a7..8aa382178c 100644 --- a/components/lazreport/source/languages/lr_const.hu.po +++ b/components/lazreport/source/languages/lr_const.hu.po @@ -267,11 +267,16 @@ msgid "Default printer" msgstr "Alapértelmezett nyomtató" #: lr_const.sdescriptionavg -msgid "AVG(<Expression> [,BandName [,1]])/Calculates the average of <Expression> for [BandName] row given. If [1] parameter is used, calculates average for non-visible rows too." +msgid "" +"AVG(<Expression> [,BandName [,1]])/Calculates the average of <Expression> " +"for [BandName] row given. If [1] parameter is used, calculates average for " +"non-visible rows too." msgstr "" #: lr_const.sdescriptioncopy -msgid "COPY(<String>, <Position>, <Length>)/Returns <Length> characters from <String> starting at <Position>." +msgid "" +"COPY(<String>, <Position>, <Length>)/Returns <Length> characters from " +"<String> starting at <Position>." msgstr "" #: lr_const.sdescriptioncount @@ -287,15 +292,21 @@ msgid "DEC(<Value>)/Decrement <Value>." msgstr "" #: lr_const.sdescriptionformatdatetime -msgid "FORMATDATETIME(<Fmt>, <DateTime>)/Converts a <DateTime> value to a string using mask in <Fmt>." +msgid "" +"FORMATDATETIME(<Fmt>, <DateTime>)/Converts a <DateTime> value to a string " +"using mask in <Fmt>." msgstr "" #: lr_const.sdescriptionformatfloat -msgid "FORMATFLOAT(<Fmt>, <Numeric>)/Converts a <Numeric> value to a string using mask in <Fmt>." +msgid "" +"FORMATFLOAT(<Fmt>, <Numeric>)/Converts a <Numeric> value to a string using " +"mask in <Fmt>." msgstr "" #: lr_const.sdescriptionformattext -msgid "FORMATTEXT(<Mask>, <String>)/Applies <Mask> to given <String> and returns formatted string." +msgid "" +"FORMATTEXT(<Mask>, <String>)/Applies <Mask> to given <String> and returns " +"formatted string." msgstr "" #: lr_const.sdescriptionfrac @@ -307,7 +318,10 @@ msgid "INC(<Value>)/Increment <Value>." msgstr "" #: lr_const.sdescriptioninput -msgid "INPUT(<Caption> [,Default])/Shows dialog window with title <Caption> and edit box. If [Default] parameter is set, puts this string in edit box. After user clicks OK, returns input string." +msgid "" +"INPUT(<Caption> [,Default])/Shows dialog window with title <Caption> and " +"edit box. If [Default] parameter is set, puts this string in edit box. After " +"user clicks OK, returns input string." msgstr "" #: lr_const.sdescriptionint @@ -323,7 +337,10 @@ msgid "LOWERCASE(<String>)/Converts <String> symbols to lower case." msgstr "" #: lr_const.sdescriptionmax -msgid "MAX(<Expression> [,BandName [,1]])/Calculates the maximum of <Expression> for [BandName] row given. If [1] parameter is used, calculates maximum for non-visible rows too." +msgid "" +"MAX(<Expression> [,BandName [,1]])/Calculates the maximum of <Expression> " +"for [BandName] row given. If [1] parameter is used, calculates maximum for " +"non-visible rows too." msgstr "" #: lr_const.sdescriptionmaxnum @@ -331,11 +348,16 @@ msgid "MAXNUM(<Value1>, <Value2>)/Returns max of given values." msgstr "" #: lr_const.sdescriptionmessagebox -msgid "MESSAGEBOX(<Text>, <Title>, <Buttons>)/Shows standard dialog window with title, text and buttons." +msgid "" +"MESSAGEBOX(<Text>, <Title>, <Buttons>)/Shows standard dialog window with " +"title, text and buttons." msgstr "" #: lr_const.sdescriptionmin -msgid "MIN(<Expression> [,BandName [,1]])/Calculates the minimum of <Expression> for [BandName] row given. If [1] parameter is used, calculates minimum for non-visible rows too." +msgid "" +"MIN(<Expression> [,BandName [,1]])/Calculates the minimum of <Expression> " +"for [BandName] row given. If [1] parameter is used, calculates minimum for " +"non-visible rows too." msgstr "" #: lr_const.sdescriptionminnum @@ -347,7 +369,9 @@ msgid "MONTHOF(<Date>)/Returns month number (1..12) of given <Date>." msgstr "" #: lr_const.sdescriptionnamecase -msgid "NAMECASE(<String>)/Converts <String> symbols to lower case, and first symbol is in upper case." +msgid "" +"NAMECASE(<String>)/Converts <String> symbols to lower case, and first symbol " +"is in upper case." msgstr "" #: lr_const.sdescriptionnewcolumn @@ -359,11 +383,13 @@ msgid "NEWPAGE/Create new page for current report." msgstr "" #: lr_const.sdescriptionpos -msgid "POS(<SubString>, <String>)/Returns position of substring in given string." +msgid "" +"POS(<SubString>, <String>)/Returns position of substring in given string." msgstr "" #: lr_const.sdescriptionround -msgid "ROUND(<Value>)/Rounds the floating point <Value> to nearest integer number." +msgid "" +"ROUND(<Value>)/Rounds the floating point <Value> to nearest integer number." msgstr "" #: lr_const.sdescriptionshowband @@ -387,11 +413,16 @@ msgid "STRTOTIME(<String>)/Converts <String> to time." msgstr "" #: lr_const.sdescriptionsum -msgid "SUM(<Expression> [,BandName [,1]])/Calculates the sum of <Expression> for [BandName] row given. If [1] parameter is used, calculates sum for non-visible rows too." +msgid "" +"SUM(<Expression> [,BandName [,1]])/Calculates the sum of <Expression> for " +"[BandName] row given. If [1] parameter is used, calculates sum for non-" +"visible rows too." msgstr "" #: lr_const.sdescriptiontrim -msgid "TRIM(<String>)/Trims all heading and trailing spaces in <String> and returns resulting string." +msgid "" +"TRIM(<String>)/Trims all heading and trailing spaces in <String> and returns " +"resulting string." msgstr "" #: lr_const.sdescriptionuppercase @@ -1317,7 +1348,6 @@ msgid "&Stretch" msgstr "Nyújtás" #: lr_const.sgroupeditorformadddbfield -#, fuzzy msgctxt "lr_const.sgroupeditorformadddbfield" msgid "Insert DB field" msgstr "Adatbázis-mező beszúrása" @@ -1458,8 +1488,9 @@ msgid "LazReport template" msgstr "LazReport sablon" #: lr_const.smathcategory +#, fuzzy msgid "Math" -msgstr "" +msgstr "Matematikai" #: lr_const.smm msgid "MM" @@ -2167,7 +2198,6 @@ msgid "&All" msgstr "&Mind" #: lr_const.sprintformcollate -#, fuzzy msgid "Collate" msgstr "Oldalankénti csoportosítás" @@ -2181,8 +2211,12 @@ msgid "Current &page" msgstr "Jelenlegi oldal" #: lr_const.sprintforminfo -msgid "Enter page numbers and/or page ranges, separated by commas. For example, 1,3,5-12" -msgstr "Adja meg az oldalak sorszámait és/vagy tartományát, vesszővel elválasztva! Például: 1,3,5-12" +msgid "" +"Enter page numbers and/or page ranges, separated by commas. For example, " +"1,3,5-12" +msgstr "" +"Adja meg az oldalak sorszámait és/vagy tartományát, vesszővel elválasztva! " +"Például: 1,3,5-12" #: lr_const.sprintformnumber msgid "&Numbers:" @@ -2499,4 +2533,3 @@ msgstr "Szó tördelés" #: lr_const.syes msgid "Yes" msgstr "Igen" - diff --git a/components/lazsvnpkg/languages/svnclasses.hu.po b/components/lazsvnpkg/languages/svnclasses.hu.po index 1598862942..01319d07ae 100644 --- a/components/lazsvnpkg/languages/svnclasses.hu.po +++ b/components/lazsvnpkg/languages/svnclasses.hu.po @@ -34,15 +34,15 @@ msgstr "Beküldés" #: svnclasses.rscommitmsg msgid "Commit Message" -msgstr "" +msgstr "Beküldési üzenet" #: svnclasses.rscommitmsghistory msgid "Commit Message History" -msgstr "" +msgstr "Beküldési üzenetek előzményei" #: svnclasses.rscommitrevision msgid "Commit revision" -msgstr "" +msgstr "Változat beküldése" #: svnclasses.rsconflict msgid "Conflict" @@ -70,7 +70,7 @@ msgstr "Törölve" #: svnclasses.rsdiffactivefile msgid "Diff active file" -msgstr "" +msgstr "Jelenlegi fájl különbségei" #: svnclasses.rsedit msgid "Edit" @@ -94,19 +94,19 @@ msgstr "Az index tartományon kívül esik (%d)" #: svnclasses.rslazarussvncommit msgid "LazarusSVN Commit" -msgstr "" +msgstr "LazarusSVN beküldés" #: svnclasses.rslazarussvndiff msgid "%s - LazarusSVN Diff ..." -msgstr "" +msgstr "%s - LazarusSVN Különbségek ..." #: svnclasses.rslazarussvnlog msgid "%s - LazarusSVN Log ..." -msgstr "" +msgstr "%s - LazarusSVN Napló ..." #: svnclasses.rslazarussvnupdate msgid "%s - LazarusSVN Update ..." -msgstr "" +msgstr "%s - LazarusSVN Frissítés ..." #: svnclasses.rsmerged msgid "Merged" @@ -122,7 +122,7 @@ msgstr "(nincs szerző)" #: svnclasses.rsonlymodifieditemscanbediffed msgid "Only modified (M) Items can be diffed" -msgstr "" +msgstr "Csak a módosított (M) elemek különbségei vizsgálhatók" #: svnclasses.rsopenfileineditor msgid "Open file in editor" @@ -195,23 +195,23 @@ msgstr "Beállítások" #: svnclasses.rsshowdiff msgid "Show diff" -msgstr "" +msgstr "Különbségek megjelenítése" #: svnclasses.rsshowdiffbase msgid "Show Diff of Local Changes" -msgstr "" +msgstr "Helyi változtatások különbségeinek megjelenítése" #: svnclasses.rsshowdiffcountrev msgid "Show Last X Commits" -msgstr "" +msgstr "Utolsó X beküldés megjelenítése" #: svnclasses.rsshowdiffhead msgid "Show Diff Against HEAD" -msgstr "" +msgstr "Különbségek megjelenítése a HEAD-hez képest" #: svnclasses.rsshowdiffprev msgid "Show Diff Against Previous Version" -msgstr "" +msgstr "Különbségek megjelenítése az előző változathoz képest" #: svnclasses.rsshowlog msgid "Show log" diff --git a/components/leakview/languages/heaptrcview.hu.po b/components/leakview/languages/heaptrcview.hu.po index 2610e6d163..5233d44e05 100644 --- a/components/leakview/languages/heaptrcview.hu.po +++ b/components/leakview/languages/heaptrcview.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: heaptrcview.rsdtimes msgid " (%d times)" @@ -17,13 +17,11 @@ msgstr " (%d alkalommal)" #: heaptrcview.rserrorparse msgid "Error while parsing trace file" -msgstr "Hiba a nyomkövetési fájl kiértékelésekor" +msgstr "Hiba a nyomkövetési fájl elemzésekor" #: heaptrcview.rsleakview -#, fuzzy -#| msgid "Find source lines for leak/stack-traces" msgid "Leaks and Traces" -msgstr "Forrás sorainak megkeresése a szivárgás/verem követéséhez" +msgstr "Szivárgás és Nyomkövetés" #: heaptrcview.sbtnclipbrd msgid "Paste Clipboard" @@ -47,10 +45,9 @@ msgid "Stay on top" msgstr "Maradjon mindig legfelül" #: heaptrcview.sfrmcap -#, fuzzy -#| msgid "LeakView - HeapTrc output viewer" msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer" -msgstr "LeakView - HeapTrc kimenet megjelenítő" +msgstr "" +"Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet megjelenítő" #: heaptrcview.sfrmselectfilewithdebuginfo msgid "Select File with debug info" @@ -85,8 +82,8 @@ msgid "Leaking Mem Size: %d" msgstr "Szivárgó memória mérete: %d" #: heaptrcview.strtotalmemalloc -#, fuzzy -#| msgid "Total Mem alloced: %d" msgid "Total Mem allocated: %d" msgstr "Teljes lefoglalt memória: %d" +#~ msgid "Find source lines for leak/stack-traces" +#~ msgstr "Forrás sorainak megkeresése a szivárgás/verem követéséhez" diff --git a/components/macroscript/languages/emsstrings.hu.po b/components/macroscript/languages/emsstrings.hu.po new file mode 100644 index 0000000000..dcfab75ade --- /dev/null +++ b/components/macroscript/languages/emsstrings.hu.po @@ -0,0 +1,68 @@ +# +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" +"Language-Team: Magyar (Hungarian)\n" +"X-Generator: Poedit 1.5.4\n" +"Language: hu\n" + +#: emsstrings.emsactive +msgid "Scripting active." +msgstr "Szkriptek használata bekapcsolva." + +#: emsstrings.emsbtntestagain +msgid "Test again" +msgstr "Újratesztelés" + +#: emsstrings.emseditormacrotitle +#, fuzzy +msgid "Editor Macro Script" +msgstr "Szerkesztő Makrószkript" + +#: emsstrings.emsnotactive +msgid "Scripting not active. Selftest failed." +msgstr "Szkriptek használata kikapcsolva. Az önellenőrzés sikertelen volt." + +#: emsstrings.emsnotsupported +msgid "Scripting not active. Not supported on this platform or CPU." +msgstr "Szkriptek használata kikapcsolva. Nem támogatott platform vagy CPU." + +#: emsstrings.emspending +msgid "Scripting not active. Selftest will run next time the IDE is started." +msgstr "" +"Szkriptek használata kikapcsolva. Az önellenőrzés az IDE következő " +"indításakor fut." + +#: emsstrings.emsselftesterrcaption +msgid "Error in EditorMacroScript" +msgstr "EditorMacroScript hiba" + +#: emsstrings.emsselftestfailed +msgid "" +"The package EditorMacroScript (pascalscript macros) has detected a problem " +"and was deactivated.%0:sThe package failed its selftest with the message:%0:s" +"\"%1:s\"" +msgstr "" +"Az EditorMacroScript (pascalscript makrók) hibát érzékelt és ki lett " +"kapcsolva.%0:sA csomag önellenőrzése sikertelenül zárult a következő " +"üzenettel::%0:s\"%1:s\"" + +#: emsstrings.emsselftestfailedlasttime +msgid "" +"The package EditorMacroScript (pascalscript macros) has detected a problem " +"and was deactivated.%0:sThe package selftest was not completed during the " +"last start of the IDE." +msgstr "" +"Az EditorMacroScript (pascalscript makrók) hibát érzékelt és ki lett " +"kapcsolva.%0:sA csomag önellenőrzése nem futott végig az IDE legutóbbi " +"indításakor." + +#: emsstrings.emsstatustitle +msgid "Status" +msgstr "Állapot" diff --git a/components/memds/languages/frmselectdataset.hu.po b/components/memds/languages/frmselectdataset.hu.po index 37e661dcb1..a4a1707ced 100644 --- a/components/memds/languages/frmselectdataset.hu.po +++ b/components/memds/languages/frmselectdataset.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: frmselectdataset.scancelbtn msgid "Cancel" diff --git a/components/messagecomposer/languages/messagecomposer.hu.po b/components/messagecomposer/languages/messagecomposer.hu.po index 7f61a9aca3..8146a364de 100644 --- a/components/messagecomposer/languages/messagecomposer.hu.po +++ b/components/messagecomposer/languages/messagecomposer.hu.po @@ -50,11 +50,11 @@ msgstr "Törlés" #: messagecomposer.sdlgcaption msgid "Dialog caption" -msgstr "Párbeszédpanel címe" +msgstr "Párbeszéd címe" #: messagecomposer.sdlgtype msgid "Dialog type" -msgstr "Párbeszédpanel típusa" +msgstr "Párbeszéd típusa" #: messagecomposer.shelpcontext msgid "Help context" @@ -77,8 +77,9 @@ msgid "Kind of message" msgstr "Az üzenet típusa" #: messagecomposer.smaskinput +#, fuzzy msgid "Mask input" -msgstr "" +msgstr "Maszk bevitel" #: messagecomposer.smessagecomposercaption msgctxt "messagecomposer.smessagecomposercaption" diff --git a/components/pochecker/languages/pocheckerconsts.hu.po b/components/pochecker/languages/pocheckerconsts.hu.po index 87d71021be..47e8ff2eeb 100644 --- a/components/pochecker/languages/pocheckerconsts.hu.po +++ b/components/pochecker/languages/pocheckerconsts.hu.po @@ -107,7 +107,9 @@ msgstr "A(z) %s azonosító nem található ebben: %s" #: pocheckerconsts.sincompatibleformatargs msgid "[Line: %d] Incompatible and/or invalid format() arguments for:" -msgstr "[Sor: %d] Nem megfelelő és/vagy érvénytelen format() paraméterek a következőben:" +msgstr "" +"[Sor: %d] Nem megfelelő és/vagy érvénytelen format() paraméterek a " +"következőben:" #: pocheckerconsts.slineinfilename msgid "[Line %d] in %s:" @@ -197,13 +199,12 @@ msgstr "" #: pocheckerconsts.sselectalltests msgid "Select &All" -msgstr "" +msgstr "Összes kijelölése" #: pocheckerconsts.sselectbasictests -#, fuzzy -#| msgid "Select &Basic Tests" +#| msgid "Select basic tests" msgid "Select &Basic" -msgstr "Alapvető tesztek kijelölése" +msgstr "Alapvetőek kijelölése" #: pocheckerconsts.sselecttesttypes msgid "Select test types" @@ -227,5 +228,4 @@ msgstr "Fordítási statisztika ehhez:" #: pocheckerconsts.sunselectalltests msgid "&Unselect All" -msgstr "" - +msgstr "Kijelölések törlése" diff --git a/components/printers/design/languages/ideprinting.hu.po b/components/printers/design/languages/ideprinting.hu.po index 8014c49996..ef7b338e53 100644 --- a/components/printers/design/languages/ideprinting.hu.po +++ b/components/printers/design/languages/ideprinting.hu.po @@ -5,11 +5,11 @@ msgstr "" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: Poedit 1.5.4\n" -"Language: hu\n" #: ideprinting.sdescrformatting msgid "Formatting" diff --git a/components/projecttemplates/languages/frmtemplatevariables.hu.po b/components/projecttemplates/languages/frmtemplatevariables.hu.po index 19feaa7971..c8a4bddfeb 100644 --- a/components/projecttemplates/languages/frmtemplatevariables.hu.po +++ b/components/projecttemplates/languages/frmtemplatevariables.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: frmtemplatevariables.screateindir msgid "Create in &directory:" diff --git a/components/projecttemplates/languages/idetemplateproject.hu.po b/components/projecttemplates/languages/idetemplateproject.hu.po index 769f5c2d85..4abd2d67d7 100644 --- a/components/projecttemplates/languages/idetemplateproject.hu.po +++ b/components/projecttemplates/languages/idetemplateproject.hu.po @@ -1,17 +1,18 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: idetemplateproject.snewfromtemplate +msgctxt "idetemplateproject.snewfromtemplate" msgid "New project from template" msgstr "Új projekt sablonból" diff --git a/components/projecttemplates/languages/projecttemplates.hu.po b/components/projecttemplates/languages/projecttemplates.hu.po index 1a4cc2e794..6890a67cfa 100644 --- a/components/projecttemplates/languages/projecttemplates.hu.po +++ b/components/projecttemplates/languages/projecttemplates.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: projecttemplates.sbtncancel msgid "Cancel" diff --git a/components/synedit/languages/syndesignstringconstants.hu.po b/components/synedit/languages/syndesignstringconstants.hu.po index ff5fdaca62..3fdaf1487d 100644 --- a/components/synedit/languages/syndesignstringconstants.hu.po +++ b/components/synedit/languages/syndesignstringconstants.hu.po @@ -30,7 +30,7 @@ msgstr "Sorszámok" #: syndesignstringconstants.syndslineoverview msgid "Line Overview" -msgstr "" +msgstr "Sor áttekintés" #: syndesignstringconstants.syndsresetmouseactions msgid "Reset mouse actions" diff --git a/components/synedit/languages/syneditstrconst.hu.po b/components/synedit/languages/syneditstrconst.hu.po index a8877e64a2..f7bc4e01de 100644 --- a/components/synedit/languages/syneditstrconst.hu.po +++ b/components/synedit/languages/syneditstrconst.hu.po @@ -650,7 +650,7 @@ msgstr "GEMBASE fájlok (*.dml,*.gem)|*.DML;*.GEM" #: syneditstrconst.syns_filtergws msgid "GW-TEL Script Files (*.gws)|*.gws" -msgstr "GW-TEL Script fájlok (*.gws)|*.gws" +msgstr "GW-TEL parancsfájlok (*.gws)|*.gws" #: syneditstrconst.syns_filterhp48 msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" @@ -666,7 +666,7 @@ msgstr "INI-fájlok (*.ini)|*.ini" #: syneditstrconst.syns_filterinno msgid "Inno Setup Script Files (*.iss)|*.iss" -msgstr "Inno Setup Script fájlok (*.iss)|*.iss" +msgstr "Inno Setup parancsfájlok (*.iss)|*.iss" #: syneditstrconst.syns_filterjava msgid "Java Files (*.java)|*.java" diff --git a/components/tdbf/languages/registerdbf.hu.po b/components/tdbf/languages/registerdbf.hu.po index 76c1a69e24..88199c7b00 100644 --- a/components/tdbf/languages/registerdbf.hu.po +++ b/components/tdbf/languages/registerdbf.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: registerdbf.dbfsalldbasefiles msgid "DBase Files" diff --git a/doceditor/languages/lazde.hu.po b/doceditor/languages/lazde.hu.po index edf7b113b3..382bd212b3 100644 --- a/doceditor/languages/lazde.hu.po +++ b/doceditor/languages/lazde.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: lazdemsg.saboutformcaption msgid "About this application" diff --git a/languages/debuggerstrconst.hu.po b/languages/debuggerstrconst.hu.po index f7f38c9a7e..7b8df8800a 100644 --- a/languages/debuggerstrconst.hu.po +++ b/languages/debuggerstrconst.hu.po @@ -1,15 +1,15 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: debuggerstrconst.drsbreakpointcolwidthaction msgid "Action column" diff --git a/languages/lazaruside.hu.po b/languages/lazaruside.hu.po index dc38035e5d..9830e9c1c1 100644 --- a/languages/lazaruside.hu.po +++ b/languages/lazaruside.hu.po @@ -5,11 +5,11 @@ msgstr "" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: Poedit 1.5.4\n" -"Language: hu\n" #: lazarusidestrconsts.dbgbreakgroupdlgcaption msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption" @@ -153,11 +153,11 @@ msgstr "Általános" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on mouse down" -msgstr "" +msgstr "Szabványos, minden művelet (töréspont, összecsukás) egérgomb lenyomására" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" -msgstr "" +msgstr "Kibővített, műveletek (töréspont, összecsukás) egérgomb felengedésére. Kijelölés egérgomb lenyomására és mozgatás" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" @@ -211,20 +211,20 @@ msgstr "Extra-2 Gomb" #: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel msgid "Alt Double" -msgstr "Alt Dupla" +msgstr "Alt Kétszeres" #: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel msgid "Ctrl Double" -msgstr "Ctrl Dupla" +msgstr "Ctrl Kétszeres" #: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" msgid "Double" -msgstr "Dupla" +msgstr "Kétszeres" #: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel msgid "Shift Double" -msgstr "Shift Dupla" +msgstr "Shift Kétszeres" #: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" @@ -557,7 +557,7 @@ msgstr "Mindig látható kurzor" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" -msgstr "Bizonytalan fájl művelet" +msgstr "Bizonytalan fájl művelet:" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" @@ -573,7 +573,7 @@ msgstr "Alkalmazás beállításai" #: lazarusidestrconsts.dlgassertcode msgid "Include assertion code" -msgstr "" +msgstr "Infókimenet-kód beépítése (assertion code)" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" @@ -697,7 +697,7 @@ msgstr "Kis- és nagybetűk megkülönböztetése" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" -msgstr "Fordító beállítások ellenőrzése" +msgstr "Fordító beállításainak ellenőrzése" #: lazarusidestrconsts.dlgccoorphanedfilefound msgid "orphaned file found: %s" @@ -798,7 +798,7 @@ msgstr "Válasszon kódsablon fájlt! (*.dcl)" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" -msgstr "Bezár gomb megjelenítése a lapfüleken" +msgstr "Bezáró gomb megjelenítése a lapfüleken" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" @@ -824,7 +824,7 @@ msgstr "Üzenetek" #: lazarusidestrconsts.dlgcochecksandassertion msgid "Checks and assertion" -msgstr "" +msgstr "Ellenőrzések és infókimenet" #: lazarusidestrconsts.dlgcocompilercommands msgid "Compiler Commands" @@ -846,7 +846,7 @@ msgstr "Hibakeresés" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" -msgstr "Hibakereső elérési út hozzáadása (semmi):" +msgstr "Hibakereső elérési út kiegészítése (semmi):" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" @@ -893,11 +893,9 @@ msgid "Linking" msgstr "Összefűzés" #: lazarusidestrconsts.dlgcoloadsavehint -#, fuzzy -#| msgid "Load/Save" msgctxt "lazarusidestrconsts.dlgcoloadsavehint" msgid "Compiler options can be saved to an XML file." -msgstr "Töltés/Mentés" +msgstr "A fordító beállításai XML fájlba menthetők." #: lazarusidestrconsts.dlgcolor msgid "Color" @@ -922,7 +920,7 @@ msgstr "Parancssori paraméterek (alkalmazás név nélkül)" #: lazarusidestrconsts.dlgcommentalignmaxdefault msgid "Make default indent for new line if comment opens at column:" -msgstr "" +msgstr "Alapértelmezett behúzás a sor számára ha a megjegyzés a következő oszlopban kezdődik:" #: lazarusidestrconsts.dlgcommentalignmaxtoken msgid "Limit indent to" @@ -930,43 +928,43 @@ msgstr "Behúzás korlátozása ennyire: " #: lazarusidestrconsts.dlgcommentcontinue msgid "Prefix comments on linebreak" -msgstr "" +msgstr "Megjegyzés előtag sortöréskor" #: lazarusidestrconsts.dlgcommentcontinuematch msgid "Match current line" -msgstr "" +msgstr "Egyezés a jelenlegi sorral" #: lazarusidestrconsts.dlgcommentcontinuematchasterisk msgid "Match text including \"*\" of token \"(*\"" -msgstr "" +msgstr "Szövegegyezés, beleértve a \"*\"-ot a \"(*\" jelzésből" #: lazarusidestrconsts.dlgcommentcontinuematchline msgid "Match whole line" -msgstr "" +msgstr "Egyezés a teljes sorral" #: lazarusidestrconsts.dlgcommentcontinuematchtext msgid "Match text after token \"%s\"" -msgstr "" +msgstr "Szövegegyezés a(z) \"%s\" után" #: lazarusidestrconsts.dlgcommentcontinuematchtoken msgid "Match text including token \"%s\"" -msgstr "" +msgstr "Szövegegyezés, beleértve a(z) \"%s\" is" #: lazarusidestrconsts.dlgcommentcontinueprefix msgid "Prefix new line" -msgstr "" +msgstr "Előtag az új sorban" #: lazarusidestrconsts.dlgcommentcontinueprefixinddefault msgid "Align Prefix at indent of previous line" -msgstr "" +msgstr "Előtag igazítása az előző sor behúzásához" #: lazarusidestrconsts.dlgcommentcontinueprefixindmatch msgid "Align Prefix below start of comment on first comment line" -msgstr "" +msgstr "Előtag igazítása az első megjegyzéssorban lévő megjegyzés elejéhez" #: lazarusidestrconsts.dlgcommentcontinueprefixindnone msgid "Do not indent prefix" -msgstr "" +msgstr "Az előtag ne legyen behúzva" #: lazarusidestrconsts.dlgcommentindentgroupoptions msgid "Comments" @@ -974,19 +972,19 @@ msgstr "Megjegyzések" #: lazarusidestrconsts.dlgcommentshlashextendalways msgid "Extend, if matched or not matched" -msgstr "" +msgstr "Meghosszabbítás, ha illeszkedik vagy nem illeszkedik" #: lazarusidestrconsts.dlgcommentshlashextendalwayssplit msgid "Extend, if matched or not matched (not at EOL)" -msgstr "" +msgstr "Meghosszabbítás, ha illeszkedik vagy nem illeszkedik (nem a sor végén)" #: lazarusidestrconsts.dlgcommentshlashextendmatch msgid "Extend, if matched" -msgstr "" +msgstr "Meghosszabbítás, ha illeszkedik" #: lazarusidestrconsts.dlgcommentshlashextendmatchsplit msgid "Extend, if matched and caret in the middle of text (not at EOL)" -msgstr "" +msgstr "Meghosszabbítás, ha illeszkedik és a beszúrási jel a szöveg belsejében van (nem a sor végén)" #: lazarusidestrconsts.dlgcompilationandlinking msgid "Compilation and Linking" @@ -997,10 +995,8 @@ msgid "Compiler messages" msgstr "Fordító üzenetei" #: lazarusidestrconsts.dlgcompilermessages -#, fuzzy -#| msgid "Compiler messages language file" msgid "Compiler messages language file (*.msg)" -msgstr "Fordító üzenetek nyelvi fájlja" +msgstr "Fordító üzenetek nyelvi fájlja (*.msg)" #: lazarusidestrconsts.dlgcompileroptions msgctxt "lazarusidestrconsts.dlgcompileroptions" @@ -1054,7 +1050,7 @@ msgstr "" #: lazarusidestrconsts.dlgcosetasdefault msgid "Set compiler options as default" -msgstr "Fordító beállítások használata alapértelmezésként" +msgstr "Legyen alapértelmezett a fordító beállítása" #: lazarusidestrconsts.dlgcoshowerr msgid "Show errors" @@ -1107,7 +1103,7 @@ msgstr "" #: lazarusidestrconsts.dlgcotrashvariables msgid "Trash variables" -msgstr "" +msgstr "Változók feltöltése szeméttel" #: lazarusidestrconsts.dlgcounitstyle msgid "Unit style" @@ -1313,19 +1309,19 @@ msgstr "Megfordítás" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit msgid "Ignore Locks, use longest unused editor" -msgstr "" +msgstr "Zárolások figyelmen kívül hagyása, a legrégebben használt szerkesztő használata" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit msgid "Ignore Locks, if editor is current" -msgstr "" +msgstr "Zárolások figyelmen kívül hagyása, ha a szerkesztő a jelenlegi" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin msgid "Ignore Locks, if editor in current window" -msgstr "" +msgstr "Zárolások figyelmen kívül hagyása, ha a szerkesztő a jelenlegi ablakban van" #: lazarusidestrconsts.dlgeditaccesscaptionlockedinview msgid "Locked, if text in view" -msgstr "" +msgstr "Zárolva, ha a szöveg látható" #: lazarusidestrconsts.dlgeditaccesscaptionunlocked msgid "Unlocked" @@ -1333,7 +1329,7 @@ msgstr "Feloldva" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview msgid "Unlocked, if text in centered view" -msgstr "" +msgstr "Feloldva, ha a szöveg középen látható" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin msgid "New tab, existing or new window" @@ -1426,7 +1422,7 @@ msgstr "Elem tulajdonságok" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" -msgstr "End gomb a legközelebbi végre ugrik" +msgstr "End billentyű a legközelebbi végre ugrik" #: lazarusidestrconsts.dlgenvask msgid "Ask" @@ -1865,7 +1861,7 @@ msgstr "Azonosító módszer" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" -msgstr "IDE beállítások" +msgstr "IDE beállításai" #: lazarusidestrconsts.dlgifdefblockactive msgid "Active $IFDEF code" @@ -1892,9 +1888,8 @@ msgid "Included mixed state $IFDEF node" msgstr "Kevert állapotú $IFDEF csomópont" #: lazarusidestrconsts.dlgignoreverb -#, fuzzy msgid "Ignore" -msgstr "Mellőzés" +msgstr "Kihagyás" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" @@ -1994,7 +1989,6 @@ msgid "Left:" msgstr "Bal:" #: lazarusidestrconsts.dlglefttopclr -#| msgid "Guid lines Left,Top" msgid "Guide lines Left,Top" msgstr "Segédvonalak balra, fent" @@ -2028,7 +2022,7 @@ msgstr "Sorszámok megjelenítése a futási hibák esetén" #: lazarusidestrconsts.dlgloaddfile msgid "Load desktop settings from file" -msgstr "Felület beállítások betöltése fájlból" +msgstr "Felület beállításainak betöltése fájlból" #: lazarusidestrconsts.dlgmainmenu msgid "Main Menu" @@ -2176,7 +2170,7 @@ msgstr "Kulcsszavak figyelmen kívül hagyása" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable timer for markup current word" -msgstr "Időzítő kikapcsolása az aktuális szó kiemelés" +msgstr "Időzítő kikapcsolása az aktuális szó kiemelésekor" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim spaces (when highlighting current selection)" @@ -2204,12 +2198,12 @@ msgstr "Metódusok és tulajdonságok vegyítése" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" -msgstr "Szimpla" +msgstr "Egyszeres" #: lazarusidestrconsts.dlgmouseoptbtn2 msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" msgid "Double" -msgstr "Dupla" +msgstr "Kétszeres" #: lazarusidestrconsts.dlgmouseoptbtn3 msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" @@ -2282,7 +2276,7 @@ msgstr "Művelet" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" -msgstr "Klikk" +msgstr "Kattintás" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" @@ -2343,10 +2337,9 @@ msgid "Order" msgstr "Sorrend" #: lazarusidestrconsts.dlgmouseoptheadpriority -#, fuzzy msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" -msgstr "Besorolás" +msgstr "Prioritás" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" @@ -2468,23 +2461,23 @@ msgstr "Többszörös kijelölés" #: lazarusidestrconsts.dlgmultiwinaccessgroup msgid "Find Editor for Jump Targets" -msgstr "" +msgstr "Szerkesztő keresése az ugrási célhoz" #: lazarusidestrconsts.dlgmultiwinaccessorder msgid "Order to use for editors matching the same criteria" -msgstr "" +msgstr "Sorrend az azonos szempontoknak megfelelő szerkesztők számára" #: lazarusidestrconsts.dlgmultiwinaccessorderedit msgid "Most recent focused editor for this file" -msgstr "" +msgstr "A fájl számára legutóbb fókuszba állított szerkesztő" #: lazarusidestrconsts.dlgmultiwinaccessorderwin msgid "Editor (for file) in most recent focused window" -msgstr "" +msgstr "Szerkesztő (a fájl számára) a legutóbb fókuszba állított ablakban" #: lazarusidestrconsts.dlgmultiwinaccesstype msgid "Priority list of criteria to choose an editor:" -msgstr "" +msgstr "Szempontok elsőbbségi listája a szerkesztő kiválasztásához:" #: lazarusidestrconsts.dlgmultiwinoptions msgid "Pages and Windows" @@ -2567,7 +2560,7 @@ msgstr "Egyéb unit fájlok (-Fu) (pontosvesszővel elválasztva)" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite block" -msgstr "Blokk felülírása" +msgstr "Kijelölés felülírása" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" @@ -2575,7 +2568,7 @@ msgstr "Tippek a komponens palettához" #: lazarusidestrconsts.dlgpasext msgid "Default Pascal extension" -msgstr "Alapértelmezett pascak kiterjesztés" +msgstr "Alapértelmezett pascal kiterjesztés" #: lazarusidestrconsts.dlgpasextkeywords msgid "Highlight control statements as keywords" @@ -2613,7 +2606,7 @@ msgstr "Csak \"String\"" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent block" -msgstr "" +msgstr "Megmaradó kijelölés" #: lazarusidestrconsts.dlgpersistentcursor msgid "Persistent cursor" @@ -2633,7 +2626,7 @@ msgstr "Ikon törlése" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" -msgstr "Alkalmazás köteg létrehozása" +msgstr "Alkalmazásköteg létrehozása" #: lazarusidestrconsts.dlgpodefaulticon msgid "Load &Default" @@ -2703,18 +2696,17 @@ msgstr "Megnevezés:" #: lazarusidestrconsts.dlgpouiaccess msgid "UI Access (uiAccess)" -msgstr "" +msgstr "UI Access (uiAccess)" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging (Darwin only)" -msgstr "Alkalmazás köteg használata futtatáshoz és hibakereséshez (csak Darwin)" +msgstr "Alkalmazásköteg használata futtatáshoz és hibakereséshez (csak Darwin)" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest file to enable themes (Windows only)" msgstr "Témák engedélyezése jegyzékfájl használatával (csak Windows)" #: lazarusidestrconsts.dlgpriorities -#, fuzzy msgid "Priorities" msgstr "Prioritások" @@ -2725,7 +2717,7 @@ msgstr "Projekt" #: lazarusidestrconsts.dlgprojectoptions msgid "Project Options" -msgstr "Projekt beállítások" +msgstr "Projekt beállításai" #: lazarusidestrconsts.dlgprojectoptionsfor msgid "Options for Project: %s" @@ -2813,12 +2805,12 @@ msgstr "Unokák kiválasztása" #: lazarusidestrconsts.dlgruberbandcreationcolor msgid "Rubberband Creation" -msgstr "" +msgstr "Nyújtható létrehozás" #: lazarusidestrconsts.dlgruberbandselectioncolor msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" msgid "Rubberband Selection" -msgstr "" +msgstr "Nyújtható kijelölés" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" @@ -2884,7 +2876,7 @@ msgstr "Görgetés tipp megjelenítése" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" -msgstr "Túlgörgetés a fájl végén" +msgstr "Görgetés a fájl vége után" #: lazarusidestrconsts.dlgscrollpastendline msgid "Caret past end of line" @@ -2957,7 +2949,7 @@ msgstr "Minden megjelenítése" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" -msgstr "Futtatható fájl információk megjelenítése (csak Win32)" +msgstr "Futtatható fájl információinak megjelenítése (csak Win32)" #: lazarusidestrconsts.dlgshowfullfilenames msgid "Show full file names" @@ -3061,7 +3053,7 @@ msgstr "Verem mérete" #: lazarusidestrconsts.dlgstatickeyword msgid "Static keyword in objects" -msgstr "" +msgstr "\"Static\" kulcsszó az objektumokban" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" @@ -3069,11 +3061,11 @@ msgstr "Leállítás ennyi hiba után:" #: lazarusidestrconsts.dlgstringautoappend msgid "Append text to close string" -msgstr "" +msgstr "Szöveg hozzáadása a karakterlánc lezárásakor" #: lazarusidestrconsts.dlgstringautoprefix msgid "Prefix string on new line" -msgstr "" +msgstr "Előtag a karakterlánchoz az új sorban" #: lazarusidestrconsts.dlgstringbreakindenttab msgid "String ''" @@ -3081,7 +3073,7 @@ msgstr "Karakterlánc ''" #: lazarusidestrconsts.dlgstringenableautocontinue msgid "Extend strings on linebreak" -msgstr "" +msgstr "Karakterláncok meghosszabbítása sortöréskor" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" @@ -3489,20 +3481,16 @@ msgid "Dependency" msgstr "Függőség" #: lazarusidestrconsts.lisa2pexistingfile2 -#, fuzzy -#| msgid "Existing file: %s%s%s" msgid "Existing file: \"%s\"" -msgstr "Létező fájl: %s%s%s" +msgstr "Létező fájl: \"%s\"" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "Fájl már létezik" #: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage -#, fuzzy -#| msgid "File %s%s%s already exists in the package." msgid "File \"%s\" already exists in the package." -msgstr "A(z) %s%s%s fájl már létezik a csomagban." +msgstr "A(z) \"%s\" fájl már létezik a csomagban." #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" @@ -3541,10 +3529,8 @@ msgid "Invalid Unit Name" msgstr "Érvényelen unit név" #: lazarusidestrconsts.lisa2pisnotavalidunitname -#, fuzzy -#| msgid "%s%s%s is not a valid unit name." msgid "\"%s\" is not a valid unit name." -msgstr "A(z) %s%s%s érvénytelen unit név." +msgstr "A(z) \"%s\" nem érvényes unit név." #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" @@ -3560,14 +3546,12 @@ msgid "New File" msgstr "Új fájl" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting -#, fuzzy -#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgid "No package found for dependency \"%s\".%sPlease choose an existing package." -msgstr "Nem található csomag a(z) %s%s%s függőséghez.%sVálasszon egy létező csomagot!" +msgstr "Nem található csomag a(z) \"%s\" függőséghez.%sVálasszon egy létező csomagot!" #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" -msgstr "Csomag név túl hosszú" +msgstr "Oldalnév túl hosszú" #: lazarusidestrconsts.lisa2ppalettepage msgid "Palette Page:" @@ -3595,59 +3579,41 @@ msgid "Switch Paths" msgstr "Útvonalak váltása" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit -#, fuzzy -#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." -msgstr "A(z) %s%s%s őstípusnak ugyanaz a neve,%smint a(z) %s%s%s unit-nak." +msgstr "A(z) \"%s\" őstípusnak ugyanaz a neve,%smint a(z) \"%s\" unit-nak." #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier -#, fuzzy -#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier." msgid "The ancestor type \"%s\" is not a valid Pascal identifier." -msgstr "A(z) %s%s%s őstípus nem érvényes pascal azonosító." +msgstr "A(z) \"%s\" őstípus nem érvényes pascal azonosító." #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame -#, fuzzy -#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgid "The class name \"%s\" and ancestor type \"%s\" are the same." -msgstr "A(z) %s%s%s osztálynév és a(z) %s%s%s őstípus megegyezik." +msgstr "A(z) \"%s\" osztálynév és a(z) \"%s\" őstípus megegyezik." #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile -#, fuzzy -#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" -msgstr "A(z) %s%s%s osztálynév már létezik a(z)%s%s csomagban %sFájl: %s%s%s" +msgstr "A(z) \"%s\" osztálynév már létezik a(z)%s%s csomagban %sFájl: \"%s\"" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit -#, fuzzy -#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." -msgstr "A(z) %s%s%s osztálynak ugyanaz a neve,%smint a(z) %s%s%s unit-nak." +msgstr "A(z) \"%s\" osztálynak ugyanaz a neve,%smint a(z) \"%s\" unit-nak." #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier -#, fuzzy -#| msgid "The class name %s%s%s is not a valid Pascal identifier." msgid "The class name \"%s\" is not a valid Pascal identifier." -msgstr "A(z) %s%s%s osztálynév nem érvényes pascal azonosító." +msgstr "A(z) \"%s\" osztálynév nem érvényes pascal azonosító." #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea -#, fuzzy -#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." -msgstr "A(z) %s%s%s fájl már része a jelenlegi projektnek.%sRossz ötlet fájlokat megosztani projektek és csomagok között." +msgstr "A(z)\"%s\" fájl már része a jelenlegi projektnek.%sRossz ötlet fájlokat megosztani projektek és csomagok között." #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename -#, fuzzy -#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." -msgstr "A(z) %s%s%s fájlnév ellentmondásos, mert a csomagnak még nincs alapértelmezett könyvtára.%sAdjon meg egy fájlnevet teljes elérési úttal!" +msgstr "A(z) \"%s\" fájlnév ellentmondásos, mert a csomagnak még nincs alapértelmezett könyvtára.%sAdjon meg egy fájlnevet teljes elérési úttal!" #: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor -#, fuzzy -#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" -msgstr "A(z) %s%s%s legnagyobb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" +msgstr "A(z) \"%s\" legnagyobb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" @@ -3655,59 +3621,41 @@ msgid "The Maximum Version is lower than the Minimim Version." msgstr "A legnagyobb változatszám kisebb, mint a legkisebb változatszám." #: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor -#, fuzzy -#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" -msgstr "A(z) %s%s%s legkisebb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" +msgstr "A(z) \"%s\" legkisebb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe -#, fuzzy -#| msgid "The package already has a dependency on the package %s%s%s." msgid "The package already has a dependency on the package \"%s\"." -msgstr "A csomaghoz már be van állítva függőségként a(z) %s%s%s csomag." +msgstr "A csomaghoz már be van állítva függőségként a(z) \"%s\" csomag." #: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting -#, fuzzy -#| msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgid "The package name \"%s\" is invalid.%sPlease choose an existing package." -msgstr "A(z) %s%s%s csomagnév érvénytelen.%sVálasszon egy létező csomagot!" +msgstr "A(z) \"%s\" csomagnév érvénytelen.%sVálasszon egy létező csomagot!" #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars -#, fuzzy -#| msgid "The page name %s%s%s is too long (max 100 chars)." msgid "The page name \"%s\" is too long (max 100 chars)." -msgstr "A(z) %s%s%s csomagnév túl hosszú (maximum 100 karakter lehet)." +msgstr "A(z) \"%s\" csomagnév túl hosszú (legfeljebb 100 karakter lehet)." #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage -#, fuzzy -#| msgid "The unitname %s%s%s already exists in the package:%s%s" msgid "The unitname \"%s\" already exists in the package:%s%s" -msgstr "A(z) %s%s%s unit név már létezik a(z) %s%s csomagban" +msgstr "A(z) \"%s\" unit név már létezik a csomagban: %s%s" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage -#, fuzzy -#| msgid "The unitname %s%s%s already exists in this package." msgid "The unitname \"%s\" already exists in this package." -msgstr "A(z) %s%s%s unit név már létezik ebben a csomagban." +msgstr "A(z) \"%s\" unit név már létezik ebben a csomagban." #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer -#, fuzzy -#| msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgid "The unit name \"%s\"%sand filename \"%s\" differ." -msgstr "A(z) %s%s%s%s unit név és a(z) %s%s%s fájlnév különbözik." +msgstr "A(z) \"%s\" unit név%sés a(z) \"%s\" fájlnév különbözik." #: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename -#, fuzzy -#| msgid "The unit name %s%s%s does not correspond to the filename." msgid "The unit name \"%s\" does not correspond to the filename." -msgstr "A(z) %s%s%s unit név nem tartozik a fájlnévhez." +msgstr "A(z) \"%s\" unitnév nem megfelelő a fájlnévhez." #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent -#, fuzzy -#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages." msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." -msgstr "A(z) %s%s%s unit neve megegyezik egy regisztrált komponens nevével.%sEnnek használata furcsa hibaüzeneteket okozhat." +msgstr "A(z) \"%s\" unit neve megegyezik egy regisztrált komponens nevével.%sEnnek használata furcsa hibaüzeneteket okozhat." #: lazarusidestrconsts.lisa2punitfilename2 msgid "Unit File Name:" @@ -3739,7 +3687,7 @@ msgstr "Minden betöltés megszakítása" #: lazarusidestrconsts.lisaborted msgid "Aborted" -msgstr "" +msgstr "Megszakítva" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" @@ -3751,11 +3699,11 @@ msgstr "Egész betöltés megszakítása" #: lazarusidestrconsts.lisabout msgid "About ..." -msgstr "" +msgstr "Névjegy ..." #: lazarusidestrconsts.lisabout2 msgid "About %s" -msgstr "" +msgstr "Részletek erről: %s" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" @@ -3844,7 +3792,7 @@ msgstr "Fájlok hozzáadása könyvtárból" #: lazarusidestrconsts.lisaddfilter msgid "Add Filter ..." -msgstr "" +msgstr "Szűrő hozzáadása ..." #: lazarusidestrconsts.lisaddkeyworddo msgid "Add keyword \"do\"" @@ -3893,7 +3841,7 @@ msgstr "Töréspont adott címen ..." #: lazarusidestrconsts.lisaddtoincludesearchpath msgid "Add to include search path?" -msgstr "" +msgstr "Hozzáadás az include keresési útvonalakhoz?" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" @@ -3901,7 +3849,7 @@ msgstr "%s hozzáadása a projekthez?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" -msgstr "" +msgstr "Hozzáadás a unit keresési útvonalakhoz?" #: lazarusidestrconsts.lisaddunitinterfaces msgid "Add unit interfaces" @@ -3936,20 +3884,16 @@ msgid "Invalid Package" msgstr "Érvénytelen csomag" #: lazarusidestrconsts.lisaf2pinvalidpackageid -#, fuzzy -#| msgid "Invalid package ID: %s%s%s" msgid "Invalid package ID: \"%s\"" -msgstr "Érvénytelen csomag azonosító: %s%s%s" +msgstr "Érvénytelen csomag azonosító: \"%s\"" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "A csomag csak olvasható" #: lazarusidestrconsts.lisaf2ppackagenotfound -#, fuzzy -#| msgid "Package %s%s%s not found." msgid "Package \"%s\" not found." -msgstr "A(z) %s%s%s csomag nem található." +msgstr "A(z) \"%s\" csomag nem található." #: lazarusidestrconsts.lisaf2pshowall msgctxt "lazarusidestrconsts.lisaf2pshowall" @@ -3957,11 +3901,9 @@ msgid "Show all" msgstr "Összes megjelenítése" #: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage -#, fuzzy -#| msgid "The file %s%s%s%sis already in the package %s." msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage" msgid "The file \"%s\"%sis already in the package %s." -msgstr "A(z) %s%s%s%s fájl már a(z) %s csomagban van." +msgstr "A(z) \"%s\"%sfájl már a(z) %s csomagban van." #: lazarusidestrconsts.lisaf2pthepackageisreadonly msgid "The package %s is read only." @@ -3972,14 +3914,12 @@ msgid "Unit name: " msgstr "Unit név:" #: lazarusidestrconsts.lisafilealreadyexistsreplaceit -#, fuzzy -#| msgid "A file %s%s%s already exists.%sReplace it?" msgid "A file \"%s\" already exists.%sReplace it?" -msgstr "A(z) %s%s%s fájl már létezik.%sLecserélhető?" +msgstr "A(z) \"%s\" fájl már létezik.%sLecseréli?" #: lazarusidestrconsts.lisafilterwiththenamealreadyexists msgid "A filter with the name \"%s\" already exists." -msgstr "" +msgstr "Egy szűrő már létezik ezzel a névvel: \"%s\"." #: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean msgid "After cleaning up (clean all or clean common files), switch to clean automatically" @@ -4022,10 +3962,8 @@ msgid "All parameters of this function are already set at this call. Nothing to msgstr "Ezen eljárás minden paramétere be lett már állítva e hívásban. Nincs mit hozzáadni." #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened -#, fuzzy -#| msgid "All your modifications to %s%s%s%swill be lost and the file reopened." msgid "All your modifications to \"%s\"%swill be lost and the file reopened." -msgstr "A(z) %s%s%s%s minden módosítása el fog veszni és a fájl újra meg lesz nyitva." +msgstr "A(z) \"%s\"%sminden módosítása el fog veszni és a fájl újra meg lesz nyitva." #: lazarusidestrconsts.lisalpha msgid "Alpha" @@ -4049,7 +3987,7 @@ msgstr "Mindig legyen kisbetűsre alakítva a javasolt alapértelmezett fájlné #: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused msgid "Always draw selected items focused" -msgstr "" +msgstr "A kijelölt elemeket mindig fókuszálva rajzolja" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" @@ -4064,18 +4002,14 @@ msgid "Ambiguous file found" msgstr "Megtévesztő fájl található" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete -#, fuzzy -#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" -msgstr "Megtévesztő fájl található: %s%s%s%sEz a fájl összetéveszthető a(z) %s%s%s%s fájllal%sTörli a megtévesztő fájlt?" +msgstr "Megtévesztő fájl található: \"%s\"%sEz a fájl összetéveszthető ezzel: \"%s\"%sTörli a megtévesztő fájlt?" #: lazarusidestrconsts.lisambiguousfilesfound msgid "Ambiguous files found" msgstr "Megtévesztő fájlok találhatók" #: lazarusidestrconsts.lisambiguousunitfound -#, fuzzy -#| msgid "Ambiguous Unit found" msgid "Ambiguous unit found" msgstr "Megtévesztő unit található" @@ -4124,10 +4058,8 @@ msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distan msgstr "" #: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro -#, fuzzy -#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgid "An error occured at last startup while loading %s!%sLoad this project again?" -msgstr "Hiba történt a legutóbbi indításkor a(z) %s betöltése közben!%s%sÚjra megnyitja a projektet?" +msgstr "Hiba történt a legutóbbi indításkor a(z) %s betöltése közben!%sÚjra megnyitja a projektet?" #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" @@ -4213,7 +4145,7 @@ msgstr "Az .lfm fájlok automatikus átalakítása .lrs include fájlokká" #: lazarusidestrconsts.lisautomaticallyignoreforselection msgid "do not complete selection" -msgstr "" +msgstr "ne egészítse ki a kijelölést" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" @@ -4269,7 +4201,7 @@ msgstr "A Backup könyvtár létrehozása a projekt könyvtárában" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "A csomag nevének vagy változatának módosítása megszakítja a függőségeket. Ezeket a függőségeket is módisítja?%sVálasszon Igen-t minden felsorolt függőség módosításához.%sVálassza a Kihagyás-t a függőségek megszakításához és a folytatáshoz." +msgstr "A csomag nevének vagy változatának módosítása megszakítja a függőségeket. Ezeket a függőségeket is módosítja?%sVálassza az Igen-t minden felsorolt függőség módosításához.%sVálassza a Kihagyás-t a függőségek megszakításához és a folytatáshoz." #: lazarusidestrconsts.lisbegins msgid "begins" @@ -4411,7 +4343,7 @@ msgstr "Építés" #: lazarusidestrconsts.lisbuildide msgid "Build IDE" -msgstr "" +msgstr "IDE építése" #: lazarusidestrconsts.lisbuildidewithpackages msgid "build IDE with packages" @@ -4435,7 +4367,7 @@ msgstr "Mód:" #: lazarusidestrconsts.lisbuildmodeintitleinexample msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus" -msgstr "" +msgstr "A cím a tálcán így jelenik meg: projekt1.lpi - Kiadás - Lazarus" #: lazarusidestrconsts.lisbuildmodes msgid "Build modes" @@ -4460,7 +4392,7 @@ msgstr "Elfoglalt" #: lazarusidestrconsts.lisbyte msgid "%s byte" -msgstr "" +msgstr "%s byte" #: lazarusidestrconsts.liscallingtocreatemakefilefromfailed msgid "Calling %s to create Makefile from %s failed." @@ -4496,22 +4428,20 @@ msgid "Cannot copy top level component." msgstr "Legfelső szintű komponenst nem lehet másolni." #: lazarusidestrconsts.liscannotcreatefile -#, fuzzy -#| msgid "Cannot create file %s%s%s" msgid "Cannot create file \"%s\"" -msgstr "A fájl nem hozható létre: %s%s%s" +msgstr "A fájl nem hozható létre: \"%s\"" #: lazarusidestrconsts.liscannotexecute msgid "can not execute \"%s\"" -msgstr "" +msgstr "nem lehet végrehajtani ezt: \"%s\"" #: lazarusidestrconsts.liscannotfind msgid "Cannot find %s" -msgstr "" +msgstr "Nem található: %s" #: lazarusidestrconsts.liscannotfindexecutable msgid "can not find executable \"%s\"" -msgstr "" +msgstr "nem található a futtatható \"%s\"" #: lazarusidestrconsts.liscannotfindlazarusstarter msgid "Cannot find Lazarus starter:%s%s" @@ -4519,7 +4449,7 @@ msgstr "A Lazarus indító nem található:%s%s" #: lazarusidestrconsts.liscannotfindunit msgid "Cannot find unit %s" -msgstr "" +msgstr "Nem található a unit: %s" #: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling msgid "Cannot test the compiler while debugging or compiling." @@ -4531,7 +4461,7 @@ msgstr "Csak TComponent-ek osztálya módosítható" #: lazarusidestrconsts.liscantfindavalidppu msgid "Can't find a valid %s.ppu" -msgstr "" +msgstr "Nem található érvényes %s.ppu" #: lazarusidestrconsts.liscaptiondiff msgctxt "lazarusidestrconsts.liscaptiondiff" @@ -4544,7 +4474,7 @@ msgstr "%s (%s fájl)" #: lazarusidestrconsts.liscbpreallydeletesourcefiles msgid "Really delete %s source files%s%s" -msgstr "" +msgstr "Valóban törlendő %s forrásfájl%s%s" #: lazarusidestrconsts.lisccdchangeclassof msgid "Change Class of %s" @@ -4576,7 +4506,7 @@ msgstr "Kimenet másolása a vágólapra" #: lazarusidestrconsts.lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" -msgstr "" +msgstr "Az FPC .ppu fájljainak dátuma több mint egy órával eltér.%sEz azt jelentheti, hogy különböző telepítésből származnak.%sFájl1: %s%sFájl2: %s" #: lazarusidestrconsts.lisccoerrorcaption msgctxt "lazarusidestrconsts.lisccoerrorcaption" @@ -4621,7 +4551,7 @@ msgstr "lefordított FPC unit nem található: %s.ppu" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " -msgstr "többszörös fordító beállítások találhatók:" +msgstr "többszörös fordítóbeállítások találhatók:" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" @@ -4637,7 +4567,7 @@ msgstr "ppu kétszer létezik: %s, %s" #: lazarusidestrconsts.lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." -msgstr "A(z) %s.ppu lefordított FPC unit nem található.%sEz tipikusan azt jelenti, hogy az fpc.cfg fájl hibás. Vagy az FPC telepítés hibás." +msgstr "A(z) %s.ppu lefordított FPC unit nem található.%sEz általában azt jelenti, hogy az fpc.cfg fájl vagy az FPC telepítés hibás." #: lazarusidestrconsts.lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" @@ -4841,7 +4771,6 @@ msgid "Published properties without default" msgstr "\"Published\" tulajdonságok \"default\" nélkül" #: lazarusidestrconsts.lisceshowcodeobserver -#| msgid "Show observerations about" msgid "Show observations about" msgstr "Megfigyelések megjelenítése erről:" @@ -4913,15 +4842,15 @@ msgstr "Betöltés folytatása" #: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection msgid "Do not know how to copy this form editing selection" -msgstr "" +msgstr "Nem tudom, hogyan kell másolni ezt a kijelölést az form szerkesztőben" #: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection msgid "Do not know how to cut this form editing selection" -msgstr "" +msgstr "Nem tudom, hogyan kell kivágni ezt a kijelölést az form szerkesztőben" #: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection msgid "Do not know how to delete this form editing selection" -msgstr "" +msgstr "Nem tudom, hogyan kell törölni ezt a kijelölést az form szerkesztőben" #: lazarusidestrconsts.liscfeerrorcreatingcomponent msgid "Error creating component" @@ -4952,10 +4881,8 @@ msgid "Error reading %s" msgstr "%s nem olvasható" #: lazarusidestrconsts.liscfeinfile -#, fuzzy -#| msgid "%sIn file %s%s" msgid "In file %s" -msgstr "%sA fájlban: %s%s" +msgstr "A(z) %s fájlban" #: lazarusidestrconsts.liscfeinvalidcomponentowner msgid "Invalid component owner" @@ -4979,19 +4906,19 @@ msgstr "%s%sAdatfolyam pozíció: %s" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists msgid "TCustomFormEditor.CreateNonFormForm already exists" -msgstr "" +msgstr "TCustomFormEditor.CreateNonFormForm már létezik" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" -msgstr "" +msgstr "TCustomFormEditor.CreateNonFormForm Ismeretlen típus: %s" #: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" -msgstr "" +msgstr "TCustomFormEditor.DeleteComponent Hol van a TCustomNonFormDesignerForm? %s" #: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" -msgstr "" +msgstr "TCustomFormEditor.RegisterDesignerMediator már regisztrálva van: %s" #: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" @@ -5003,7 +4930,7 @@ msgstr "A(z) %s típusú komponens nem tudta beállítani saját szülőjeként #: lazarusidestrconsts.liscfeunabletocleartheformeditingselection msgid "Unable to clear the form editing selection%s%s" -msgstr "" +msgstr "Nem lehet megszüntetni a kijelölést az form szerkesztőben%s%s" #: lazarusidestrconsts.lischange msgctxt "lazarusidestrconsts.lischange" @@ -5068,7 +4995,7 @@ msgstr "" #: lazarusidestrconsts.lischeckifpackageisinthedependencies msgid ". Check if package %s is in the dependencies" -msgstr "" +msgstr ". Elenőrizni kell, hogy a(z) %s csomag szerepel-e a függőségek között" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "check if the next token in source is an end and if not returns lineend + end; + lineend" @@ -5207,10 +5134,8 @@ msgid "classes.ppu not found. Check your fpc.cfg." msgstr "A classes.ppu nem található. Ellenőrizze az fpc.cfg fájlt!" #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste -#, fuzzy -#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgid "Class \"%s\" is not a registered component class.%sUnable to paste." -msgstr "A(z) %s%s%s osztály nem egy regisztrált komponens osztály.%sNem lehet beilleszteni." +msgstr "A(z) \"%s\" osztály nem egy regisztrált komponens osztály.%sNem lehet beilleszteni." #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" @@ -5218,13 +5143,11 @@ msgstr "Osztály nem található" #: lazarusidestrconsts.lisclassnotfoundat msgid "Class %s not found at %s(%s,%s)" -msgstr "" +msgstr "A(z) %s osztály nem található itt: %s(%s,%s)" #: lazarusidestrconsts.lisclassofmethodnotfound -#, fuzzy -#| msgid "Class %s%s%s of method %s%s%s not found." msgid "Class \"%s\" of method \"%s\" not found." -msgstr "A(z) %s%s%s osztály, amely a %s%s%s metódust tartalmazza nem található." +msgstr "A(z) \"%s\" osztály, amely a \"%s\" metódust tartalmazza nem található." #: lazarusidestrconsts.liscldirclean msgid "Clean" @@ -5297,7 +5220,7 @@ msgstr "Könyvtár tartalmának törlése?" #: lazarusidestrconsts.lisclearthefilterforoptions msgid "Clear the filter for options" -msgstr "" +msgstr "Beállításszűrők törlése" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" @@ -5398,16 +5321,16 @@ msgstr "Kód" #: lazarusidestrconsts.liscodebrowser msgctxt "lazarusidestrconsts.liscodebrowser" msgid "Code Browser" -msgstr "Kód tallózó" +msgstr "Kódtallózó" #: lazarusidestrconsts.liscodeexplorer msgctxt "lazarusidestrconsts.liscodeexplorer" msgid "Code Explorer" -msgstr "Kód böngésző" +msgstr "Kódböngésző" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" -msgstr "Kód létrehozás beállítások" +msgstr "Kód létrehozás beállításai" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" @@ -5446,7 +5369,7 @@ msgstr "Példa" #: lazarusidestrconsts.liscodehelpgroupbox msgid "FPDoc settings" -msgstr "FPDoc beállítások" +msgstr "FPDoc beállításai" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" @@ -5527,7 +5450,7 @@ msgstr "Kód vizsgáló" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" -msgstr "A kövezkező meg nem nevezett konstansok kihagyása" +msgstr "A következő meg nem nevezett konstansok kihagyása" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" @@ -5539,10 +5462,8 @@ msgid "Add code template" msgstr "Kód sablon hozzáadása" #: lazarusidestrconsts.liscodetemplatokenalreadyexists -#, fuzzy -#| msgid " A token %s%s%s already exists! " msgid " A token \"%s\" already exists! " -msgstr "A(z) %s%s%s megnevezés már foglalt! " +msgstr "A(z) \"%s\" megnevezés már foglalt! " #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on" @@ -5839,7 +5760,7 @@ msgstr "Kijelölt csomópont:" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging." -msgstr "" +msgstr "A Free Pascal fordító útvonala . Nem szükséges. Javítja a deklarációk és a hibák keresését." #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." @@ -5851,15 +5772,15 @@ msgstr "A Free Pascal SVN forráskód könyvtára." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." -msgstr "" +msgstr "A Free Pascal fordító útvonala.%s Például: %s/usr/bin/%s -n%s vagy %s/usr/local/bin/fpc @/etc/fpc.cfg%s." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." -msgstr "" +msgstr "A Free Pascal fordító útvonala ehhez a projekthez. Csak akkor van rá szükség ha lentebb be van állítva az FPC SVN forrás. Makrók automatikus létrehozásához használatos." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." -msgstr "" +msgstr "A Free Pascal fordító útvonala ehhez a forráskódhoz.%sMakrók automatikus létrehozásához használatos." #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." @@ -6048,7 +5969,7 @@ msgstr "Tipp: A fordító útvonala beállítható a menüben: Eszközök -> Be #: lazarusidestrconsts.liscompilermessagesfilenotfound msgid "Compiler messages file not found:%s%s" -msgstr "" +msgstr "A fordító üzenetek fájlja nem található:%s%s" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" @@ -6065,7 +5986,7 @@ msgstr "Fordítás" #: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates msgid "%s -> Compile with -vd for more details. Check for duplicates." -msgstr "" +msgstr "%s -> A részletekért -vd használatával kell újrafordítani. Másolatokat kell keresni!" #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" @@ -6097,16 +6018,12 @@ msgid "Component name \"%s\" is a Pascal keyword." msgstr "A(z) \"%s\" komponens neve egy pascal kulcsszó" #: lazarusidestrconsts.liscomponentnameiskeyword -#, fuzzy -#| msgid "Component name %s%s%s is keyword" msgid "Component name \"%s\" is keyword" -msgstr "A(z) %s%s%s komponens név egy kulcsszó" +msgstr "A(z) \"%s\" komponens név egy kulcsszó" #: lazarusidestrconsts.liscomponentnameisnotavalididentifier -#, fuzzy -#| msgid "Component name %s%s%s is not a valid identifier" msgid "Component name \"%s\" is not a valid identifier" -msgstr "A(z) %s%s%s komponens azonosító érvénytelen" +msgstr "A(z) \"%s\" komponens azonosító érvénytelen" #: lazarusidestrconsts.liscomppalcomponentlist msgid "View All" @@ -6144,10 +6061,8 @@ msgid "Configure Build %s" msgstr "%s építésének beállítása" #: lazarusidestrconsts.lisconfigurebuildlazarus -#, fuzzy -#| msgid "Configure %sBuild Lazarus%s" msgid "Configure \"Build Lazarus\"" -msgstr "%sLazarus építés%s beállítása" +msgstr "\"Lazarus építés\" beállítása" #: lazarusidestrconsts.lisconfigurelazaruside msgid "Configure Lazarus IDE" @@ -6200,7 +6115,7 @@ msgstr "Ütközés" #: lazarusidestrconsts.lisconflictdetected msgid "Conflict detected" -msgstr "" +msgstr "Ütközés észlelhető" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" @@ -6322,25 +6237,23 @@ msgstr "Hiba=\"%s\"" #: lazarusidestrconsts.lisconvdelphiexceptionduringconversion msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." -msgstr "" +msgstr "Kivétel keletkezett a unit átalakítása közben. Folytatás a már átalakított unitok form fájljaival..." #: lazarusidestrconsts.lisconvdelphifailedconvertingunit msgid "Failed converting unit" msgstr "A unit átalakítása sikertelen" #: lazarusidestrconsts.lisconvdelphifailedtoconvertunit -#, fuzzy -#| msgid "Failed to convert unit%s%s%s" msgid "Failed to convert unit \"%s\"" -msgstr "A unit átalakítása sikertelen%s%s%s" +msgstr "A unit átalakítása sikertelen: \"%s\"" #: lazarusidestrconsts.lisconvdelphifixedunitcase msgid "Fixed character case of unit \"%s\" to \"%s\"." -msgstr "" +msgstr "A unit betűméretének véglegesítése erről: \"%s\" erre: \"%s\"" #: lazarusidestrconsts.lisconvdelphifixingusedunits msgid "* Fixing used units for file %s *" -msgstr "" +msgstr "* Használt unitok véglegesítése a fájlban: %s *" #: lazarusidestrconsts.lisconvdelphifoundallunitfiles msgid "Found all unit files" @@ -6527,7 +6440,7 @@ msgstr "Minden elem másolása a vágólapra" #: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard msgid "Copy All/Original Messages to Clipboard" -msgstr "" +msgstr "Minden/Eredeti üzenetek másolása a vágólapra" #: lazarusidestrconsts.liscopyalloutputclipboard msgid "Copy all output to clipboard" @@ -6555,13 +6468,11 @@ msgstr "Hiba másolása" #: lazarusidestrconsts.liscopyfilenametoclipboard msgid "Copy File Name to Clipboard" -msgstr "" +msgstr "Fájlnév másolása a vágólapra" #: lazarusidestrconsts.liscopyidentifier -#, fuzzy -#| msgid "Copy %s%s%s to clipboard" msgid "Copy \"%s\" to clipboard" -msgstr "%s%s%s másolása a vágólapra" +msgstr "\"%s\" másolása a vágólapra" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." @@ -6573,7 +6484,7 @@ msgstr "Elem másolása a vágólapra" #: lazarusidestrconsts.liscopymovefiletodirectory msgid "Copy/Move File to Directory" -msgstr "" +msgstr "Fájl másolása/áthelyezése könyvtárba" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy Selected Items to Clipboard" @@ -6600,44 +6511,32 @@ msgid "Skip calling compiler" msgstr "Kihagyja a fordító hivását" #: lazarusidestrconsts.liscouldnotadditomainsource -#, fuzzy -#| msgid "Could not add %s{$I %s%s} to main source!" msgid "Could not add \"{$I %s}\" to main source!" -msgstr "Nem adható hozzá %s{$I %s%s} a fő forráskódhoz!" +msgstr "Nem adható hozzá \"{$I %s}\" a fő forráskódhoz!" #: lazarusidestrconsts.liscouldnotaddrtomainsource -#, fuzzy -#| msgid "Could not add %s{$R %s%s} to main source!" msgid "Could not add \"{$R %s}\" to main source!" -msgstr "Nem adható hozzá %s{$R %s%s} a fő forráskódhoz!" +msgstr "Nem adható hozzá \"{$R %s}\" a fő forráskódhoz!" #: lazarusidestrconsts.liscouldnotaddtomainsource -#, fuzzy -#| msgid "Could not add %s%s%s to main source!" msgid "Could not add \"%s\" to main source!" -msgstr "Nem adható hozzá %s%s%s a fő forráskódhoz!" +msgstr "Nem adható hozzá \"%s\" a fő forráskódhoz!" #: lazarusidestrconsts.liscouldnotremovefrommainsource -#, fuzzy -#| msgid "Could not remove %s%s%s from main source!" msgid "Could not remove \"%s\" from main source!" -msgstr "Nem távolítható el %s%s%s a fő forráskódból!" +msgstr "Nem távolítható el \"%s\" a fő forráskódból!" #: lazarusidestrconsts.liscouldnotremoveifrommainsource -#, fuzzy -#| msgid "Could not remove %s{$I %s%s} from main source!" msgid "Could not remove \"{$I %s}\" from main source!" -msgstr "Nem távolítható el %s{$I %s%s} a főforráskódból!" +msgstr "Nem távolítható el \"{$I %s}\" a főforráskódból!" #: lazarusidestrconsts.liscouldnotremoverfrommainsource -#, fuzzy -#| msgid "Could not remove %s{$R %s%s} from main source!" msgid "Could not remove \"{$R %s}\" from main source!" -msgstr "Nem távolítható el %s{$R %s%s} a fő forráskódból!" +msgstr "Nem távolítható el \"{$R %s}\" a fő forráskódból!" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." -msgstr "" +msgstr "Figyelmeztetés: A hozzáadott fordító beállítási fájl neve megegyezik az egyik szabványos beállítási fájllal, amelyet a Free Pascal keres. Ez azt okozhatja, hogy CSAK a hozzáadott beállítási fájl lesz elemezve és kimarad a szabványos beállítás." #: lazarusidestrconsts.liscpopenpackage msgid "Open Package %s" @@ -6661,7 +6560,7 @@ msgstr "Létrehozza a könyvtárat?" #: lazarusidestrconsts.liscreatefilter msgid "Create Filter" -msgstr "" +msgstr "Szűrő létrehozása" #: lazarusidestrconsts.liscreatefunction msgid "Create function" @@ -6677,7 +6576,7 @@ msgstr "Hozza létre" #: lazarusidestrconsts.liscreatelocalvariable msgid "Create local variable \"%s\"" -msgstr "" +msgstr "Helyi változó létrehozása: \"%s\"" #: lazarusidestrconsts.liscreatenewpackage msgid "(Create new package)" @@ -6731,7 +6630,7 @@ msgstr "Előnézet megnyitása" #: lazarusidestrconsts.lisctdefstools msgid "Tools" -msgstr "Eszközök" +msgstr "E&szközök" #: lazarusidestrconsts.lisctdefvariable msgid "Variable: %s" @@ -6747,11 +6646,11 @@ msgstr "Sablonok" #: lazarusidestrconsts.lisctoupdateallmethodsignatures msgid "Update all method signatures" -msgstr "" +msgstr "Frissítse a metódusok összes begépelését" #: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures msgid "Update multiple procedure signatures" -msgstr "" +msgstr "Frissítse az eljárások valamennyi begépelését" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" @@ -6768,11 +6667,11 @@ msgstr "Jelenlegi" #: lazarusidestrconsts.liscurrentdirectory msgid "CurrentDirectory: %s" -msgstr "" +msgstr "Jelenlegi könyvtár: %s" #: lazarusidestrconsts.liscurrentdirectory2 msgid "CurrentDirectory: " -msgstr "" +msgstr "Jelenlegi könyvtár: " #: lazarusidestrconsts.liscurrentstate msgid "Current state: " @@ -6788,7 +6687,7 @@ msgstr "Kurzor sora a jelenlegi szerkesztőben" #: lazarusidestrconsts.liscustomopthint msgid "These options are passed to the compiler after comments are deleted and macros are replaced." -msgstr "" +msgstr "Ezen beállítások át lesznek adva a fordítónak a megjegyzések törlése és a makrók behelyettesítése után." #: lazarusidestrconsts.liscustomoptions msgid "custom options" @@ -6853,7 +6752,7 @@ msgstr "Összes tiltása" #: lazarusidestrconsts.lisdbgallitemdisablehint msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" msgid "Disable all" -msgstr "összes tiltása" +msgstr "Összes tiltása" #: lazarusidestrconsts.lisdbgallitemenable msgctxt "lazarusidestrconsts.lisdbgallitemenable" @@ -6989,7 +6888,7 @@ msgstr "Be/Ki" #: lazarusidestrconsts.lisdbgwinpowerhint msgid "Disable/Enable updates for the entire window" -msgstr "" +msgstr "Frissítés ki-/bekapcsolása a teljes ablak számára" #: lazarusidestrconsts.lisdebugger msgctxt "lazarusidestrconsts.lisdebugger" @@ -6998,7 +6897,7 @@ msgstr "Hibakereső" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "Hibakereső hiba%sHoppá, a hibakereső hibát hajtott végre.%sMentse a munkáját most!%sNyomja meg az Leállítás-t, és reménykedjen a legjobbakban, most kihúzzuk a dugót." +msgstr "Hibakereső hiba%sHoppá, a hibakereső hibaállapotba került.%sMentse a munkáját most!%sNyomja meg az Leállítás-t, és reménykedjen a legjobbakban, most kihúzzuk a dugót." #: lazarusidestrconsts.lisdebuggerfeedbackerror msgid "Debugger Error" @@ -7051,7 +6950,7 @@ msgstr "Hibakereső általános beállításai" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" -msgstr "Hibakereső-specifikus beállítások (a hibakereső típusától függ)" +msgstr "Hibakereső-függő beállítások (a hibakereső típusától függ)" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" @@ -7152,10 +7051,8 @@ msgid "Unable to load file" msgstr "Fájl betöltése nem lehetséges" #: lazarusidestrconsts.lisdebugunabletoloadfile2 -#, fuzzy -#| msgid "Unable to load file %s%s%s." msgid "Unable to load file \"%s\"." -msgstr "A(z) %s%s%s fájl betöltése nem lehetséges" +msgstr "A(z) \"%s\" fájl betöltése nem lehetséges" #: lazarusidestrconsts.lisdecimal msgctxt "lazarusidestrconsts.lisdecimal" @@ -7193,10 +7090,8 @@ msgid "Delete all breakpoints?" msgstr "Minden töréspontot töröl?" #: lazarusidestrconsts.lisdeleteallbreakpoints2 -#, fuzzy -#| msgid "Delete all breakpoints in file %s%s%s?" msgid "Delete all breakpoints in file \"%s\"?" -msgstr "Minden töréspontot töröl a(z) %s%s%s fájlban?" +msgstr "Minden töréspont törlése a(z) \"%s\" fájlból?" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" @@ -7235,20 +7130,16 @@ msgid "Delete file failed" msgstr "Fájl törlés sikertelen" #: lazarusidestrconsts.lisdeletemacro -#, fuzzy -#| msgid "Delete macro %s%s%s?" msgid "Delete macro \"%s\"?" -msgstr "%s%s%s makró törlése?" +msgstr "\"%s\" makró törlése?" #: lazarusidestrconsts.lisdeletemode msgid "Delete mode \"%s\"" msgstr "Mód törlése: \"%s\"" #: lazarusidestrconsts.lisdeleteoldfile -#, fuzzy -#| msgid "Delete old file %s%s%s?" msgid "Delete old file \"%s\"?" -msgstr "Törli a %s%s%s régi fájlt?" +msgstr "Törli a \"%s\" régi fájlt?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" @@ -7263,20 +7154,16 @@ msgid "Delete selected macro?" msgstr "Kijelölt makró törlése?" #: lazarusidestrconsts.lisdeletevalue -#, fuzzy -#| msgid "Delete value %s%s%s" msgid "Delete value \"%s\"?" -msgstr "%s%s%s érték törlése" +msgstr "\"%s\" érték törlése?" #: lazarusidestrconsts.lisdeletevalue2 msgid "Delete value %s" msgstr "%s érték törlése" #: lazarusidestrconsts.lisdeletingoffilefailed -#, fuzzy -#| msgid "Deleting of file %s%s%s failed." msgid "Deleting of file \"%s\" failed." -msgstr "A(z) %s%s%s fájl törlése sikertelen." +msgstr "A(z) \"%s\" fájl törlése sikertelen." #: lazarusidestrconsts.lisdelphi msgid "Delphi" @@ -7300,7 +7187,7 @@ msgstr "" #: lazarusidestrconsts.lisdesktop msgid "Desktop: " -msgstr "" +msgstr "Felület: " #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" @@ -7375,10 +7262,8 @@ msgid "Directory: " msgstr "Könyvtár:" #: lazarusidestrconsts.lisdirectorynotfound -#, fuzzy -#| msgid "Directory %s%s%s not found." msgid "Directory \"%s\" not found." -msgstr "A(z) %s%s%s könyvtár nem található." +msgstr "A(z) \"%s\" könyvtár nem található." #: lazarusidestrconsts.lisdirectorynotfound2 msgid "directory %s not found" @@ -7620,20 +7505,16 @@ msgid "Duplicate File Name" msgstr "" #: lazarusidestrconsts.lisduplicatefoundofvalue -#, fuzzy -#| msgid "Duplicate found of value %s%s%s." msgid "Duplicate found of value \"%s\"." -msgstr "A(z) %s%s%s érték többszörösen megtalálható." +msgstr "A(z) \"%s\" érték többszörösen megtalálható." #: lazarusidestrconsts.lisduplicatename msgid "Duplicate Name" msgstr "" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe -#, fuzzy -#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" -msgstr "Többszörös név: A(z) %s%s%s komponens már létezik a(z) %s származtatott komponensben." +msgstr "Többszörös név: \"%s\" nevű komponens már létezik a(z) %s származtatott komponensben." #: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." @@ -7670,7 +7551,7 @@ msgstr "Billentyű szerkesztése" #: lazarusidestrconsts.liseditorcolors msgid "Editor Colors" -msgstr "" +msgstr "Szerkesztő színei" #: lazarusidestrconsts.liseditorfiletypes #, fuzzy @@ -7827,7 +7708,7 @@ msgstr "Keresés ezekben az osztály részben:" #: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause msgid "Unable to show empty methods of the current class, because%s%s" -msgstr "" +msgstr "Nem lehet megjeleníteni az aktuális osztály üres metódusait, mert%s%s" #: lazarusidestrconsts.lisempty msgid "Empty" @@ -7860,7 +7741,7 @@ msgstr "Csoportok Engedélyezése" #: lazarusidestrconsts.lisenablei18nforlfm msgid "Enable I18N for LFM" -msgstr "" +msgstr "I18N engedélyezése az LFM-hez" #: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport msgid "Enable internationalization and translation support" @@ -7883,11 +7764,9 @@ msgid "Enclose in $IFDEF" msgstr "Közrezárás $IFDEF által" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis -#, fuzzy -#| msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." -msgstr "A(z) %s%s%s%s fájl kódolása a lemezen: %s. Az új kódolás: %s." +msgstr "A(z) \"%s\"%sfájl kódolása a lemezen: %s. Az új kódolás: %s." #: lazarusidestrconsts.lisendlessloopinmacros msgid "Endless loop in macros" @@ -7895,7 +7774,7 @@ msgstr "Végtelen ciklus a makrókban" #: lazarusidestrconsts.lisenternewnameformacros msgid "Enter new name for Macro \"%s\"" -msgstr "" +msgstr "Új név megadása a \"%s\" makró számára" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" @@ -7903,7 +7782,7 @@ msgstr "Környezeti változó, neve, mint paraméter" #: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick msgid "Jump from message to source line on double click (otherwise: single click)" -msgstr "Ugorjon az üzenetről a forráskódra dupla kattintáskor (különben: egy kattintás)" +msgstr "Kétszeres kattintáskor ugorjon az üzenetről a forráskódra (különben: egy kattintás)" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" @@ -7915,7 +7794,7 @@ msgstr "Érvénytelen hibakereső fájlnév" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." -msgstr "A hibakereső fájl \"%s\" nem futtatható fájl." +msgstr "A(z) \"%s\" hibakereső nem futtatható állomány." #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." @@ -7963,7 +7842,7 @@ msgstr "" #: lazarusidestrconsts.liserrorinthedebuggerpathaddition msgid "Error in the \"Debugger path addition\":" -msgstr "" +msgstr "Hiba a \"Hibakereső elérési út kiegészítése\"-ben:" #: lazarusidestrconsts.liserrorinthesearchpathforincludefiles msgid "Error in the search path for \"Include files\":" @@ -7998,10 +7877,8 @@ msgid "Error loading file" msgstr "Hiba fájl betöltés közben" #: lazarusidestrconsts.liserrorloadingfile2 -#, fuzzy -#| msgid "Error loading file \"%s\":%s%s" msgid "Error loading file \"%s\":" -msgstr "Hiba a fájl betöltése közben: \"%s\":%s%s" +msgstr "Hiba a(z) \"%s\" fájl betöltése közben:" #: lazarusidestrconsts.liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" @@ -8013,11 +7890,11 @@ msgstr "Hiba a komponens mozgatása közben" #: lazarusidestrconsts.liserrormovingcomponent2 msgid "Error moving component %s:%s" -msgstr "Hiba a komponens mozgatása a(z) %s komponens mozgatása közben:%s" +msgstr "Hiba a(z) %s komponens mozgatása közben:%s" #: lazarusidestrconsts.liserrornamingcomponent msgid "Error naming component" -msgstr "" +msgstr "Hiba a komponens elnevezése közben" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" @@ -8036,10 +7913,8 @@ msgid "Error reading XML" msgstr "Hiba XML olvasása közben" #: lazarusidestrconsts.liserrorreadingxmlfile -#, fuzzy -#| msgid "Error reading xml file %s%s%s%s%s" msgid "Error reading xml file \"%s\"%s%s" -msgstr "Hiba a(z) %s%s%s%s%s XML fájl beolvasása közben" +msgstr "Hiba az XML fájl olvasása közben: \"%s\"%s%s" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" @@ -8052,7 +7927,7 @@ msgstr "Hibák" #: lazarusidestrconsts.liserrors2 msgid ", Errors:%s" -msgstr "" +msgstr ", Hibák:%s" #: lazarusidestrconsts.liserrorsavingto msgid "Error saving %s to%s%s%s%s" @@ -8060,7 +7935,7 @@ msgstr "Hiba %s ide történő mentése közben:%s%s%s%s" #: lazarusidestrconsts.liserrorsettingthenameofacomponentto msgid "Error setting the name of a component %s to %s" -msgstr "" +msgstr "Hiba a(z) %s komponens nevének beállításakor erre: %s" #: lazarusidestrconsts.liserrorwritingfile msgid "Error writing file \"%s\"" @@ -8133,7 +8008,7 @@ msgstr "Hibakereső kivétel figyelmeztetés" #: lazarusidestrconsts.lisexcludedatruntime msgid "%s excluded at run time" -msgstr "" +msgstr "%s kihagyva futásidőben" #: lazarusidestrconsts.lisexcludefilter msgid "Exclude filter" @@ -8145,19 +8020,19 @@ msgstr "Futtatható" #: lazarusidestrconsts.lisexecutable2 msgid "Executable: %s" -msgstr "" +msgstr "Futtatható: %s" #: lazarusidestrconsts.lisexecutable3 msgid "Executable: " -msgstr "" +msgstr "Futtatható: " #: lazarusidestrconsts.lisexecutableisadirectory msgid "executable \"%s\" is a directory" -msgstr "" +msgstr "a(z) \"%s\" állomány egy könyvtár" #: lazarusidestrconsts.lisexecutablelacksthepermissiontorun msgid "executable \"%s\" lacks the permission to run" -msgstr "" +msgstr "a \"%s\" állománynak nincs futási engedélye" #: lazarusidestrconsts.lisexecutingcommandafter msgid "Executing command after" @@ -8182,7 +8057,7 @@ msgstr "Kilépés" #: lazarusidestrconsts.lisexitcode msgid "Exit code %s" -msgstr "" +msgstr "Kilépési kód: %s" #: lazarusidestrconsts.lisexpandall msgid "Expand All (*)" @@ -8227,31 +8102,31 @@ msgstr "Kifejezés:" #: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith msgid "Extend include file search path of package \"%s\" with\"%s\"?" -msgstr "" +msgstr "Kibővíti a(z) \"%s\" csomag include fájl keresési útvonalát ezzel: \"%s\"?" #: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith msgid "Extend include files search path of project with%s\"%s\"?" -msgstr "" +msgstr "Kibővíti a projekt include fájl keresési útvonalát ezzel:%s\"%s\"?" #: lazarusidestrconsts.lisextendincludepath msgid "Extend Include Path?" -msgstr "" +msgstr "Include útvonal kibővítése?" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" -msgstr "Kiterjeszti a unit útvonalát?" +msgstr "Kibővíti a unit útvonalat?" #: lazarusidestrconsts.lisextendunitpath2 msgid "Extend Unit Path?" -msgstr "" +msgstr "Unit útvonal kibővítése?" #: lazarusidestrconsts.lisextendunitsearchpathofpackagewith msgid "Extend unit search path of package \"%s\" with\"%s\"?" -msgstr "" +msgstr "Kibővíti a(z) \"%s\" csomag unit keresési útvonalát ezzel: \"%s\"?" #: lazarusidestrconsts.lisextendunitsearchpathofprojectwith msgid "Extend unit search path of project with%s\"%s\"?" -msgstr "" +msgstr "Kibővíti a projekt unit keresési útvonalát ezzel:%s\"%s\"?" #: lazarusidestrconsts.lisextract msgid "Extract" @@ -8264,7 +8139,7 @@ msgstr "Áthelyezés eljárásba" #: lazarusidestrconsts.lisextremelyverbose msgid "Extremely Verbose" -msgstr "" +msgstr "Rendkívül részletes" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External Tools" @@ -8280,7 +8155,7 @@ msgstr "Maximális eszközszám elérve" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." -msgstr "Az eszközök száma maximum %s lehet." +msgstr "Az eszközök száma legfeljebb %s lehet." #: lazarusidestrconsts.lisexttooltitlecompleted msgid "\"%s\" completed" @@ -8292,7 +8167,7 @@ msgstr "A(z) %s%s%s eszköz futtatása nem lehetséges:%s%s" #: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor msgid "Failed to create Application Bundle for \"%s\"" -msgstr "" +msgstr "Nem sikerült létrehozni az alkalmazásköteget ehhez: %s" #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" @@ -8300,7 +8175,7 @@ msgstr "Összecsukási állapot betöltése sikertelen" #: lazarusidestrconsts.lisfailedtoresolvemacros msgid "failed to resolve macros" -msgstr "" +msgstr "a makrók feloldása sikertelen" #: lazarusidestrconsts.lisfailedtosavefile msgid "Failed to save file." @@ -8308,7 +8183,7 @@ msgstr "A fájl mentése nem sikerült." #: lazarusidestrconsts.lisfatal msgid "Fatal" -msgstr "" +msgstr "Végzetes" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" @@ -8328,11 +8203,9 @@ msgid "File: " msgstr "Fájl:" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway -#, fuzzy -#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?" -msgstr "A(z) %s%s%s%s fájl nem tűnik szövegfájlnak.%sMindenképpen megnyitja?" +msgstr "A(z) \"%s\"%s fájl nem tűnik szövegfájlnak.%sMindenképpen megnyitja?" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" @@ -8371,10 +8244,8 @@ msgid "These are file filters that will appear in all File Open dialogs" msgstr "E fájlszűrők jelennek majd meg a Fájl megnyitása párbeszédben" #: lazarusidestrconsts.lisfilehaschangedsave -#, fuzzy -#| msgid "File %s%s%s has changed. Save?" msgid "File \"%s\" has changed. Save?" -msgstr "A(z) %s%s%s fájl megváltozott. Menti?" +msgstr "A(z) \"%s\" fájl megváltozott. Mentés?" #: lazarusidestrconsts.lisfilehasnoproject msgid "File has no project" @@ -8397,10 +8268,8 @@ msgid "File is symlink" msgstr "A fájl egy szimbolikus hivatkozás" #: lazarusidestrconsts.lisfileisvirtual -#, fuzzy -#| msgid "File %s%s%s is virtual." msgid "File \"%s\" is virtual." -msgstr "A(z) %s%s%s fájl virtuális." +msgstr "A(z) \"%s\" fájl virtuális." #: lazarusidestrconsts.lisfilelinkerror msgid "File link error" @@ -8412,18 +8281,16 @@ msgstr "Fájlnév/Cím" #: lazarusidestrconsts.lisfilenamestyle msgid "Filename Style ..." -msgstr "" +msgstr "Fájlnév stílusa ..." #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "Fájl nem található" #: lazarusidestrconsts.lisfilenotfound2 -#, fuzzy -#| msgid "File %s%s%s not found.%s" msgctxt "lazarusidestrconsts.lisfilenotfound2" msgid "File \"%s\" not found." -msgstr "A(z) %s%s%s fájl nem található.%s" +msgstr "A(z) \"%s\" fájl nem található." #: lazarusidestrconsts.lisfilenotfound3 msgid "file %s not found" @@ -8435,13 +8302,11 @@ msgstr "A fájl nem található" #: lazarusidestrconsts.lisfilenotfound5 msgid "File not found:%s%s" -msgstr "" +msgstr "A fájl nem található:%s%s" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit -#, fuzzy -#| msgid "File %s%s%s not found.%sDo you want to create it?%s" msgid "File \"%s\" not found.%sDo you want to create it?" -msgstr "A(z) %s%s%s fájl nem található.%sLétre szeretné hozni?%s" +msgstr "A(z) \"%s\" fájl nem található.%sLétre szeretné hozni?" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" @@ -8493,35 +8358,35 @@ msgstr "Szűrő: %s" #: lazarusidestrconsts.lisfilterallmessagesoftype msgid "Filter all messages of type %s" -msgstr "" +msgstr "A következő típusú összes üzenet kiszűrése: %s" #: lazarusidestrconsts.lisfilteralreadyexists msgid "Filter already exists" -msgstr "" +msgstr "A szűrő már létezik" #: lazarusidestrconsts.lisfilterdebugmessagesandbelow msgid "Filter Debug Messages and below" -msgstr "" +msgstr "Hibakereső üzenetek és az alábbiak kiszűrése" #: lazarusidestrconsts.lisfilterhintsandbelow msgid "Filter Hints and below" -msgstr "" +msgstr "Tippek és az alábbiak kiszűrése" #: lazarusidestrconsts.lisfilterhintswithoutsourceposition msgid "Filter Hints without Source Position" -msgstr "" +msgstr "Tippek forráspozíció nélkül" #: lazarusidestrconsts.lisfilternonedonotfilterbyurgency msgid "Filter None, do not filter by urgency" -msgstr "" +msgstr "Nincs szűrés, ne szűrje ki a zavaró üzeneteket" #: lazarusidestrconsts.lisfilternonurgentmessages msgid "Filter non urgent Messages" -msgstr "" +msgstr "Nem zavaró üzenetek szűrése" #: lazarusidestrconsts.lisfilternotesandbelow msgid "Filter Notes and below" -msgstr "" +msgstr "Megjegyzések és az alábbiak kiszűrése" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" @@ -8533,15 +8398,15 @@ msgstr "" #: lazarusidestrconsts.lisfilterverbosemessagesandbelow msgid "Filter Verbose Messages and below" -msgstr "" +msgstr "Fecsegő üzenetek és az alábbiak kiszűrése" #: lazarusidestrconsts.lisfilterwarningsandbelow msgid "Filter Warnings and below" -msgstr "" +msgstr "Figyelmeztetések és az alábbiak kiszűrése" #: lazarusidestrconsts.lisfind msgid "Find ..." -msgstr "" +msgstr "Keresés ..." #: lazarusidestrconsts.lisfindfiledirectory msgid "D&irectory" @@ -8597,11 +8462,11 @@ msgstr "Hiányzó unit megkeresése" #: lazarusidestrconsts.lisfindthenextoccurenceofthephrase msgid "Find the next occurence of the phrase" -msgstr "" +msgstr "A kifejezés következő előfordulásának keresése" #: lazarusidestrconsts.lisfindthepreviousoccurenceofthephrase msgid "Find the previous occurence of the phrase" -msgstr "" +msgstr "A kifejezés előző előfordulásának keresése" #: lazarusidestrconsts.lisfirst msgid "First" @@ -8702,7 +8567,7 @@ msgstr "Keresés visszafelé" #: lazarusidestrconsts.lisfreeingbufferlines msgid "freeing buffer lines: %s" -msgstr "" +msgstr "felszabadított puffersorok: %s" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" @@ -8774,7 +8639,7 @@ msgstr "Keresés, ahol" #: lazarusidestrconsts.lisfull msgid "Full" -msgstr "" +msgstr "Teljes" #: lazarusidestrconsts.lisfunction msgctxt "lazarusidestrconsts.lisfunction" @@ -8813,7 +8678,7 @@ msgstr "Hozzárendelés a létező \"%s\" csoporthoz?" #: lazarusidestrconsts.lisgroupemptydelete msgid "No more breakpoints are assigned to group \"%s\", delete it?" -msgstr "" +msgstr "Nincs több töréspont társítva a(z) \"%s\" csoporthoz. Törölhető?" #: lazarusidestrconsts.lisgroupemptydeletemore msgid "%sThere are %d more empty groups, delete all?" @@ -8821,7 +8686,7 @@ msgstr "%sVan még %d üres csoport. Összes törlése?" #: lazarusidestrconsts.lisgroupnameemptyclearinstead msgid "The group name cannot be empty. Clear breakpoints' group(s)?" -msgstr "" +msgstr "A csoport neve nem lehet üres. Törlendő a töréspontok csoportja?" #: lazarusidestrconsts.lisgroupnameinput msgid "Group name:" @@ -8841,7 +8706,7 @@ msgstr "Csoport(ok) törlése" #: lazarusidestrconsts.lisgroupsfordebugoutput msgid "Enable or Disable groups of debug output. Valid Options are:" -msgstr "" +msgstr "Engedélyezi vagy letiltja a hibakereső kimenetének csoportjait. Érvényes beállítások:" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" @@ -8853,7 +8718,7 @@ msgstr "Van súgja" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" -msgstr "Fejléc megjegyzés osztályhoz" +msgstr "Fejléc megjegyzés az osztályhoz" #: lazarusidestrconsts.lishelp msgctxt "lazarusidestrconsts.lishelp" @@ -8878,19 +8743,19 @@ msgstr "Súgó a Free Pascal Compiler üzeneteihez" #: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh msgid "Hide all hints and warnings by inserting IDE directives {%H-}" -msgstr "" +msgstr "Minden tipp és figyelmeztetés elrejtése IDE direktívák beszúrásával {%H-}" #: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh msgid "Hide message at %s by inserting IDE directive {%H-}" -msgstr "" +msgstr "Üzenet elrejtése (itt: %s) IDE direktíva beszúrásával {%H-}" #: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh msgid "Hide message by inserting IDE directive {%H-}" -msgstr "" +msgstr "Üzenet elrejtése IDE direktíva beszúrásával {%H-}" #: lazarusidestrconsts.lishidemessageviadirective msgid "Hide message via directive" -msgstr "" +msgstr "Üzenet elrejtése direktívával" #: lazarusidestrconsts.lishidesearch msgid "Hide Search" @@ -8898,11 +8763,11 @@ msgstr "" #: lazarusidestrconsts.lishidewithpackageoptionvm msgid "Hide with package option (-vm%s)" -msgstr "" +msgstr "Elrejtés csomagbeállítással (-vm%s)" #: lazarusidestrconsts.lishidewithprojectoptionvm msgid "Hide with project option (-vm%s)" -msgstr "" +msgstr "Elrejtés projektbeállítással (-vm%s)" #: lazarusidestrconsts.lishint msgid "Hint" @@ -8918,7 +8783,7 @@ msgstr "Tipp: Ellenőrizze, hogy két csomag tartalmaz-e egyforma nevű unit-ot. #: lazarusidestrconsts.lishints msgid ", Hints:%s" -msgstr "" +msgstr ", Tippek:%s" #: lazarusidestrconsts.lishintsaveall msgid "Save all" @@ -8962,7 +8827,7 @@ msgstr "Adatbázisok" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" -msgstr "Súgó beállítások" +msgstr "Súgó beállításai" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" @@ -9051,41 +8916,39 @@ msgstr "Az IDE címe a projekt nevével kezdődik" #: lazarusidestrconsts.lisiecoallbuildmodes msgid "All build modes" -msgstr "" +msgstr "Minden építési mód" #: lazarusidestrconsts.lisiecocompileroptionsof msgid "Compiler options of" -msgstr "" +msgstr "Fordító beállításai:" #: lazarusidestrconsts.lisiecocurrentbuildmode msgid "Current build mode" -msgstr "" +msgstr "Jelenlegi építési mód" #: lazarusidestrconsts.lisiecoerroropeningxml msgid "Error opening XML" -msgstr "" +msgstr "Hiba az XML megnyitása közben" #: lazarusidestrconsts.lisiecoerroropeningxmlfile msgid "Error opening XML file \"%s\":%s%s" -msgstr "" +msgstr "Hiba a(z) \"%s\" XML fájl megnyitása közben:%s%s" #: lazarusidestrconsts.lisiecoexportcompileroptions msgid "Export Compiler Options" -msgstr "" +msgstr "Fordító beállításainak exportálása" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "Export fájl létezik" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti -#, fuzzy -#| msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" -msgstr "A(z) %s%s%s export fájl létezik.%sMegnyitja a fájlt és kicseréli csak a fordító opcióit?%s(A többi beállítás megmarad.)" +msgstr "A(z) \"%s\" export fájl létezik.%sMegnyitja a fájlt és kicseréli csak a fordító opcióit?%s(A többi beállítás megmarad.)" #: lazarusidestrconsts.lisiecoimportcompileroptions msgid "Import Compiler Options" -msgstr "" +msgstr "Fordító beállításainak importálása" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" @@ -9093,7 +8956,7 @@ msgstr "Beolvasás fájlból" #: lazarusidestrconsts.lisieconocompileroptionsinfile msgid "File \"%s\" does not contain compiler options." -msgstr "" +msgstr "A(z) \"%s\" fájl nem tartalmaz fordítóbeállításokat." #: lazarusidestrconsts.lisiecorecentfiles msgid "Recent files" @@ -9108,18 +8971,16 @@ msgid "If not checked:" msgstr "" #: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst -#, fuzzy -#| msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s" msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" -msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%s%sPéldául:%s" +msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%sPéldául:" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" -msgstr "Minden kihagyása" +msgstr "Összes kihagyása" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" -msgstr "Kihagy és folytat" +msgstr "Kihagyás és folytatás" #: lazarusidestrconsts.lisignorebinaries msgid "Ignore binaries" @@ -9148,7 +9009,7 @@ msgstr "Importálás" #: lazarusidestrconsts.lisimportant msgid "Important" -msgstr "" +msgstr "Fontos" #: lazarusidestrconsts.lisimportlist msgid "Import list" @@ -9192,7 +9053,7 @@ msgstr "Alkönyvtárak belevétele" #: lazarusidestrconsts.lisincompatibleppu msgid ", incompatible ppu=%s" -msgstr "" +msgstr ", összeférhetetlen ppu=%s" #: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound msgid "Incorrect configuration directory found" @@ -9290,10 +9151,8 @@ msgid "Inherited project component" msgstr "Örökölt projekt komponens" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil -#, fuzzy -#| msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" -msgstr "Azért, hogy egy tiszta másolat jöhessen létre a projektből/csomagból, a következő könyvtár minden elemét törölni kell, és minden tartalma el fog veszni.%s%sMinden fájlt töröl a(z) %s%s%s könyvtárban?" +msgstr "Azért, hogy egy tiszta másolat jöhessen létre a projektből/csomagból, a következő könyvtár minden eleme törölve lesz és annak teljes tartalma el fog veszni.%sTörli az összes fájlt a(z) \"%s\" könyvtárból?" #: lazarusidestrconsts.lisinsert msgctxt "lazarusidestrconsts.lisinsert" @@ -9367,7 +9226,7 @@ msgstr "V&izsgálat" #: lazarusidestrconsts.lisinspectclassinherit msgid "%s : Class %s inherits from %s" -msgstr "" +msgstr "%s : A(z) %s osztály ettől örököl: %s" #: lazarusidestrconsts.lisinspectdata msgid "Data" @@ -9445,7 +9304,7 @@ msgstr "Interaktív" #: lazarusidestrconsts.lisinternalerror msgid "internal error: %s" -msgstr "" +msgstr "belső hiba: %s" #: lazarusidestrconsts.lisinvalidcommand msgid "Invalid command" @@ -9473,17 +9332,15 @@ msgstr "Érvénytelen sor, oszlop az üzenetben: %s%s" #: lazarusidestrconsts.lisinvalidmacrosin msgid "Invalid macros in \"%s\"" -msgstr "" +msgstr "Érvényytelen makrók ebben: \"%s\"" #: lazarusidestrconsts.lisinvalidmacrosinexternaltool msgid "Invalid macros \"%s\" in external tool \"%s\"" -msgstr "" +msgstr "Érvénytelen makrók \"%s\" a külső eszközben: \"%s\"" #: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie -#, fuzzy -#| msgid "Invalid macro %s%s%s. The macro name must be a Pascal identifier." msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." -msgstr "Érvénytelen makró: %s%s%s. A makró neve csak Pascal azonosító lehet." +msgstr "Érvénytelen makró: \"%s\". A makró neve csak Pascal azonosító lehet." #: lazarusidestrconsts.lisinvalidmacrothenameisakeyword msgid "Invalid macro name \"%s\". The name is a keyword." @@ -9542,10 +9399,8 @@ msgid "%s is already part of the Project." msgstr "%s már része a projektnek." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject -#, fuzzy -#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "%s%s%s érvénytelen projekt név.%sVálasszon egy másikat! (pl. project1.pli)" +msgstr "A(z) \"%s\" egy érvénytelen projekt név.%sVálasszon egy másikat! (pl. project1.lpi)" #: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed msgid "%s is a %s.%sThis circular dependency is not allowed." @@ -9574,7 +9429,7 @@ msgstr "Ugrási előzmények" #: lazarusidestrconsts.liskb msgid "%s KB" -msgstr "" +msgstr "%s KB" #: lazarusidestrconsts.liskeep2 msgid "Keep" @@ -9678,10 +9533,8 @@ msgid "Compile project/program" msgstr "Projekt/Program fordítása" #: lazarusidestrconsts.liskmconfigbuildfile -#, fuzzy -#| msgid "Config %sBuild File%s" msgid "Config \"Build File\"" -msgstr "%sFájl építés%s beállítása" +msgstr "\"Fájl építés\" beállítása" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure Custom Components" @@ -9721,7 +9574,7 @@ msgstr "Utolsó karakter törlése" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff Editor Files" -msgstr "" +msgstr "Szerkesztett fájlok különbségei" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" @@ -10063,11 +9916,11 @@ msgstr "Hívási verem megjelenítése" #: lazarusidestrconsts.liskmtoggleviewcodebrowser msgid "Toggle view Code Browser" -msgstr "Kód tallózó megjelenítése" +msgstr "Kódtallózó megjelenítése" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" -msgstr "Kód böngésző megjelenítése" +msgstr "Kódböngésző megjelenítése" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle View Component Palette" @@ -10138,7 +9991,7 @@ msgstr "Ugrási előzmények megjelenítése" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" -msgstr "Projekt beállítások megjelenítése" +msgstr "Projekt beállításainak megjelenítése" #: lazarusidestrconsts.liskmviewprojectsource msgid "View Project Source" @@ -10163,7 +10016,7 @@ msgstr "Lazarus" #: lazarusidestrconsts.lislazarusdefault msgid "Lazarus Default" -msgstr "" +msgstr "Lazarus alapértelmezés" #: lazarusidestrconsts.lislazarusdesktopsettings msgid "Lazarus Desktop Settings" @@ -10175,7 +10028,7 @@ msgstr "Lazarus könyvtára" #: lazarusidestrconsts.lislazarusdiroverride msgid "directory, to be used as a basedirectory" -msgstr "" +msgstr "könyvtár, mely alapkönyvtárként használandó" #: lazarusidestrconsts.lislazaruseditorv msgid "Lazarus IDE v%s" @@ -10290,7 +10143,7 @@ msgstr "Hiba fájl írás közben" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow msgid "%s%s%s%slazbuild is non interactive, aborting now." -msgstr "%s%s%s%slazbuild nem interaktív, megszakítás." +msgstr "%s%s%s%sA lazbuild nem interaktív, megszakítás." #: lazarusidestrconsts.lislazbuildmanageprofiles msgid "Manage Build Profiles" @@ -10394,7 +10247,7 @@ msgstr "Tisztítás és minden építése" #: lazarusidestrconsts.lislazver msgid "Lazarus Version (e.g. 1.2.4)" -msgstr "" +msgstr "Lazarus változat (pl. 1.2.4)" #: lazarusidestrconsts.lislclwidgettype msgid "LCL widget type" @@ -10464,7 +10317,7 @@ msgstr "LFM fájl" #: lazarusidestrconsts.lislfmfilecontainsinvalidproperties msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." -msgstr "" +msgstr "Az LFM ismeretlen tulajdonságokat/osztályokat tartalmaz, melyek nem léteznek az LCL-ben. Ezek lecserélhetők vagy eltávolíthatók" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" @@ -10624,14 +10477,12 @@ msgid "Append to section" msgstr "Hozzáfűzés részhez" #: lazarusidestrconsts.lismakeresstrchooseanothername -#, fuzzy -#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "A(z) %s%s%s ResourceString már létezik.%sVálasszon másik nevet!%sHasználja a Kihagyás-t, ha mindenképpen hozzá szeretné adni!" +msgstr "A(z) \"%s\" ResourceString már létezik.%sVálasszon másik nevet!%sHasználja a Kihagyás-t, ha mindenképpen hozzá szeretné adni!" #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" -msgstr "Konvertálási beállítások" +msgstr "Konvertálás beállításai" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" @@ -10696,7 +10547,7 @@ msgstr "Maximum %d" #: lazarusidestrconsts.lismaybepackageneedsacleanrebuild msgid ". Maybe package %s needs a clean rebuild." -msgstr "" +msgstr ". A(z) %s csomag talán tiszta újraépítést igényel." #: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage msgid "%s Maybe you have to recompile the package." @@ -10704,7 +10555,7 @@ msgstr "%s Talán újra kell fordítani a csomagot." #: lazarusidestrconsts.lismb msgid "%s MB" -msgstr "" +msgstr "%s MB" #: lazarusidestrconsts.lismeaction msgctxt "lazarusidestrconsts.lismeaction" @@ -10842,7 +10693,7 @@ msgstr "Hibakereső ablakok" #: lazarusidestrconsts.lismenudelphiconversion msgid "Delphi Conversion" -msgstr "" +msgstr "Delphi átalakítása" #: lazarusidestrconsts.lismenudiff msgctxt "lazarusidestrconsts.lismenudiff" @@ -11016,7 +10867,7 @@ msgstr "Lezáratlan blokk keresése" #: lazarusidestrconsts.lismenuhelp msgid "&Help" -msgstr "Súgó" +msgstr "&Súgó" #: lazarusidestrconsts.lismenuideinternals msgid "IDE Internals" @@ -11061,7 +10912,7 @@ msgstr "GPL megjegyzés" #: lazarusidestrconsts.lismenuinsertgplnoticetranslated msgid "GPL Notice (translated)" -msgstr "" +msgstr "GPL megjegyzés (lefordítva)" #: lazarusidestrconsts.lismenuinsertlgplnotice msgid "LGPL Notice" @@ -11069,7 +10920,7 @@ msgstr "LGPL megjegyzés" #: lazarusidestrconsts.lismenuinsertlgplnoticetranslated msgid "LGPL Notice (translated)" -msgstr "" +msgstr "LGPL megjegyzés (lefordítva)" #: lazarusidestrconsts.lismenuinsertmitnotice msgid "MIT Notice" @@ -11077,7 +10928,7 @@ msgstr "MIT megjegyzés" #: lazarusidestrconsts.lismenuinsertmitnoticetranslated msgid "MIT Notice (translated)" -msgstr "" +msgstr "MIT megjegyzés (lefordítva)" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL Notice" @@ -11085,7 +10936,7 @@ msgstr "Módosított LGPL megjegyzés" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated msgid "Modified LGPL Notice (translated)" -msgstr "" +msgstr "Módosított LGPL megjegyzés (lefordítva)" #: lazarusidestrconsts.lismenuinsertusername msgid "Current Username" @@ -11218,7 +11069,7 @@ msgstr "Legutóbbi projekt megnyitása" #: lazarusidestrconsts.lismenupackage msgid "Pa&ckage" -msgstr "Csomag" +msgstr "&Csomag" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph" @@ -11247,12 +11098,12 @@ msgstr "Projekt felügyelő" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." -msgstr "Projekt beállítások ..." +msgstr "Projekt beállításai ..." #: lazarusidestrconsts.lismenuprojectrun msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "&Run" -msgstr "Futtatás" +msgstr "F&uttatás" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." @@ -11298,7 +11149,7 @@ msgstr "Visszaállítás" #: lazarusidestrconsts.lismenurun msgctxt "lazarusidestrconsts.lismenurun" msgid "&Run" -msgstr "Futtatás" +msgstr "F&uttatás" #: lazarusidestrconsts.lismenurunfile msgid "Run File" @@ -11331,7 +11182,7 @@ msgstr "Projekt mentése másként ..." #: lazarusidestrconsts.lismenusearch msgid "&Search" -msgstr "Kere&sés" +msgstr "&Keresés" #: lazarusidestrconsts.lismenuselect msgid "Select" @@ -11472,7 +11323,7 @@ msgstr "Kijelölés megjegyzésbe/vissza" #: lazarusidestrconsts.lismenutools msgid "&Tools" -msgstr "Eszközök" +msgstr "Es&zközök" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment Selection" @@ -11493,7 +11344,7 @@ msgstr "Unit hozzáadása a uses részhez ..." #: lazarusidestrconsts.lismenuview msgid "&View" -msgstr "Nézet" +msgstr "&Nézet" #: lazarusidestrconsts.lismenuviewanchoreditor msgid "Anchor Editor" @@ -11515,12 +11366,12 @@ msgstr "Hívási verem" #: lazarusidestrconsts.lismenuviewcodebrowser msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" msgid "Code Browser" -msgstr "Kód tallózó" +msgstr "Kódtallózó" #: lazarusidestrconsts.lismenuviewcodeexplorer msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" msgid "Code Explorer" -msgstr "Kód böngésző" +msgstr "Kódböngésző" #: lazarusidestrconsts.lismenuviewcomponentpalette msgid "Component Palette" @@ -11634,7 +11485,7 @@ msgstr "Amit építeni kell" #: lazarusidestrconsts.lismenuwindow msgid "&Window" -msgstr "Ablak" +msgstr "&Ablak" #: lazarusidestrconsts.lismeother msgctxt "lazarusidestrconsts.lismeother" @@ -11647,7 +11498,7 @@ msgstr "Projektek" #: lazarusidestrconsts.lismessagecontainsnofilepositioninformation msgid "Message contains no file position information:%s%s" -msgstr "" +msgstr "Az üzenet nem tartalmazza a fájlon belüli pozíciót:%s%s " #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" @@ -11655,7 +11506,7 @@ msgstr "Üzenetszerkesztő" #: lazarusidestrconsts.lismessageswindow msgid "Messages Window" -msgstr "" +msgstr "Üzenet ablak" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" @@ -11663,7 +11514,7 @@ msgstr "Metódus osztálya nem található" #: lazarusidestrconsts.lismissingdirectory msgid "missing directory \"%s\"" -msgstr "" +msgstr "hiányzó könyvtár: \"%s\"" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" @@ -11671,7 +11522,7 @@ msgstr "Hiányzó események" #: lazarusidestrconsts.lismissingexecutable msgid "missing executable \"%s\"" -msgstr "" +msgstr "hiányzó futtatható állomány: \"%s\"" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" @@ -11731,7 +11582,7 @@ msgstr "Egyéni beállítások hozzáadása:" #: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" -msgstr "" +msgstr "Önkényes fpc beállítások hozzáadása, pl. -O1 -ghtl -dFlag" #: lazarusidestrconsts.lismmapplytoallpackages msgid "Apply to all packages." @@ -11751,7 +11602,7 @@ msgstr "Alkalmazás a projektre." #: lazarusidestrconsts.lismmcreateanewgroupofoptions msgid "Create a new group of options" -msgstr "" +msgstr "Új beállításcsoport létrehozása" #: lazarusidestrconsts.lismmcustomoption msgid "Custom Option" @@ -11823,7 +11674,7 @@ msgstr "Új cél" #: lazarusidestrconsts.lismmoverrideoutdirfu msgid "Override OutDir (-FU): %s" -msgstr "" +msgstr "OutDir felülbírálása (-FU): %s" #: lazarusidestrconsts.lismmoverrideoutputdirectory msgid "Override output directory (-FU)" @@ -11889,23 +11740,23 @@ msgstr "Tovább" #: lazarusidestrconsts.lismoresub msgctxt "lazarusidestrconsts.lismoresub" msgid "More >>" -msgstr "Tovább >>" +msgstr "Továbbiak >>" #: lazarusidestrconsts.lismove msgid "Move" -msgstr "" +msgstr "Áthelyezés" #: lazarusidestrconsts.lismovefiles msgid "Move Files" -msgstr "" +msgstr "Fájlok áthelyezése" #: lazarusidestrconsts.lismovefiles2 msgid "Move files?" -msgstr "" +msgstr "Fájlok áthelyezése?" #: lazarusidestrconsts.lismovefilesfromtothedirectoryof msgid "Move %s file(s) from %s to the directory%s%s%sof %s." -msgstr "" +msgstr "%s fájl áthelyezése innen: %s%s ide:%s%smely a(z) %s könyvtára." #: lazarusidestrconsts.lismoveonepositiondown msgid "Move \"%s\" one position down" @@ -11917,11 +11768,11 @@ msgstr "Mozgatás \"%s\" pozícióval feljebb" #: lazarusidestrconsts.lismoveorcopyfiles msgid "Move or Copy files?" -msgstr "" +msgstr "Fájlok áthelyezése vagy másolása?" #: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s." -msgstr "" +msgstr "%s fájl áthelyezése vagy másolása innen: %s%s ide:%s%smely a(z) %s könyvtára." #: lazarusidestrconsts.lismovepage msgid "Move Page" @@ -11941,7 +11792,7 @@ msgstr "Mozgatás ide: " #: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa msgid "Moving these units will break their uses sections. See Messages window for details." -msgstr "" +msgstr "Ezen unitok áthelyezése törést okoz a uses részükben. Lásd az Üzenetek ablakát a részletekért!" #: lazarusidestrconsts.lisms msgid "(ms)" @@ -12072,7 +11923,7 @@ msgstr "Nincs kijelölt kód" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." -msgstr "Nincsenek származtatott fordító beállítások." +msgstr "Nincsenek származtatott fordítóbeállítások." #: lazarusidestrconsts.lisnohints msgid "no hints" @@ -12111,10 +11962,8 @@ msgid "No Pascal file" msgstr "Nincs pascal fájl" #: lazarusidestrconsts.lisnoprogramfilesfound -#, fuzzy -#| msgid "No program file %s%s%s found." msgid "No program file \"%s\" found." -msgstr "A(z) %s%s%s programfájl nem található." +msgstr "A(z) \"%s\" programfájl nem található." #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" @@ -12142,7 +11991,7 @@ msgstr "Nem érvényes pascal azonosító" #: lazarusidestrconsts.lisnote msgid "Note" -msgstr "" +msgstr "Megjegyzés" #: lazarusidestrconsts.lisnotebooktabposbottom msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" @@ -12251,16 +12100,12 @@ msgid "Add to favorite properties" msgstr "Hozzáadás a kedvenc tulajdonságokhoz" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty -#, fuzzy -#| msgid "Choose a base class for the favorite property %s%s%s." msgid "Choose a base class for the favorite property \"%s\"." -msgstr "Válasszon egy alap osztályt a(z) %s%s%s kedvenc tulajdonság számára!" +msgstr "Válasszon egy alap osztályt a(z) \"%s\" kedvenc tulajdonság számára!" #: lazarusidestrconsts.lisoifclassnotfound -#, fuzzy -#| msgid "Class %s%s%s not found." msgid "Class \"%s\" not found." -msgstr "A(z) %s%s%s osztály nem található" +msgstr "A(z) \"%s\" osztály nem található" #: lazarusidestrconsts.lisoifremovefromfavoriteproperties msgid "Remove from favorite properties" @@ -12296,7 +12141,7 @@ msgstr "statikusan telepítve" #: lazarusidestrconsts.lisoiplicenselicense msgid "%sLicense: %s" -msgstr "" +msgstr "%sLicenc: %s" #: lazarusidestrconsts.lisoipmissing msgid "missing" @@ -12469,7 +12314,7 @@ msgstr "%sa projekt CPU felülbírálása. pl. i386 x86_64 powerpc powerpc_64 st #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau msgid "%soverride the project operating system. e.g. win32 linux. default: %s" -msgstr "%sa proket operációs rendszer felülbírálása.pl. win32 linux. alapértelmezett: %s" +msgstr "%sa projekt operációs rendszer felülbírálása.pl. win32 linux. alapértelmezett: %s" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" @@ -12497,7 +12342,7 @@ msgstr "%s csomag" #: lazarusidestrconsts.lispackage3 msgid ", package %s" -msgstr "" +msgstr ", %s csomag" #: lazarusidestrconsts.lispackageinfo msgid "Package info" @@ -12517,7 +12362,7 @@ msgstr "A csomagot telepíteni kell" #: lazarusidestrconsts.lispackageoption msgid "Package \"%s\" Option" -msgstr "" +msgstr "\"%s\" csomagbeállítás" #: lazarusidestrconsts.lispackageoutputdirectories msgid "Package output directories" @@ -12537,7 +12382,7 @@ msgstr "Oldal" #: lazarusidestrconsts.lispanic msgid "Panic" -msgstr "" +msgstr "Pánik" #: lazarusidestrconsts.lisparsed #, fuzzy @@ -12546,7 +12391,7 @@ msgstr ", elemezve" #: lazarusidestrconsts.lisparser msgid "parser \"%s\": %s" -msgstr "" +msgstr "\"%s\" elemző: %s" #: lazarusidestrconsts.lispascalfile msgid "Pascal file" @@ -12641,7 +12486,7 @@ msgstr "Törölje a csomag nevének használatához" #: lazarusidestrconsts.lispckdisablei18noflfm msgid "Disable I18N of lfm" -msgstr "" +msgstr "I18N kikapcsolása az lfm-ben" #: lazarusidestrconsts.lispckeditaddanitem msgid "Add an item" @@ -12746,10 +12591,8 @@ msgid "Package %s" msgstr "%s csomag" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage -#, fuzzy -#| msgid "Package %s%s%s has changed.%sSave package?" msgid "Package \"%s\" has changed.%sSave package?" -msgstr "A(z) %s%s%s csomag megváltozott.%sElmenti a csomagot?" +msgstr "A(z) \"%s\" csomag megváltozott.%sElmenti a csomagot?" #: lazarusidestrconsts.lispckeditpackagenotsaved msgid "package %s not saved" @@ -12800,10 +12643,8 @@ msgid "Remove Dependency?" msgstr "Eltávolítja a függőséget?" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage -#, fuzzy -#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" -msgstr "Eltávolítja a(z) %s%s%s%s függőséget a(z) %s%s%s csomagból?" +msgstr "Eltávolítja a(z) \"%s\"%s függőséget a(z) \"%s\" csomagból?" #: lazarusidestrconsts.lispckeditremovedfiles msgid "Removed Files" @@ -12823,10 +12664,8 @@ msgid "Remove file?" msgstr "Eltávolítja a fájlt?" #: lazarusidestrconsts.lispckeditremovefilefrompackage -#, fuzzy -#| msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgid "Remove file \"%s\"%sfrom package \"%s\"?" -msgstr "Eltávolítja a(z) %s%s%s%s fájlt a(z) %s%s%s csomagból?" +msgstr "Eltávolítja a(z) \"%s\"%s fájlt a(z) \"%s\" csomagból?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" @@ -12849,16 +12688,12 @@ msgid "Store file name as preferred for this dependency" msgstr "" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion -#, fuzzy -#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" -msgstr "A(z) %s%s%s legnagyobb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)" +msgstr "A(z) \"%s\" legnagyobb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion -#, fuzzy -#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" -msgstr "A(z) %s%s%s legkisebb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)" +msgstr "A(z) \"%s\" legkisebb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" @@ -12992,10 +12827,8 @@ msgid "Runtime" msgstr "Futásidejű" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans -#, fuzzy -#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." -msgstr "A(z) %s%s%s csomagnak van auto install kapcsolója.%sEz azt jelenti, hogy telepítve lesz az IDE-be. A telepítendő csomagoknak%stervezési idejű csomagoknak kell lenniük." +msgstr "A(z) \"%s\" csomagnak van auto install kapcsolója.%sEz azt jelenti, hogy telepítve lesz az IDE-be.%sA telepítendő csomagoknak tervezési idejű csomagoknak kell lenniük." #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" @@ -13216,31 +13049,27 @@ msgstr "Virtuális unit" #: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid msgid "Package directory. Parameter is package ID" -msgstr "" +msgstr "Csomag könyvtára. Paraméter a csomag azonosítója" #: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid msgid "Package include files search path. Parameter is package ID" -msgstr "" +msgstr "Csomag include fájlok keresési útvonala. Paraméter a csomag azonosítója" #: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid msgid "Package source search path. Parameter is package ID" -msgstr "" +msgstr "Csomag forrás keresési útvonala. Paraméter a csomag azonosítója" #: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid msgid "Package unit search path. Parameter is package ID" -msgstr "" +msgstr "Csomag unit keresési útvonala. Paraméter a csomag azonosítója" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage -#, fuzzy -#| msgid "%sAdding new Dependency for package %s: package %s%s" msgid "%sAdding new Dependency for package %s: package %s" -msgstr "%sÚj függőség hozzáadása a(z) %s csomaghoz: %s%s csomag" +msgstr "%sÚj függőség hozzáadása a(z) %s csomaghoz: %s csomag" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage -#, fuzzy -#| msgid "%sAdding new Dependency for project %s: package %s%s" msgid "%sAdding new Dependency for project %s: package %s" -msgstr "%sÚj függőség hozzáadása a(z) %s projekthez: %s%s csomag" +msgstr "%sÚj függőség hozzáadása a(z) %s projekthez: %s csomag" #: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." @@ -13279,10 +13108,8 @@ msgid "Delete Old Package File?" msgstr "Törli a régi csomag fájlt?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 -#, fuzzy -#| msgid "Delete old package file %s%s%s?" msgid "Delete old package file \"%s\"?" -msgstr "Törli a(z) %s%s%s régi csomagfájlt?" +msgstr "Törli a(z) \"%s\" régi csomagfájlt?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" @@ -13330,11 +13157,9 @@ msgid "Filename is used by project" msgstr "A fájlnevet egy projekt használja" #: lazarusidestrconsts.lispkgmangfilenotfound -#, fuzzy -#| msgid "File %s%s%s not found." msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" msgid "File \"%s\" not found." -msgstr "A(z) %s%s%s fájl nem található." +msgstr "A(z) \"%s\" fájl nem található." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" @@ -13373,10 +13198,8 @@ msgid "Invalid Package Name" msgstr "Érvénytelen csomag név" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage -#, fuzzy -#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" -msgstr "A(z) %s csomag betöltése eltávolítja a(z) %s%scsomagot a(z) %s fájlból.%sA régi csomag megváltozott.%s%sElmenti a(z) %s régi csomagot?" +msgstr "A(z) %s csomag betöltése eltávolítja a(z) %s%s csomagot a(z) %s fájlból.%sA régi csomag megváltozott.%sMenti a régi %s csomagot?" #: lazarusidestrconsts.lispkgmangnewpackage msgid "NewPackage" @@ -13431,10 +13254,8 @@ msgid "Rename File lowercase?" msgstr "A fájl átnevezése kisbetűsre?" #: lazarusidestrconsts.lispkgmangreplaceexistingfile -#, fuzzy -#| msgid "Replace existing file %s%s%s?" msgid "Replace existing file \"%s\"?" -msgstr "Kicseréli a létező %s%s%s fájlt?" +msgstr "Kicseréli a létező \"%s\" fájlt?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" @@ -13453,10 +13274,8 @@ msgid "Save Package %s (*.lpk)" msgstr "A(z) %s csomag mentése (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto -#, fuzzy -#| msgid "Should the file be renamed lowercase to%s%s%s%s?" msgid "Should the file be renamed lowercase to%s\"%s\"?" -msgstr "A fájlnév átnevezhető kisbetűsre a következőképpen:%s%s%s%s?" +msgstr "A fájlnév átnevezhető kisbetűsre a következőképpen:%s\"%s\"?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" @@ -13471,39 +13290,29 @@ msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "A(z) %s csomaghoz tartozó fordító nem érvényes futtatható fájl:%s%s" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage -#, fuzzy -#| msgid "The file %s%s%s%sis already in the package %s." msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" msgid "The file \"%s\"%sis already in the package %s." -msgstr "A(z) %s%s%s%s fájl mér benne van a(z) %s csomagban." +msgstr "A(z) \"%s\"%s fájl már benne van a(z) %s csomagban." #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage -#, fuzzy -#| msgid "The file %s%s%s is not a Lazarus package." msgid "The file \"%s\" is not a Lazarus package." -msgstr "A(z) %s%s%s fájl nem Lazarus csomag." +msgstr "A(z) \"%s\" fájl nem Lazarus csomag." #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage -#, fuzzy -#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" -msgstr "A(z) %s%s%s fájlnév nem egyezik meg a(z) %s%s%s csomagnévvel a fájlban.%sMegváltoztatja a csomagnevet erre: %s%s%s?" +msgstr "A(z) \"%s\" fájlnév nem egyezik meg a(z) \"%s\" csomagnévvel a fájlban.%sMegváltoztatja a csomagnevet erre: \"%s\"?" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject -#, fuzzy -#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." -msgstr "A(z) %s%s%s fájlnév része a jelenlegi projektnek.%sA projektek és a csomagok nem oszthatnak meg fájlokat egymás között." +msgstr "A(z) \"%s\" fájlnév része a jelenlegi projektnek.%sA projektek és a csomagok nem oszthatnak meg fájlokat egymás között." #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile -#, fuzzy -#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." -msgstr "A(z) %s%s%s fájlnevet%sa(z) %s%s%s csomag használja%sa(z) %s%s%s fájlban." +msgstr "A(z) \"%s\" fájlnevet%sa(z) \"%s\" csomag használja%sa(z) \"%s\" fájlban." #: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound msgid "The file \"%s\" of package %s was not found." -msgstr "" +msgstr "A(z) \"%s\" fájl a %s csomagból nem található." #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" @@ -13514,22 +13323,16 @@ msgid "The following packages failed to load:" msgstr "A következő csomagok betöltése sikertelen:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof -#, fuzzy -#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgid "%sThe following units will be added to the uses section of%s%s:%s%s" -msgstr "%sA következő unit-ok hozzá lesznek adva a(z) %s%s uses részhez:%s%s%s" +msgstr "%sA következő unit-ok hozzá lesznek adva a(z) %s%s uses részhez:%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati -#, fuzzy -#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?" -msgstr "A(z) %s%s%s csomagot nem sikerült lefordítani.%sEltávolítja a telepítési listából?" +msgstr "A(z) \"%s\" csomagot nem sikerült lefordítani.%sEltávolítja a telepítési listából?" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename -#, fuzzy -#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name." msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." -msgstr "A(z) %s%s%s csomag fájlnév%sa(z) %s%s%s fájlban érvénytelen Lazarus csomagnév." +msgstr "A(z) \"%s\" csomag fájlnév%sa(z) \"%s\" fájlban érvénytelen Lazarus csomagnév." #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." @@ -13548,62 +13351,44 @@ msgid "The package %s is required by %s, which is marked for installation.%sSee msgstr "A(z) %s csomag függősége a(z) %s csomagnak, ami meg van jelölve telepítéshez.%sLásd a csomagstruktúrát." #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean -#, fuzzy -#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "A(z) %s%s%s csomagnév érvénytelen.%sVálasszon egy másik nevet! (pl. csomag1.lpk)" +msgstr "A(z) \"%s\" csomagnév érvénytelen.%sVálasszon egy másik nevet! (pl. csomag1.lpk)" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid -#, fuzzy -#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." -msgstr "A(z) %s%s%s csomagnév%sa(z) %s%s%s fájlban érvénytelen." +msgstr "A(z) \"%s\" csomagnév%sa(z) \"%s\" fájlban érvénytelen." #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus -#, fuzzy -#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" -msgstr "A(z) %s%s%s csomag meg lett jelölve.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi eltávolításhoz újra kell építeni és újra kell indítani a Lazarus-t.%s%sÚjra szeretné fordítani a Lazarus-t most?" +msgstr "A(z) \"%s\" csomag meg lett jelölve.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi eltávolításhoz újra kell építeni és újra kell indítani a Lazarus-t.%sÚjra szeretné fordítani a Lazarus-t most?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus -#, fuzzy -#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" -msgstr "A(z) %s%s%s csomag meg lett jelölve telepítésre.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi telepítéshez újra kell építeni és újra kell indítani a Lazarus-t.%s%sÚjra szeretné fordítani a Lazarus-t most?" +msgstr "A(z) \"%s\" csomag meg lett jelölve telepítésre.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi telepítéshez újra kell építeni és újra kell indítani a Lazarus-t.%sÚjra szeretné fordítani a Lazarus-t most?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound -#, fuzzy -#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." -msgstr "A projekthez szükséges a(z) %s%s%s csomag.%sDe ez nem található. Ellenőrizze a Projekt -> Projekt felügyelőben." +msgstr "A projekthez szükséges a(z)\"%s\" csomag.%sDe ez nem található. Ellenőrizze a Projekt -> Projekt felügyelőben." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from -#, fuzzy -#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" -msgstr "Van két azonos nevű unit:%s%s1. %s%s%s innen: %s%s2. %s%s%s innen: %s%s%s" +msgstr "Van két azonos nevű unit:%s1. \"%s\" innen: %s%s2. \"%s\" innen: %s" #: lazarusidestrconsts.lispkgmangthereisacirculardependency msgid "There is a circular dependency in the packages. See package graph." msgstr "A csomagok között körkörös függés áll fenn. Lásd a Csomag-fát!" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage -#, fuzzy -#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgid "There is a FPC unit with the same name as a package:%s\"%s\"" -msgstr "Létezik egy FPC unit ugyanazzal a névvel, mint a következő csomag:%s%s%s%s%s%s" +msgstr "Létezik egy FPC unit ugyanazzal a névvel, mint a következő csomag:%s\"%s\"" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom -#, fuzzy -#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" -msgstr "Van egy FPC unit ugyanolyan névvel, mint ez:%s%s%s%s%s innen %s%s%s" +msgstr "Van egy FPC unit ugyanolyan névvel, mint ez:%s\"%s\" innen %s" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename -#, fuzzy -#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" -msgstr "Már létezik egy csomag ezzel a névvel: %s%s%s.%sÜtköző csomag: %s%s%s%sFájl: %s%s%s" +msgstr "Már létezik egy csomag ezzel a névvel: \"%s\".%sÜtköző csomag: \"%s\"%sFájl: \"%s\"" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." @@ -13614,10 +13399,8 @@ msgid "There is an unsaved package in the required packages. See package graph." msgstr "Van egy nem mentett csomag a szükséges csomagok között. Lásd a csomag diagramban." #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 -#, fuzzy -#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" -msgstr "Van egy unit ugyanazzal a névvel, mint egy csomag:%s%s1. %s%s%s innen: %s%s2. %s%s%s%s" +msgstr "Van egy unit ugyanazzal a névvel, mint egy csomag:%s1. \"%s\" innen: %s%s2. \"%s\"" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." @@ -13628,66 +13411,48 @@ msgid "Unable to create directory" msgstr "Könyvtár létrehozása nem lehetséges" #: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage -#, fuzzy -#| msgid "Unable to create output directory %s%s%s%sfor package %s." msgid "Unable to create output directory \"%s\"%sfor package %s." -msgstr "A(z) %s%s%s kimeneti könyvtár létrehozása nem lehetséges%sa(z) %s csomaghoz." +msgstr "A(z) \"%s\" kimeneti könyvtár létrehozása nem lehetséges%sa(z) %s csomaghoz." #: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage -#, fuzzy -#| msgid "Unable to create package source directory %s%s%s%sfor package %s." msgid "Unable to create package source directory \"%s\"%sfor package %s." -msgstr "A(z) %s%s%s forrás könyvtár létrehozása nem lehetséges%sa(z) %s csomaghoz." +msgstr "A(z) \"%s\" forrás könyvtár létrehozása nem lehetséges%sa(z) %s csomaghoz." #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus -#, fuzzy -#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages." msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." -msgstr "Ezen Lazarus célkönyvtár létrehozása nem lehetséges:%s%s%s%s.%sEz a könyvtár szükséges az új, megváltozott Lazarus IDE-hez, amely már tartalmazza az egyéni csomagjait." +msgstr "Ezen Lazarus célkönyvtár létrehozása nem lehetséges:%s\"%s\".%sEz a könyvtár szükséges az új, megváltozott Lazarus IDE-hez, amely már tartalmazza az egyéni csomagjait." #: lazarusidestrconsts.lispkgmangunabletodeletefile -#, fuzzy -#| msgid "Unable to delete file %s%s%s." msgid "Unable to delete file \"%s\"." -msgstr "A(z) %s%s%s fájl törlése nem lehetséges" +msgstr "A(z) \"%s\" fájl törlése nem lehetséges" #: lazarusidestrconsts.lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "Fájl törlése nem lehetséges" #: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage -#, fuzzy -#| msgid "Unable to delete old state file %s%s%s%sfor package %s." msgid "Unable to delete old state file \"%s\"%sfor package %s." -msgstr "A(z) %s%s%s régi állapotfájl törlése nem lehetséges%sa(z) %s csomaghoz." +msgstr "A(z) \"%s\" régi állapotfájl törlése nem lehetséges%sa(z) %s csomaghoz." #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "Csomag betöltése nem lehetséges" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage -#, fuzzy -#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgid "Unable to open the package \"%s\".%sThis package was marked for installation." -msgstr "A(z) %s%s%s csomag megnyitása nem lehetséges.%sEz a csomag meg lett jelölve telepítésre." +msgstr "A(z) \"%s\" csomag megnyitása nem lehetséges.%sEz a csomag meg lett jelölve telepítésre." #: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror -#, fuzzy -#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s" -msgstr "A(z) %s%s%s%sállapotfájl,ami a(z) %s csomaghoz tartozik nem olvasható.%sHiba: %s" +msgstr "A(z) \"%s\" állapotfájl,%sami a(z) %s csomaghoz tartozik nem olvasható.%sHiba: %s" #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror -#, fuzzy -#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" -msgstr "A(z) %s%s%s csomag írása%sa(z) %s%s%s fájlba nem lehetséges.%sHiba: %s" +msgstr "A(z) \"%s\" csomag írása%sa(z) \"%s\" fájlba nem lehetséges.%sHiba: %s" #: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror -#, fuzzy -#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s" -msgstr "A(z) %s%s%s%sállapotfájl írása, ami a(z) %s csomaghoz tartozik, nem lehetséges.%sHiba: %s" +msgstr "A(z) \"%s\" állapotfájl írása,%sami a(z) %s csomaghoz tartozik, nem lehetséges.%sHiba: %s" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" @@ -13706,10 +13471,8 @@ msgid "Use unit" msgstr "Unit használata" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject -#, fuzzy -#| msgid "Warning: The file %s%s%s%sbelongs to the current project." msgid "Warning: The file \"%s\"%sbelongs to the current project." -msgstr "Figyelmeztetés: A(z) %s%s%s%sfájl a jelenlegi projekthez tartozik." +msgstr "Figyelmeztetés: A(z) \"%s\"%sfájl a jelenlegi projekthez tartozik." #: lazarusidestrconsts.lispkgmgrkeep msgctxt "lazarusidestrconsts.lispkgmgrkeep" @@ -13740,16 +13503,12 @@ msgid "Cannot register components without unit" msgstr "Unit nélküli komponenseket nem lehet regisztrálni" #: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined -#, fuzzy -#| msgid "Component Class %s%s%s already defined" msgid "Component Class \"%s\" already defined" -msgstr "A(z) %s%s%s komponens osztály már definiálva van" +msgstr "A(z) \"%s\" komponens osztály már definiálva van" #: lazarusidestrconsts.lispkgsysfilename -#, fuzzy -#| msgid "%s%sFile Name: %s%s%s" msgid "%s%sFile Name: \"%s\"" -msgstr "%s%sFájlnév: %s%s%s" +msgstr "%s%sFájlnév: \"%s\"" #: lazarusidestrconsts.lispkgsysinvalidcomponentclass msgid "Invalid component class" @@ -13760,10 +13519,8 @@ msgid "Invalid Unitname: %s" msgstr "Érvénytelen unit név: %s" #: lazarusidestrconsts.lispkgsyslpkfilename -#, fuzzy -#| msgid "%s%slpk file: %s%s%s" msgid "%s%slpk file: \"%s\"" -msgstr "%s%slpk fájl: %s%s%s" +msgstr "%s%slpk fájl: \"%s\"" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" @@ -13786,10 +13543,8 @@ msgid "%s%sThe lpk file was not found." msgstr "%s%sAz lpk fájl nincs meg." #: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound -#, fuzzy -#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." -msgstr "A(z) %s%s%s csomag telepítve van, de nem található érvényes csomagfájl (.lpk).%sEgy törött, látszólagos csomag lett létrehozva." +msgstr "A(z) \"%s\" csomag telepítve van, de nem található érvényes csomagfájl (.lpk).%sEgy törött, látszólagos csomag lett létrehozva." #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." @@ -13800,10 +13555,8 @@ msgid "This package is installed, but the lpk file was not found. All its compon msgstr "Ez a csomag telepítve van, de az .lpk fájl nem található. Minden komponense deaktiválva van. Javítsa!" #: lazarusidestrconsts.lispkgsysunitname -#, fuzzy -#| msgid "%s%sUnit Name: %s%s%s" msgid "%s%sUnit Name: \"%s\"" -msgstr "%s%sUnit név: %s%s%s" +msgstr "%s%sUnit név: \"%s\"" #: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit." @@ -13812,7 +13565,7 @@ msgstr "A(z) \"%s\" unit nem található az lpk fájlban.%s Lehet, hogy ez az lp #: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk" msgid "Unit \"%s\" was removed from package (lpk)" -msgstr "" +msgstr "A \"%s\" unit el lett távolítva a csomagból (lpk)" #: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies." @@ -13831,15 +13584,12 @@ msgid "Transitivity" msgstr "" #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror -#, fuzzy -#| msgid "Unable to read package file %s%s%s.%sError: %s" msgid "Unable to read package file \"%s\".%sError: %s" -msgstr "A(z) %s%s%s csomagfájl nem olvasható.%sHiba: %s" +msgstr "A(z) \"%s\" csomagfájl nem olvasható.%sHiba: %s" #: lazarusidestrconsts.lisplay -#, fuzzy msgid "Play" -msgstr "Lejátszás" +msgstr "Indítás" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" @@ -14067,59 +13817,43 @@ msgid "Package not found" msgstr "Csomag nem található" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound -#, fuzzy -#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." -msgstr "A(z) %s%s%s függőség nem található.%sVálasszon egy létező csomagot!" +msgstr "A(z) \"%s\" függőség nem található.%sVálasszon egy létező csomagot!" #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid -#, fuzzy -#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "A(z) %s%s%s maximális verziószám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" +msgstr "A(z) \"%s\" legnagyobb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." -msgstr "A maximális verziószám kisebb, mint a minimális verziószám." +msgstr "A legnagyobb változatszám kisebb, mint a legkisebb változatszám." #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid -#, fuzzy -#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "A(z) %s%s%s minimális verziószám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" +msgstr "A(z) \"%s\" legkisebb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag -#, fuzzy -#| msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgid "The package name \"%s\" is invalid.%sPlase choose an existing package." -msgstr "A(z) %s%s%s csomagnév nem érvényes.%sVálasszon egy létező csomagot!" +msgstr "A(z) \"%s\" csomagnév nem érvényes.%sVálasszon egy létező csomagot!" #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency -#, fuzzy -#| msgid "The project has already a dependency for the package %s%s%s." msgid "The project has already a dependency for the package \"%s\"." -msgstr "A projektnek már függősége a(z) %s%s%s csomag." +msgstr "A projektnek már függősége a(z) \"%s\" csomag." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject -#, fuzzy -#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." -msgstr "A(z) %s%s%s unit név már létezik a projektben%sa(z) %s%s%s fájllal." +msgstr "A(z) \"%s\" unit név már létezik a projektben%sa(z) \"%s\" fájllal." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection -#, fuzzy -#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." -msgstr "A(z) %s%s%s unit név már létezik a kijelölésben%sa(z) %s%s%s fájllal." +msgstr "A(z) \"%s\" unit név már létezik a kijelölésben%sa(z) \"%s\" fájllal." #: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier -#, fuzzy -#| msgid "The unit name %s%s%s is not a valid Pascal identifier." msgid "The unit name \"%s\" is not a valid Pascal identifier." -msgstr "A(z) %s%s%s unit név nem érvényes pascal azonosító." +msgstr "A(z) \"%s\" unit név nem érvényes pascal azonosító." #: lazarusidestrconsts.lisprojaddtoproject msgctxt "lazarusidestrconsts.lisprojaddtoproject" @@ -14136,7 +13870,7 @@ msgstr "Projekt: %s" #: lazarusidestrconsts.lisproject2 msgid "Project: " -msgstr "" +msgstr "Projekt:" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" @@ -14186,11 +13920,11 @@ msgstr "Projekt" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" -msgstr "Projekt makró beállítások" +msgstr "Projekt-makró tulajdonságok" #: lazarusidestrconsts.lisprojectoption msgid "Project Option" -msgstr "" +msgstr "Projekt beállítás" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" @@ -14218,37 +13952,35 @@ msgstr "Projekt forráskönyvtárai" #: lazarusidestrconsts.lisprojectsraisedexceptionataddress msgid "%0:s%0:s At address %1:x" -msgstr "" +msgstr "%0:s%0:s a következő címen: %1:x" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss msgid "Project %s raised exception class '%s'." -msgstr "" +msgstr "A(z) %s projekt '%s' osztályú kivételt okozott." #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess msgid "Project %s raised exception class '%s' with message:%s%s" -msgstr "" +msgstr "A(z) %s projekt '%s' osztályú kivételt okozott a következő üzenettel:%s%s" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress msgid "%0:s%0:s In file '%1:s' at address %2:x" -msgstr "" +msgstr "%0:s%0:s a '%1:s' fájlban a következő címen: %2:x" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileline msgid "%0:s%0:s In file '%1:s' at line %2:d" -msgstr "" +msgstr "%0:s%0:s a '%1:s' fájlban a következő sorban: %2:d" #: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" -msgstr "" +msgstr "%0:s%0:s a '%1:s' fájlban a következő sorban: %2:d:%0:s%3:s" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Projekt forrás útvonala" #: lazarusidestrconsts.lisprojectsuccessfullybuilt -#, fuzzy -#| msgid "Project %s%s%s successfully built" msgid "Project \"%s\" successfully built" -msgstr "A projekt építése sikerült: %s%s%s" +msgstr "A projekt építése sikerült: \"%s\"" #: lazarusidestrconsts.lisprojectunit msgid "project unit" @@ -14454,11 +14186,11 @@ msgstr "Legutóbbi lapok" #: lazarusidestrconsts.lisrecord msgctxt "lazarusidestrconsts.lisrecord" msgid "Record" -msgstr "Record" +msgstr "Rögzítés" #: lazarusidestrconsts.lisrecordedmacros msgid "Recorded" -msgstr "" +msgstr "Rögzítve" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" @@ -14480,7 +14212,7 @@ msgstr "Reguláris kifejezés" #: lazarusidestrconsts.lisrelative msgid "Relative" -msgstr "" +msgstr "Relatív" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" @@ -14493,7 +14225,7 @@ msgstr "Eltávolítás" #: lazarusidestrconsts.lisremove2 msgid "Remove?" -msgstr "" +msgstr "Eltávolítás?" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" @@ -14501,7 +14233,7 @@ msgstr "Minden érvénytelen tulajdonság eltávolítása" #: lazarusidestrconsts.lisremoveallmessagetypefilters msgid "Remove all message type filters" -msgstr "" +msgstr "Minden üzenettípus-szűrő eltávolítása" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" @@ -14513,7 +14245,7 @@ msgstr "" #: lazarusidestrconsts.lisremovedependenciesfrompackage msgid "Remove %s dependencies from package \"%s\"?" -msgstr "" +msgstr "%s függőség eltávolítása a(z) \"%s\" csomagból?" #: lazarusidestrconsts.lisremovedpropertys msgid "Removed property \"%s\"." @@ -14521,7 +14253,7 @@ msgstr "Tulajdonság eltávolítása: \"%s\"" #: lazarusidestrconsts.lisremovefilesfrompackage msgid "Remove %s files from package \"%s\"?" -msgstr "" +msgstr "%s fájl eltávolítása a(z) \"%s\" csomagból?" #: lazarusidestrconsts.lisremovefrominstalllist msgid "Remove from install list" @@ -14549,11 +14281,11 @@ msgstr "Helyi változó eltávolítása" #: lazarusidestrconsts.lisremovelocalvariable3 msgid "Remove local variable \"%s\"" -msgstr "" +msgstr "Helyi változó eltávolítása: %s" #: lazarusidestrconsts.lisremovemessagetypefilter msgid "Remove Message Type Filter" -msgstr "" +msgstr "Üzenettípus-szűrő eltávolítása" #: lazarusidestrconsts.lisremovenonexistingfiles msgid "Remove nonexistent files" @@ -14581,7 +14313,7 @@ msgstr "Unit útvonal eltávolítása?" #: lazarusidestrconsts.lisremoveuses msgid "Remove uses \"%s\"" -msgstr "" +msgstr "Ne használja ezt: \"%s\"" #: lazarusidestrconsts.lisrename msgctxt "lazarusidestrconsts.lisrename" @@ -14623,7 +14355,7 @@ msgstr "Újra megnyitás másik kódolással" #: lazarusidestrconsts.lisrepeat msgctxt "lazarusidestrconsts.lisrepeat" msgid "Repeat" -msgstr "Repeat" +msgstr "Ismétlés" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" @@ -14672,7 +14404,7 @@ msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/hu" #: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources msgid "Requires FPC 2.4 or above. Like Delphi resources" -msgstr "" +msgstr "FPC 2.4 vagy újabbat igényel. Mint a Delphi erőforrások" #: lazarusidestrconsts.lisrescan msgid "Rescan" @@ -14771,10 +14503,8 @@ msgid "File not executable" msgstr "A fájl nem futtatható" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable -#, fuzzy -#| msgid "The host application %s%s%s is not executable." msgid "The host application \"%s\" is not executable." -msgstr "A(z) %s%s%s külső alkalmazás nem futtatható fájl." +msgstr "A(z) \"%s\" külső alkalmazás nem futtatható fájl." #: lazarusidestrconsts.lisrunstage msgctxt "lazarusidestrconsts.lisrunstage" @@ -14873,7 +14603,7 @@ msgstr "Minden megváltozott fájl mentése" #: lazarusidestrconsts.lissavealloriginalmessagestofile msgid "Save All/Original Messages to File ..." -msgstr "" +msgstr "Összes/Eredeti üzenetek mentése fájlba ..." #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" @@ -14925,10 +14655,8 @@ msgid "Save file as" msgstr "Fájl mentése másként" #: lazarusidestrconsts.lissavefilebeforeclosingform -#, fuzzy -#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgid "Save file \"%s\"%sbefore closing form \"%s\"?" -msgstr "Menti a(z) %s%s%s fájlt%s a(z) %s%s%s form bezárása előtt?" +msgstr "Menti a(z) \"%s\" fájlt%s a(z) \"%s\" form bezárása előtt?" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" @@ -14940,7 +14668,7 @@ msgstr "Makró mentése mint" #: lazarusidestrconsts.lissavemessages msgid "Save messages" -msgstr "" +msgstr "Üzenetek mentése" #: lazarusidestrconsts.lissaveproject msgid "Save project %s (*%s)" @@ -14956,7 +14684,7 @@ msgstr "Beállítások mentése" #: lazarusidestrconsts.lissaveshownmessagestofile msgid "Save Shown Messages to File ..." -msgstr "" +msgstr "Megjelenített üzenetek mentése fájlba ..." #: lazarusidestrconsts.lissavespace msgid "Save " @@ -15077,19 +14805,19 @@ msgstr "Útvonal kiválasztása ehhez: %s" #: lazarusidestrconsts.lisselecttargetdirectory msgid "Select target directory" -msgstr "" +msgstr "Célkönyvtár választása" #: lazarusidestrconsts.lissetallcolors msgid "Set all colors:" -msgstr "" +msgstr "Minden szín beállítása:" #: lazarusidestrconsts.lissetdefault msgid "Set default" -msgstr "Alapértelmezett beállítása" +msgstr "Alapértelmezés beállítása" #: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." -msgstr "" +msgstr "Állítsa be ezt a fordító üzeneteinek más nyelvre történő lefordításához (nem angol). Például: Német: $(FPCSrcDir)/compiler/msg/errordu.msg." #: lazarusidestrconsts.lissetupdefaultindentation msgid "(Set up default indentation)" @@ -15101,7 +14829,7 @@ msgstr "Rövidítés:" #: lazarusidestrconsts.lisshortnopath msgid "Short, no path" -msgstr "" +msgstr "Rövid, nincs útvonal" #: lazarusidestrconsts.lisshow msgid "Show" @@ -15109,7 +14837,7 @@ msgstr "Megjelenítés" #: lazarusidestrconsts.lisshowabstractmethodsof msgid "Show abstract methods of \"%s\"" -msgstr "" +msgstr "\"%s\" absztrakt metódusainak megjelenítése" #: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector msgid "Show component tree" @@ -15154,7 +14882,7 @@ msgstr "Információs ablak megjelenítése" #: lazarusidestrconsts.lisshowmessagetypeid msgid "Show Message Type ID" -msgstr "" +msgstr "Üzenettípus azonosítójának megjelenítése" #: lazarusidestrconsts.lisshowonlymodified msgid "Show only modified" @@ -15206,7 +14934,7 @@ msgstr "Érték-tippek megjelenítése hibakeresés közben" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" -msgstr "verziószám megjelenítése és kilépés" +msgstr "változatszám megjelenítése és kilépés" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" @@ -15317,16 +15045,12 @@ msgid "&Source Breakpoint ..." msgstr "Töréspont a forráskódban ..." #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema -#, fuzzy -#| msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it." -msgstr "A(z) %s%s%s forrás könyvtár%sés a(z) %s%s%s célkönyvtár%sazonos.%s%sLehet, hogy félreértette ezt a funkciót.%sEz tisztítja/újra létrehozza a célkönyvtárat%sés belemásolja a csomagot/projektet." +msgstr "Ugyanaz a forráskönyvtár: \"%s\"%sés a célkönyvtár: \"%s\".%sLehet, hogy félreértette ezt a szolgáltatást.%sEz tisztítja / újra létrehozza a célkönyvtárat és belemásolja a csomagot/projektet." #: lazarusidestrconsts.lissourcedirectorydoesnotexist -#, fuzzy -#| msgid "Source directory %s%s%s does not exist." msgid "Source directory \"%s\" does not exist." -msgstr "A(z) %s%s%s forrás könyvtár nem létezik." +msgstr "A(z) \"%s\" forrás könyvtár nem létezik." #: lazarusidestrconsts.lissourceeditorwindowmanager msgid "Source Editor Window Manager" @@ -15337,10 +15061,8 @@ msgid "Source modified" msgstr "Forrás módosítva" #: lazarusidestrconsts.lissourceofpagehaschangedsave -#, fuzzy -#| msgid "Source of page %s%s%s has changed. Save?" msgid "Source of page \"%s\" has changed. Save?" -msgstr "A(z) %s%s%s oldal forrása megváltozott. Elmenti?" +msgstr "A(z) \"%s\" oldal forrása megváltozott. Mentés?" #: lazarusidestrconsts.lissourceofpagehaschangedsaveex msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" @@ -15434,19 +15156,19 @@ msgstr "Al-eljárás azonos szinten" #: lazarusidestrconsts.lissuccesfullyexportedbuildmodes msgid "Succesfully exported %d BuildModes to \"%s\"." -msgstr "" +msgstr "%d építési mód sikeresen exportálva lett ide: \"%s\"." #: lazarusidestrconsts.lissuccesfullyexportedcompileroptions msgid "Succesfully exported compiler options to \"%s\"." -msgstr "" +msgstr "A fordítóbeállítások sikeresen exportálva lettek ide: \"%s\"." #: lazarusidestrconsts.lissuccesfullyimportedbuildmodes msgid "Succesfully imported %d BuildModes from \"%s\"." -msgstr "" +msgstr "%d építési mód sikeresen importálva lett innen: \"%s\"." #: lazarusidestrconsts.lissuccesfullyimportedcompileroptions msgid "Succesfully imported compiler options from \"%s\"." -msgstr "" +msgstr "A fordítóbeállítások sikeresen importálva lettek innen: \"%s\"." #: lazarusidestrconsts.lissuccess msgid "Success" @@ -15473,10 +15195,8 @@ msgid "Invalid variable name" msgstr "Érvénytelen változónév" #: lazarusidestrconsts.lissvuoisnotavalididentifier -#, fuzzy -#| msgid "%s%s%s is not a valid identifier." msgid "\"%s\" is not a valid identifier." -msgstr "Érvénytelen azonosító: %s%s%s" +msgstr "Érvénytelen azonosító: \"%s\"" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" @@ -15484,7 +15204,7 @@ msgstr "Rendszerváltozó felülbírálása" #: lazarusidestrconsts.lisswitchfiltersettings msgid "Switch Filter Settings" -msgstr "" +msgstr "Szűrőbeállítások váltása" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" @@ -15552,7 +15272,7 @@ msgstr "Cél fájlnév + paraméterek" #: lazarusidestrconsts.listargetisreadonly msgid "Target is read only" -msgstr "" +msgstr "A cél csak olvasható" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" @@ -15581,49 +15301,39 @@ msgstr "Teszt könyvtár" #: lazarusidestrconsts.listheapplicationbundlewascreatedfor msgid "The Application Bundle was created for \"%s\"" -msgstr "" +msgstr "Az alkalmazásköteg létre lett hozva ehhez: \"%s\"" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." msgstr "" #: lazarusidestrconsts.listhecodetoolsfoundanerror -#, fuzzy -#| msgid "The Codetools found an error:%s%s%s" msgid "The Codetools found an error:%s%s" -msgstr "A CodeTools talált egy hibát:%s%s%s" +msgstr "A CodeTools talált egy hibát:%s%s" #: lazarusidestrconsts.listhecommandafterisnotexecutable -#, fuzzy -#| msgid "The command after %s%s%s is not executable." msgid "The command after \"%s\" is not executable." -msgstr "A(z) %s%s%S utáni parancs nem futtatható." +msgstr "A(z) \"%s\" utáni parancs nem futtatható." #: lazarusidestrconsts.listhecommandafterpublishingisinvalid -#, fuzzy -#| msgid "The command after publishing is invalid:%s%s%s%s" msgid "The command after publishing is invalid:%s\"%s\"" -msgstr "A közzétéel utáni parancs érvénytelen:%s%s%s%s" +msgstr "A közzétéel utáni parancs érvénytelen:%s\"%s\"" #: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect msgid "The compiler file \"%s\" does not look correct:%s%s" -msgstr "" +msgstr "A fordító fájl \"%s\" nem tűnik megfelelőnek:%s%s" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." msgstr "A(z) %s komponens nem törölhető, mert nem a(z) %s birtokolja." #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror -#, fuzzy -#| msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" -msgstr "A(z) %s%s%s osztály komponens szerkesztője ezt a hibát generálta:%s%s%s%s" +msgstr "A(z) \"%s\" osztály komponens szerkesztője ezt a hibát generálta:%s\"%s\"" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated -#, fuzzy -#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" -msgstr "A(z) %s%s%s osztály komponens szerkesztője,%sami a #%s %s%s%s parancs által van meghívva,%sa következő hibát generálta:%s%s%s%s" +msgstr "A(z) \"%s\" osztály komponens szerkesztője,%sami a #%s \"%s\" parancs által van meghívva,%sa következő hibát generálta:%s\"%s\"" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." @@ -15639,11 +15349,11 @@ msgstr "" #: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted msgid "The configuration will be downgraded/converted." -msgstr "" +msgstr "A beállítások visszafejlesztésre/átalakításra kerülnek." #: lazarusidestrconsts.listhecontainsanotexistingdirectory msgid "The %s contains a nonexistent directory:%s%s" -msgstr "" +msgstr "A(z) %s egy nem létező könyvtárat tartalmaz:%s%s" #: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." @@ -15655,27 +15365,23 @@ msgstr "" #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" -msgstr "" +msgstr "A hibakereső \"%s\"%snem létezik vagy nem futtatható.%sLásd: Eszközök -> Beállítások -> Hibakereső beállításai" #: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive msgid "The debugger executable typically has the name \"%s\". Please give the full file path." -msgstr "" +msgstr "A hibakereső program neve általában \"%s\". Meg kell adni a fájl teljes útvonalát." #: lazarusidestrconsts.listhedefaultmodemustbestoredinproject msgid "The default mode must be stored in project, not in session." msgstr "Az alapértelmezett módot a projektben kell tárolni és nem a munkamenetben." #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist -#, fuzzy -#| msgid "The destination directory%s%s%s%s does not exist." msgid "The destination directory%s\"%s\" does not exist." -msgstr "A(z)%s%s%s%s célkönyvtár nem létezik." +msgstr "A célkönyvtár nem létezik:%s\"%s\"" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep -#, fuzzy -#| msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options." -msgstr "A(z) %s%s%s célkönyvtár nem létezik.%sEllenőrizze a projekt célfájl nevét a menüben itt: Projekt -> Projekt beállítások!" +msgstr "A(z) \"%s\" célkönyvtár nem létezik.%sEllenőrizze a projekt célfájl nevét a menüben itt: Projekt -> Projekt beállításai!" #: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" @@ -15686,32 +15392,24 @@ msgid "The directory \"%s\" contains no project units any more. Remove this dire msgstr "" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit -#, fuzzy -#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" -msgstr "A(z) %s%s%s könyvtár többé nem szükséges a unit elérési útban.%sEltávolítja?" +msgstr "A(z) \"%s\" könyvtár többé nem szükséges a unit elérési útban.%sEltávolítja?" #: lazarusidestrconsts.listhedirectoryisnotwritable -#, fuzzy -#| msgid "The directory %s%s%s is not writable." msgid "The directory \"%s\" is not writable." -msgstr "A(z) %s%s%s nevű könyvtár nem írható." +msgstr "A(z) \"%s\" könyvtár nem írható." #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit -#, fuzzy -#| msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?" -msgstr "A(z) %s%s%s könyvtár még nem szerepel a unit elérési útban.%sHozzáadja?" +msgstr "A(z) \"%s\" könyvtár még nem szerepel a unit elérési útban.%sHozzáadja?" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." msgstr "A(z) %s könyvtár nem található." #: lazarusidestrconsts.listhefile -#, fuzzy -#| msgid "The file %s%s%s" msgid "The file \"%s\"" -msgstr "A(z) %s%s%s fájl" +msgstr "A(z) \"%s\" fájl" #: lazarusidestrconsts.listhefiledoesnotlooklikealpifile msgid "The file %s does not look like a lpi file." @@ -15722,14 +15420,12 @@ msgid "The file index is needed for functions like find declaration. While scann msgstr "" #: lazarusidestrconsts.listhefileisasymlinkopeninstead -#, fuzzy -#| msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?" -msgstr "A(z) %s%s%s fájl egy szimbolikus link.%s%sMegnyitja %s%s%s -t helyette?" +msgstr "A(z) \"%s\" fájl egy szimbolikus link.%sMegnyitja a(z) \"%s\"-t helyette?" #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" -msgstr "" +msgstr "A(z) \"%s\" fájl nem egy Lazarus projekt.%sÚj projekt létrehozása ehhez: \"%s\"?" #: lazarusidestrconsts.listhefilemaskisinvalid msgid "The file mask \"%s\" is invalid." @@ -15740,38 +15436,28 @@ msgid "The file mask \"%s\" is not a valid regular expression." msgstr "A fájlmaszk nem egy szabályos reguláris kifejezés: \"%s\"" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject -#, fuzzy -#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "A(z) %s%s%s%sfájl egy programnak tűnik. Bezárja a jelenlegi projektet és létrehoz egy új Lazarus projektet ehhez a programhoz?%sHa a \"Nem\"-et választja normál forrásként tölti be a fájlt." +msgstr "A(z) \"%s\" fájl egy programnak tűnik.%sBezárja a jelenlegi projektet és létrehoz egy új Lazarus projektet ehhez a programhoz?%sHa a \"Nem\"-et választja normál forrásként tölti be a fájlt." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing Lazarus Project." msgstr "A(z) %s fájl egy létező Lazarus projekt program fájljának tűnik." #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac -#, fuzzy -#| msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?" -msgstr "A(z) %s%s%s%sfájl a(z) %s csomag egyik forráskönyvtárában található és egy lefordított unit-nak látszik. A lefordított unit-oknak a csomag kimeneti könyvtárában kell lenniük, különben más csomagoknak problémái lehetnek ennek a csomagnak a használatával.%s%sTörli a megtévesztő fájlt?" +msgstr "A(z) \"%s\"%sfájl a(z) %s csomag egyik forráskönyvtárában található és egy lefordított unit-nak látszik. A lefordított unit-oknak a csomag kimeneti könyvtárában kell lenniük, különben más csomagoknak problémái lehetnek ennek a csomagnak a használatával.%sTörli a megtévesztő fájlt?" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself -#, fuzzy -#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" -msgstr "A(z) %s%s%s%sfájl nem található.%sMegkeresi kézzel?%s" +msgstr "A(z) \"%s\" fájl nem található.%sMegkeresi kézzel?" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject -#, fuzzy -#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "A(z) %s%s%s%sfájl nem található.%s\"Kihagyás\"-ra folytatja a projekt betöltését,%s\"Megszakítás\"-ra leállítja a betöltést." +msgstr "A(z) \"%s\" fájl nem található.%sA \"Kihagyás\" folytatja a projekt betöltését,%sA \"Megszakítás\" leállítja a betöltést." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth -#, fuzzy -#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" -msgstr "A következő, %s által használt metódusok nincsenek a forrásban%s%s%s%s%s%sEltávolítja a függő hivatkozásokat?" +msgstr "A következő, %s által használt metódusok nincsenek a forrásban%s%s%s%s%sEltávolítja a függő hivatkozásokat?" #: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect msgid "The FPC source directory \"%s\" does not look correct:%s%s" @@ -15779,29 +15465,23 @@ msgstr "Az FPC források könyvtára \"%s\" nem tűnik megfelelőnek:%s%s" #: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." -msgstr "" +msgstr "A Free Pascal fordító program neve általában \"%s\". Használható még célfüggő fordító is mint a(z) \"%s\". Meg kell adni a fájl teljes útvonalát." #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "Az azonosító egy unit. Használja a Fájl -> Mentés másként menüpontot unit átnevezéshez!" #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand -#, fuzzy -#| msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" msgid "The key %s%sis already assigned to %s.%sRemove the old assignment and assign the key to the new function%s%s?" -msgstr "A(z) %s%sbillentyű már hozzá van rendelve a(z) %s funkcióhoz.%s%sEltávolítja a régebbi hozzárendelést és hozzárendeli a billentyűt a(z) %s%s új funkcióhoz?" +msgstr "A(z) %s%sbillentyű már hozzá van rendelve a(z) %s funkcióhoz.%sEltávolítja a régebbi hozzárendelést és hozzárendeli a billentyűt a(z) %s%s új művelethez?" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists -#, fuzzy -#| msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." -msgstr "A(z) %s alkalmazás köteg,%sami a futtatáshoz szükséges, nem létezik vagy nem futtatható.%sLétre szeretne hozni egyet?%s%sEllenőrizze a Projekt -> Projekt beállítások -> Alkalmazás lapon." +msgstr "A(z) %s alkalmazásköteg,%sami a futtatáshoz szükséges, nem létezik vagy nem futtatható.%sLétre szeretne hozni egyet?%sEllenőrizze a Projekt -> Projekt beállításai -> Alkalmazás lapon." #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta -#, fuzzy -#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" -msgstr "A(z) %s%s%s%sfuttató alkalmazás nem létezik, vagy nem futtatható.%s%sEllenőrizze a Futtatás -> Futtatási paraméterek -> Helyi lapon." +msgstr "A(z) \"%s\"%sfuttató alkalmazás nem létezik, vagy nem futtatható.%sEllenőrizze a Futtatás -> Futtatási paraméterek -> Helyi lapon." #: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." @@ -15821,15 +15501,15 @@ msgstr "A(z) \"%s\" makró nem ezzel kezdődik: \"%s\"." #: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." -msgstr "" +msgstr "A \"make\" program neve általában \"%s\". Szükség van rá az IDE építéséhez. Meg kell adni a fájl teljes útvonalát." #: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd msgid "The new include file is not yet in the include search path.%sAdd directory %s?" -msgstr "" +msgstr "Az új include fájl nem az include keresési útvonalon található.%sA(z) %s könyvtár hozzáadása?" #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" -msgstr "" +msgstr "Az új unit nem a unit keresési útvonalon található.%sA(z) %s könyvtár hozzáadása?" #: lazarusidestrconsts.listheoldconfigurationwillbeupgraded msgid "The old configuration will be upgraded." @@ -15840,10 +15520,8 @@ msgid "The \"Other sources\" contains a directory which is already in the \"Othe msgstr "Az \"Egyéb források\" tartalmaz egy könyvtárat, mely már megtalálható az \"Egyéb unit fájlok\" között.%s%s" #: lazarusidestrconsts.listheoutputdirectoryismissing -#, fuzzy -#| msgid "The output directory %s%s%s is missing." msgid "The output directory \"%s\" is missing." -msgstr "A(z) %s%s%s kimeneti könyvtár hiányzik." +msgstr "A(z) \"%s\" kimeneti könyvtár hiányzik." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." @@ -15894,10 +15572,8 @@ msgid "The package %s can not be uninstalled, because it is needed by the IDE it msgstr "A(z) %s csomag nem távolítható el, mert szükséges az IDE működéséhez." #: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi -#, fuzzy -#| msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." -msgstr "A(z) %s csomagnak nincs \"Register\" eljárása, ami általában azt jelenti, hogy nem biztosít IDE bővítményt. Telepítése valószínűleg csak növeli az IDE méretét és bizonytalanná teszi a működését.%s%sJavaslat: Ha szükség van egy csomagra a projektben akkor a \"Hozzáadás a projekthez\" menüelem használandó." +msgstr "A(z) %s csomagnak nincs \"Register\" eljárása, ami általában azt jelenti, hogy nem biztosít IDE bővítményt. Telepítése valószínűleg csak növeli az IDE méretét és bizonytalanná teszi a működését.%sJavaslat: Ha szükség van egy csomagra a projektben akkor a \"Hozzáadás a projekthez\" menüelem használandó." #: lazarusidestrconsts.listhepackageisalreadyinthelist msgid "The package %s is already in the list" @@ -15912,10 +15588,8 @@ msgid "The path of \"make\" is not correct: \"%s\"" msgstr "A \"make\" útvonala helytelen: \"%s\"" #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla -#, fuzzy -#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s" msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." -msgstr "A %smake%s program nem található.%sEz az eszköz szükséges a Lazarus építéséhez.%s" +msgstr "A \"make\" program nem található.%sEz az eszköz szükséges a Lazarus építéséhez." #: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" @@ -15930,40 +15604,32 @@ msgid "The project has no main source file." msgstr "A projektnek nincs fő forrásfájlja." #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource -#, fuzzy -#| msgid "The project info file %s%s%s%sis equal to the project main source file!" msgid "The project info file \"%s\"%sis equal to the project main source file!" -msgstr "A(z) %s%s%s projekt információs fájl%smegegyezik a projekt fő forrás fájljával!" +msgstr "A projekt információs fájl \"%s\"%smegegyezik a projekt fő forrás fájljával!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk -#, fuzzy -#| msgid "The project information file %s%s%s%shas changed on disk." msgid "The project information file \"%s\"%shas changed on disk." -msgstr "A projekt információs fájlja megváltozott a lemezen:%s%s%s%s" +msgstr "A projekt információs fájlja \"%s\"%smegváltozott a lemezen." #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" msgstr "Építés előtt menteni kell a projektet.%sHa a Teszt könyvtár be van állítva az IDE beállításai között%sakkor a létrehozott projektek azonnal építhetők.%sProjekt mentése?" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar -#, fuzzy -#| msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." -msgstr "A projekt a(z) %s cél OS-t és %s cél CPU-t használ.%sA system.ppu ehhez a célhoz nem található az FPC bináris könyvtáraiban. %sGyőződjön meg róla, hogy az FPC megfelelően lett telepítve ehhez a célhoz, és az fpc.cfg a helyes könyvtárakat tartalmazza." +msgstr "A projekt %s cél OS-t és %s cél CPU-t használ.%sA system.ppu ehhez a célhoz nem található az FPC bináris könyvtáraiban.%sGyőződjön meg róla, hogy az FPC megfelelően lett telepítve ehhez a célhoz, és az fpc.cfg a helyes könyvtárakat tartalmazza." #: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea msgid "The project uses the new FPC resources, which requires at least FPC 2.4" -msgstr "" +msgstr "A projekt az FPC erőforrásait használja, amihez legalább FPC 2.4 szükséges" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "Más fájlok is vannak a könyvtárban ugyanezzel a névvel,%samelyek csak betűméretben térnek el:%s%s%sTörli őket?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension -#, fuzzy -#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" -msgstr "Van egy fájl ugyanilyen névvel és hasonló kiterjesztéssel a meghajtón%sFájl: %s%sMegtévesztő fájl: %s%s%sTörli a megtévesztő fájlt?" +msgstr "Van egy fájl ugyanilyen névvel és hasonló kiterjesztéssel a meghajtón%sFájl: %s%sMegtévesztő fájl: %s%sTörli a megtévesztő fájlt?" #: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname msgid "There is already a build mode with this name." @@ -15979,23 +15645,19 @@ msgstr "Már létezik egy komponens ezzel a névvel" #: lazarusidestrconsts.listhereisalreadyafilein msgid "There is already a file%s%s%sin %s" -msgstr "" +msgstr "Már van egy %s%s%s fájl ebben: %s" #: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" -msgstr "" +msgstr "Már van egy \"%s\" fájl ebben: %s%sRégi: %s%sÚj: %s%s%sFolytatás?" #: lazarusidestrconsts.listhereisalreadyaformwiththename -#, fuzzy -#| msgid "There is already a form with the name %s%s%s" msgid "There is already a form with the name \"%s\"" -msgstr "Már létezik egy form %s%s%s névvel" +msgstr "Már létezik egy form \"%s\" névvel." #: lazarusidestrconsts.listhereisalreadyamacrowiththename -#, fuzzy -#| msgid "There is already a macro with the name %s%s%s." msgid "There is already a macro with the name \"%s\"." -msgstr "Már létezik egy makró %s%s%s névvel" +msgstr "Már létezik egy makró \"%s\" névvel." #: lazarusidestrconsts.listhereisalreadyanidemacrowiththename msgid "There is already an IDE macro with the name \"%s\"" @@ -16010,30 +15672,24 @@ msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make msgstr "" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus -#, fuzzy -#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." -msgstr "Már létezik %s%s%s nevű unit. A Pascal azonosítóknak egyedinek kell lenniük." +msgstr "Már létezik \"%s\" nevű unit. A Pascal azonosítóknak egyedinek kell lenniük." #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose -#, fuzzy -#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" -msgstr "Létezik %s%s%s nevű unit a projektben.%sVálasszon egy eltérő nevet!" +msgstr "Létezik \"%s\" nevű unit a projektben.%sVálasszon egy eltérő nevet!" #: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." -msgstr "" +msgstr "Nincs fpc.exe a(z) %s könyvtárában. Általában a make program együtt van telepítve az FPC fordítóval." #: lazarusidestrconsts.listheremustbeatleastonebuildmode msgid "There must be at least one build mode." msgstr "Legalább egy építési módnak lennie kell." #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor -#, fuzzy -#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." -msgstr "A(z) %s%s%s osztály leszármazottja ennek: %s%s%s. Lehetséges, hogy ez csak a TForm elgépelése." +msgstr "A(z) \"%s\" osztály leszármazottja ennek: \"%s\". Lehetséges, hogy ez csak a TForm elgépelése." #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" @@ -16069,19 +15725,15 @@ msgstr "" #: lazarusidestrconsts.listhetargetisnotwritable msgid "The target %s is not writable." -msgstr "" +msgstr "A(z) %s cél nem írható." #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt -#, fuzzy -#| msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)" msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" -msgstr "A teszt könyvtár nem található:%s%s%s%s%s(Lásd az IDE beállításait)" +msgstr "A teszt könyvtár nem található:%s\"%s\"%s(Lásd az IDE beállításait)" #: lazarusidestrconsts.listheunitalreadyexists -#, fuzzy -#| msgid "The unit %s%s%s already exists." msgid "The unit \"%s\" already exists." -msgstr "A(z) %s%s%s unit már létezik" +msgstr "A(z) \"%s\" unit már létezik." #: lazarusidestrconsts.listheunitbelongstopackage msgid "The unit belongs to package %s." @@ -16096,10 +15748,8 @@ msgid "The unit has this name" msgstr "A unit-nak ez a neve" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler -#, fuzzy -#| msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" -msgstr "A(z) %s%s%s unit fájlneve nem kisbetűs.%sA Free Pascal fordító nem keres minden betűmérettel. Ajánlott csak kisbetűk használata a fájlnévben.%s%sÁtnevezi kisbetűsre?" +msgstr "A(z) \"%s\" unit fájlneve nem kisbetűs.%sA Free Pascal fordító nem keres minden betűmérettel. Ajánlott csak kisbetűk használata a fájlnévben.%sÁtnevezi kisbetűsre?" #: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." @@ -16110,22 +15760,16 @@ msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "A(z) %s unit-ot más fájlok is használjak.%sFrissíti a hivatkozásokat automatikusan?" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus -#, fuzzy -#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." -msgstr "A unit-nak magának már ez a neve: %s%s%s. A Pascal azonosítóknak egyedinek kell lenniük." +msgstr "A unit-nak magának már ez a neve: \"%s\". A Pascal azonosítóknak egyedinek kell lenniük." #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac -#, fuzzy -#| msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" -msgstr "A(z) %s%s%s unit keresési útvonala tartalmazza a(z) %s%s%s könyvtárat, ami a(z) %s csomag forrás könyvtára" +msgstr "A(z) \"%s\" unit keresési útvonala tartalmazza a(z) \"%s\" könyvtárat, ami a(z) %s csomag forrás könyvtára" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki -#, fuzzy -#| msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." -msgstr "A(z) %s%s%s munkakönyvtár nem létezik.%sEllenőrizze a munkakönyvtárat a menüben itt: Futtatás -> Futtatási paraméterek!" +msgstr "A(z) \"%s\" munkakönyvtár nem létezik.%sEllenőrizze a munkakönyvtárat a menüben itt: Futtatás -> Futtatási paraméterek!" #: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename msgid "This component already contains a class with the name %s." @@ -16165,7 +15809,7 @@ msgstr "Ez körkörös függést hoz létre." #: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" -msgstr "" +msgstr "Ez sok szöveget (%s) tesz a vágólapra.%sFolytatás?" #: lazarusidestrconsts.listhreads msgctxt "lazarusidestrconsts.listhreads" @@ -16263,27 +15907,27 @@ msgstr "Teljes/Részleges elérési út megjelenítésének átkapcsolása fájl #: lazarusidestrconsts.listoolhasnoexecutable msgid "tool \"%s\" has no executable" -msgstr "" +msgstr "a(z) \"%s\" eszköz nem tartalmaz futtatható állományt" #: lazarusidestrconsts.listoolheaderfailed msgid "Tool Header: Failed" -msgstr "" +msgstr "Eszköz-fejléc: Sikertelen" #: lazarusidestrconsts.listoolheaderrunning msgid "Tool Header: Running" -msgstr "" +msgstr "Eszköz-fejléc: Fut" #: lazarusidestrconsts.listoolheaderscrolledup msgid "Tool Header: Scrolled up" -msgstr "" +msgstr "Eszköz-fejléc: Felgördítve" #: lazarusidestrconsts.listoolheadersuccess msgid "Tool Header: Success" -msgstr "" +msgstr "Eszköz-fejléc: Sikerült" #: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo msgid "tool stopped with exit code %s. Use context menu to get more information." -msgstr "" +msgstr "az eszköz kilépési kóddal állt le: %s. A helyi menüből további információ érhető el." #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" @@ -16311,7 +15955,7 @@ msgstr "Felső oldali távolságok egyenlően" #: lazarusidestrconsts.listranslatetheenglishmessages msgid "Translate the English Messages" -msgstr "" +msgstr "Az angol üzenetek lefordítása" #: lazarusidestrconsts.listreeneedsrefresh msgid "Tree needs refresh" @@ -16323,7 +15967,7 @@ msgstr "Turbo Pascal" #: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" -msgstr "" +msgstr "Két áthelyezett fájlnak ugyanaz lesz a neve:%s%s%s%s%sitt: %s" #: lazarusidestrconsts.listypes msgid "Types (not removed if no replacement)" @@ -16474,10 +16118,8 @@ msgid "Not found" msgstr "Nem található" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith -#, fuzzy -#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" -msgstr "Kicseréli a(z) %s%s%s%s találatot ezzel: %s%s%s?" +msgstr "Kicseréli a(z) \"%s\" ezen előfordulását%s erre: \"%s\"?" #: lazarusidestrconsts.lisuesearching msgid "Searching: %s" @@ -16497,7 +16139,7 @@ msgstr "A keresett '%s' nem található!" #: lazarusidestrconsts.lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." -msgstr "" +msgstr "A szerkesztő jelenlegi betűkészlete nem támogatja az UTF-8 kódolást, azonban úgy tűnik a rendszer azt használja.%sEz azt jelenti, hogy a nem ASCII karakterek valószínűleg helytelenül jelennek majd meg.%sA szerkesztő beállításai között másik betűkészlet választható." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" @@ -16508,9 +16150,8 @@ msgid "%s bytes" msgstr "%s byte" #: lazarusidestrconsts.lisuidincludedby -#, fuzzy msgid "Included by:" -msgstr "Mellékelte:" +msgstr "Használat ebben:" #: lazarusidestrconsts.lisuidinproject msgid "in Project:" @@ -16560,34 +16201,28 @@ msgid "Unable copy components to clipboard" msgstr "Komponensek vágólapra másolása nem lehetséges" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile -#, fuzzy -#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." -msgstr "Forrás fejléc megjegyzés hozzáadása nem lehetséges a(z) %s%s%s%s forrás fájlhoz.%sTalán szintaktikai hiba." +msgstr "Erőforrás fejléc megjegyzés hozzáadása nem lehetséges a(z) %s\"%s\" erőforrás fájlhoz.%sTalán szintaktikai hiba." #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably -#, fuzzy -#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." -msgstr "Nem lehetséges forrás T%s:FORMDATA hozzáadása a(z) %s%s%s%s forrás fájlhoz.%sTalán szintaktikai hiba." +msgstr "A T%s:FORMDATA erőforrás nem adható hozzá a(z) %s\"%s\" erőforrás fájlhoz.%sTalán szintaktikai hiba." #: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread msgid "Unable to add the dependency %s, because the package %s has already a dependency %s" -msgstr "" +msgstr "Nem lehet hozzáadni a(z) %s függőséget, mert a(z) %s csomag már függ ettől: %s" #: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s" -msgstr "" +msgstr "Nem lehet hozzáadni a(z) %s függőséget, mert ez körkörös függőséget okozna. Függőség: %s" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "Nem lehetséges %s hozzáadása a projekthez, mert már van egy ilyen nevű unit a projektben." #: lazarusidestrconsts.lisunabletobackupfileto -#, fuzzy -#| msgid "Unable to backup file %s%s%s to %s%s%s!" msgid "Unable to backup file \"%s\" to \"%s\"!" -msgstr "Nem lehetséges biztonsági mentés készítése a(z) %s%s%s fájlról %s%s%s -ként!" +msgstr "Nem készíthető biztonsági mentés erről: \"%s\" ide: \"%s\"!" #: lazarusidestrconsts.lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" @@ -16602,70 +16237,52 @@ msgid "Unable to clean up destination directory" msgstr "Cél könyvtár tisztítása nem lehetséges" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions -#, fuzzy -#| msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgid "Unable to clean up \"%s\".%sPlease check permissions." -msgstr "A(z) %s%s%s tisztítása nem lehetséges.%sEllenőrizze a jogosultságokat!" +msgstr "A(z) \"%s\" nem tisztítható.%sEllenőrizze a jogosultságokat!" #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "A komponens szövegének %s%s bináris formátumra való konvertálása nem lehetséges." #: lazarusidestrconsts.lisunabletoconvertfileerror -#, fuzzy -#| msgid "Unable to convert file %s%s%s%sError: %s" msgid "Unable to convert file \"%s\"%sError: %s" -msgstr "A(z) %s%s%s fájl konvertálása nem lehetséges%sHiba: %s" +msgstr "A fájl nem konvertálható: \"%s\"%sHiba: %s" #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream -#, fuzzy -#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" -msgstr "A(z) %s%s%s%s fájl szövegadatának konvertálása%sbináris adatfolyamra nem lehetséges. (%s)" +msgstr "A fájl szövegadata nem konvertálható bináris adatfolyammá:%s\"%s\"%s(%s)" #: lazarusidestrconsts.lisunabletocopyfile msgid "Unable to copy file" msgstr "Fájl másolása nem lehetséges" #: lazarusidestrconsts.lisunabletocopyfileto -#, fuzzy -#| msgid "Unable to copy file %s%s%s%sto %s%s%s" msgid "Unable to copy file \"%s\"%sto \"%s\"" -msgstr "A fájl nem másolható innen: %s%s%s%s ide: %s%s%s" +msgstr "A fájl nem másolható innen: \"%s\"%side: \"%s\"" #: lazarusidestrconsts.lisunabletocreatebackupdirectory -#, fuzzy -#| msgid "Unable to create backup directory %s%s%s." msgid "Unable to create backup directory \"%s\"." -msgstr "A(z) %s%s%s biztonsági mentés könyvtár létrehozása nem lehetséges." +msgstr "A biztonsági mentés könyvtára nem hozható létre: \"%s\"." #: lazarusidestrconsts.lisunabletocreatedirectory -#, fuzzy -#| msgid "Unable to create directory %s%s%s." msgid "Unable to create directory \"%s\"." -msgstr "A(z) %s%s%s könyvtár létrehozása nem lehetséges." +msgstr "A könyvtár nem hozható létre: \"%s\"." #: lazarusidestrconsts.lisunabletocreatefile msgid "Unable to create file" msgstr "Fájl létrehozása nem lehetséges" #: lazarusidestrconsts.lisunabletocreatefile2 -#, fuzzy -#| msgid "Unable to create file %s%s%s" msgid "Unable to create file \"%s\"" -msgstr "A(z) %s%s%s fájl létrehozása nem lehetséges" +msgstr "A fájl nem hozható létre: \"%s\"" #: lazarusidestrconsts.lisunabletocreatefile3 -#, fuzzy -#| msgid "Unable to create file%s%s%s%s" msgid "Unable to create file%s\"%s\"" -msgstr "A(z) %s%s%s%s fájl létrehozása nem lehetséges" +msgstr "A fájl nem hozható létre:%s\"%s\"" #: lazarusidestrconsts.lisunabletocreatelinkwithtarget -#, fuzzy -#| msgid "Unable to create link %s%s%s with target %s%s%s" msgid "Unable to create link \"%s\" with target \"%s\"" -msgstr "Nem lehetséges %s%s%s hivatkozás létrehozása %s%s%s céllal" +msgstr "A(z) \"%s\" hivatkozás nem hozható létre erre: \"%s\"" #: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto msgid "Unable to create new file, because there is already a directory with this name." @@ -16684,30 +16301,24 @@ msgid "Unable to delete" msgstr "Nem törölhető" #: lazarusidestrconsts.lisunabletodeleteambiguousfile -#, fuzzy -#| msgid "Unable to delete ambiguous file %s%s%s" msgid "Unable to delete ambiguous file \"%s\"" -msgstr "A(z) %s%s%s megtévesztő fájl törlése nem lehetséges" +msgstr "A megtévesztő fájl nem törölhető: \"%s\"" #: lazarusidestrconsts.lisunabletoexecute msgid "unable to execute: %s" -msgstr "" +msgstr "nem futtatható: %s" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "Nem található ResourceString rész ebben, vagy bármelyik használt unit-ban." #: lazarusidestrconsts.lisunabletofindavalidclassnamein -#, fuzzy -#| msgid "Unable to find a valid classname in %s%s%s" msgid "Unable to find a valid classname in \"%s\"" -msgstr "Nem található érvényes osztálynév ebben: %s%s%s" +msgstr "Nem található érvényes osztálynév ebben: \"%s\"" #: lazarusidestrconsts.lisunabletofindfile -#, fuzzy -#| msgid "Unable to find file %s%s%s." msgid "Unable to find file \"%s\"." -msgstr "A(z) %s%s%s fájl nem található." +msgstr "A fájl nem található: \"%s\"." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" @@ -16722,14 +16333,12 @@ msgid "Unable to find method." msgstr "A metódus nem található." #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile -#, fuzzy -#| msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s" msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" -msgstr "Nem található pascal unit (.pas,.pp) az lfm fájlhoz: %s%s%s%s" +msgstr "Nem található pascal unit (.pas, .pp) az .lfm fájlhoz: %s\"%s\"" #: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" -msgstr "" +msgstr "Nem található a komponensosztály: \"%s\".%sNem let regisztrálva a RegisterClass által és nem található lfm fájl sem.%sA következő unit igényli:%s%s" #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." @@ -16748,16 +16357,12 @@ msgid "unable to load file %s: %s" msgstr "Nem tölthető be a fájl %s: %s" #: lazarusidestrconsts.lisunabletoloadpackage -#, fuzzy -#| msgid "Unable to load package %s%s%s" msgid "Unable to load package \"%s\"" -msgstr "A(z) %s%s%s csomag betöltése nem lehetséges" +msgstr "A csomag nem tölthető be: \"%s\"" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits -#, fuzzy -#| msgid "Unable to load the component class %s%s%s, because it depends on itself." msgid "Unable to load the component class \"%s\", because it depends on itself." -msgstr "A(z) %s%s%s komponens osztály betöltése nem lehetséges, mert saját magától függ." +msgstr "A(z) \"%s\" komponens osztály betöltése nem lehetséges, mert saját magától függ." #: lazarusidestrconsts.lisunabletoopen msgid "Unable to open \"%s\"" @@ -16780,16 +16385,12 @@ msgid "Unable to read file" msgstr "Fájl olvasása nem lehetséges" #: lazarusidestrconsts.lisunabletoreadfile2 -#, fuzzy -#| msgid "Unable to read file %s%s%s!" msgid "Unable to read file \"%s\"." -msgstr "A(z) %s%s%s fájl olvasása nem lehetséges!" +msgstr "Nem olvasható a fájl: \"%s\"." #: lazarusidestrconsts.lisunabletoreadfileerror -#, fuzzy -#| msgid "Unable to read file %s%s%s%sError: %s" msgid "Unable to read file \"%s\"%sError: %s" -msgstr "A(z) %s%s%s fájl olvasása nem lehetséges%sHiba: %s" +msgstr "Nem olvasható a fájl: \"%s\"%sHiba: %s" #: lazarusidestrconsts.lisunabletoreadlpi msgid "Unable to read lpi" @@ -16797,46 +16398,36 @@ msgstr "Nem olvasható az lpi" #: lazarusidestrconsts.lisunabletoreadprocessexitstatus msgid "unable to read process ExitStatus" -msgstr "" +msgstr "Nem olvasható a folyamat kilépési állapota (ExitStatus)" #: lazarusidestrconsts.lisunabletoreadtheprojectinfofile -#, fuzzy -#| msgid "Unable to read the project info file%s%s%s%s." msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile" msgid "Unable to read the project info file%s\"%s\"." -msgstr "Nem olvasható a projekt infó fájlja:%s%s%s%s." +msgstr "Nem olvasható a projekt infó fájlja:%s\"%s\"." #: lazarusidestrconsts.lisunabletoremoveoldbackupfile -#, fuzzy -#| msgid "Unable to remove old backup file %s%s%s!" msgid "Unable to remove old backup file \"%s\"!" -msgstr "A(z) %s%s%s régi biztonsági mentés fájl törlése nem lehetséges!" +msgstr "Nem törölhető a régi biztonsági mentés fájl: \"%s\"!" #: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource msgid "Unable to remove project title from source.%s%s" msgstr "Nem lehet eltávolítani a projekt címét a forrásból.%s%s" #: lazarusidestrconsts.lisunabletorenameambiguousfileto -#, fuzzy -#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" -msgstr "A(z) %s%s%s megtévesztő fájl átnevezése nem lehetséges%serre: %s%s%s" +msgstr "A megtévesztő fájl nem nevezhető át erről: \"%s\"%serre: \"%s\"" #: lazarusidestrconsts.lisunabletorenamefile msgid "Unable to rename file" msgstr "Fájl átnevezése nem lehetséges" #: lazarusidestrconsts.lisunabletorenamefileto -#, fuzzy -#| msgid "Unable to rename file %s%s%s to %s%s%s!" msgid "Unable to rename file \"%s\" to \"%s\"!" -msgstr "A(z) %s%s%s fájl átnevezése erre: %s%s%s nem lehetséges!" +msgstr "A fájl nem nevethető át erről: \"%s\" erre: \"%s\"!" #: lazarusidestrconsts.lisunabletorenamefileto2 -#, fuzzy -#| msgid "Unable to rename file %s%s%s%sto %s%s%s." msgid "Unable to rename file \"%s\"%sto \"%s\"." -msgstr "A(z) %s%s%s fájl%sátnevezése erre: %s%s%s nem lehetséges." +msgstr "A fájl nem nevethető át erről: \"%s\"%serre: \"%s\"." #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." @@ -16883,10 +16474,8 @@ msgid "Unable to update CreateForm statement in project source" msgstr "A CreateForm állomány frissítése nem lehetséges a projekt forrásban" #: lazarusidestrconsts.lisunabletowrite2 -#, fuzzy -#| msgid "Unable to write %s%s%s" msgid "Unable to write \"%s\"" -msgstr "Nem írható: %s%s%s" +msgstr "Nem írható: \"%s\"" #: lazarusidestrconsts.lisunabletowritefile msgid "Unable to write file" @@ -16894,19 +16483,15 @@ msgstr "Nem írható a fájl" #: lazarusidestrconsts.lisunabletowritefile2 msgid "Unable to write file \"%s\"." -msgstr "" +msgstr "Nem írható a fájl: \"%s\"." #: lazarusidestrconsts.lisunabletowritefileerror -#, fuzzy -#| msgid "Unable to write file %s%s%s%sError: %s" msgid "Unable to write file \"%s\"%sError: %s" -msgstr "Nem írható a fájl: %s%s%s%sHiba: %s" +msgstr "Nem írható a fájl: \"%s\"%sHiba: %s" #: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror -#, fuzzy -#| msgid "Unable to write the project info file%s%s%s%s.%sError: %s" msgid "Unable to write the project info file%s\"%s\".%sError: %s" -msgstr "Nem írható a projekt infó fájlja:%s%s%s%s.%sHiba: %s" +msgstr "Nem írható a projekt infó fájlja:%s\"%s\".%sHiba: %s" #: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror msgid "Unable to write the project session file%s\"%s\".%sError: %s" @@ -16942,20 +16527,16 @@ msgid "Uninstall selection" msgstr "Kijelölés eltávolítása" #: lazarusidestrconsts.lisunithaschangedsave -#, fuzzy -#| msgid "Unit %s%s%s has changed. Save?" msgid "Unit \"%s\" has changed. Save?" -msgstr "A(z) %s%s%s unit megváltozott. Elmenti?" +msgstr "A(z) \"%s\" unit megváltozott. Mentés?" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "Unit azonosító létezik" #: lazarusidestrconsts.lisunitinpackage -#, fuzzy -#| msgid "%s unit %s in package %s%s" msgid "%s unit %s in package %s" -msgstr "%s unit %s a(z)%s%s csomagban" +msgstr "%s unit %s a(z) %s csomagban" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" @@ -16971,11 +16552,11 @@ msgstr "Unit név tartalmazza ..." #: lazarusidestrconsts.lisunitnotfound msgid "unit %s not found" -msgstr "" +msgstr "a(z) %s unit nem található" #: lazarusidestrconsts.lisunitnotfoundatnewposition msgid "unit %s not found at new position \"%s\"" -msgstr "" +msgstr "a %s unit nem található az új helyen: \"%s\"" #: lazarusidestrconsts.lisunitnotfoundinproject msgid "A unit not found in project %s" @@ -16995,7 +16576,7 @@ msgstr "Unit útvonalak" #: lazarusidestrconsts.lisunitrequirespackage msgid "unit %s requires package %s" -msgstr "" +msgstr "a(z) %s unit igényli a(z) %s csomagot" #: lazarusidestrconsts.lisunitsnotfoundinproject msgid "Units not found in project %s" @@ -17011,7 +16592,7 @@ msgstr "%s nem használt unit-jai" #: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." -msgstr "" +msgstr "Szokásos fordító-fájlnév. Általában így kezdődik: fpc, ppc vagy ppcross" #: lazarusidestrconsts.lisup msgctxt "lazarusidestrconsts.lisup" @@ -17024,7 +16605,7 @@ msgstr "Infó frissítése" #: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha msgid "Update other procedure signatures when only letter case has changed" -msgstr "" +msgstr "Csak betűméret változása esetén frissítse az eljárás többi begépelését" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" @@ -17065,7 +16646,7 @@ msgstr "Megjegyzések használata az egyéni beállításoknál" #: lazarusidestrconsts.lisusedby msgid " used by %s" -msgstr "" +msgstr ", melyet a(z) %s használ" #: lazarusidestrconsts.lisusedesigntimepackages msgid "Use design time packages" @@ -17126,7 +16707,7 @@ msgstr "Eltávolítás a listából: %s" #: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle msgid "Toggle on list \"%s\"" -msgstr "" +msgstr "Váltás a listán: \"%s\"" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" @@ -17174,7 +16755,7 @@ msgstr "Változó" #: lazarusidestrconsts.lisverbose msgid "Verbose" -msgstr "" +msgstr "Fecsegés" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" @@ -17182,7 +16763,7 @@ msgstr "Metódus hívások ellenőrzése" #: lazarusidestrconsts.lisversion msgid "Version" -msgstr "Verzió" +msgstr "Változat" #: lazarusidestrconsts.lisversionmismatch msgid "Version mismatch" @@ -17198,7 +16779,7 @@ msgstr "Változat információ másolása a vágólapra" #: lazarusidestrconsts.lisveryverbose msgid "Very Verbose" -msgstr "" +msgstr "Nagyon részletes" #: lazarusidestrconsts.lisviewbreakpointproperties msgctxt "lazarusidestrconsts.lisviewbreakpointproperties" @@ -17223,14 +16804,12 @@ msgid "Warning: " msgstr "Figyelmeztetés:" #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis -#, fuzzy -#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\"" -msgstr "Figyelem: ellentmondásos fájl található: %s%s%s. A forrás fájl: %s%s%s" +msgstr "Figyelem: ellentmondásos fájl található: \"%s\". A forrás fájl: \"%s\"" #: lazarusidestrconsts.liswarnings msgid ", Warnings:%s" -msgstr "" +msgstr ", Figyelmeztetések:%s" #: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." @@ -17294,10 +16873,8 @@ msgid "Welcome to Lazarus IDE %s" msgstr "Üdvözli a Lazarus IDE %s" #: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve -#, fuzzy -#| msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s" msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" -msgstr "Üdvözöljük! Ez a Lazarus %s%s%s Létezik már egy beállítás a(z) %s változathoz itt: %s%s%s" +msgstr "Üdvözöljük! Ez a Lazarus %s%sLétezik már egy beállítás a(z) %s változathoz itt: %s%s" #: lazarusidestrconsts.liswhatneedsbuilding msgid "What needs building" @@ -17313,19 +16890,19 @@ msgstr "" #: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein msgid "When the source editor cursor moves, show the current node in the code explorer" -msgstr "" +msgstr "Amikor a kurzor mozog a forráskód-szerkesztőben, az aktuális csomópont jelenjen meg a kódböngészőben" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedform msgid "Window menu shows designed form's name instead of caption" -msgstr "" +msgstr "Az Ablak menü a tervezett form nevét jeleníti meg a címe helyett" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint msgid "Useful especially if the caption is left empty." -msgstr "" +msgstr "Különösen hasznos ha a cím üresen maradt." #: lazarusidestrconsts.liswindowstaysontop msgid "Window stays on top" -msgstr "" +msgstr "Az ablak legfelül marad" #: lazarusidestrconsts.liswithincludes2 msgid ", with includes " @@ -17333,23 +16910,23 @@ msgstr "" #: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw msgid "Without a proper compiler the code browsing and compiling will be disappointing." -msgstr "" +msgstr "Megfelelő fordító nélkül a kód böngészése és a fordítás csalódást fog okozni." #: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing msgid "Without a proper debugger, debugging will be disappointing." -msgstr "" +msgstr "Megfelelő hibakereső nélkül a hibakeresés csalódást fog okozni." #: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn msgid "Without a proper Lazarus directory you will get a lot of warnings." -msgstr "" +msgstr "A megfelelő Lazarus könyvtár nélkül rengeteg figyelmeztetés jelenik majd meg." #: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." -msgstr "" +msgstr "Megfelelő \"make\" program nélkül az IDE fordítása nem lehetséges." #: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio msgid "Without the proper FPC sources code browsing and completion will be very limited." -msgstr "" +msgstr "A megfelelő FPC forráskódok nélkül a kód böngészése és kiegészítése erősen korlátozott lesz. " #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" @@ -17433,7 +17010,7 @@ msgstr "" #: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" -msgstr "" +msgstr "Az FPC és az FPC forráskódjai letölthetők innen: http://sourceforge.net/projects/lazarus/?source=directory" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You cannot build Lazarus while debugging or compiling." @@ -17491,9 +17068,8 @@ msgid "Display type for selected Registers" msgstr "" #: lazarusidestrconsts.regdlgformat -#, fuzzy msgid "Format" -msgstr "Formátum" +msgstr "" #: lazarusidestrconsts.regdlghex msgid "Hex" @@ -17709,7 +17285,7 @@ msgstr "Litván" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" -msgstr "Nyelvbeállítások" +msgstr "Nyelvi beállítások" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" @@ -17798,7 +17374,7 @@ msgstr "Új keresés indítása" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" -msgstr "Verzió számozás" +msgstr "Változatszámozás" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" @@ -17911,14 +17487,12 @@ msgid "Abstract Methods ..." msgstr "Absztrakt metódusok ..." #: lazarusidestrconsts.srkmecaddbpaddress -#, fuzzy msgid "add address breakpoint" -msgstr "Cím-töréspont hozzáadása" +msgstr "cím-töréspont hozzáadása" #: lazarusidestrconsts.srkmecaddbpsource -#, fuzzy msgid "add source breakpoint" -msgstr "Forráskód-töréspont hozzáadása" +msgstr "forráskód-töréspont hozzáadása" #: lazarusidestrconsts.srkmecaddbpwatchpoint msgid "add data/watchpoint" @@ -18346,7 +17920,7 @@ msgstr "GPL megjegyzés beszúrása" #: lazarusidestrconsts.srkmecinsertgplnoticetranslated msgid "Insert GPL notice (translated)" -msgstr "" +msgstr "GPL megjegyzés beszúrása (lefordítva)" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" @@ -18358,7 +17932,7 @@ msgstr "LGPL megjegyzés beszúrása" #: lazarusidestrconsts.srkmecinsertlgplnoticetranlated msgid "Insert LGPL notice (translated)" -msgstr "" +msgstr "LGPL megjegyzés beszúrása (lefordítva)" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" @@ -18370,7 +17944,7 @@ msgstr "MIT megjegyzés beszúrása" #: lazarusidestrconsts.srkmecinsertmitnoticetranslated msgid "Insert MIT notice (translated)" -msgstr "" +msgstr "MIT megjegyzés beszúrása (lefordítva)" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" @@ -18382,7 +17956,7 @@ msgstr "Módosított LGPL megjegyzés beszúrása" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated msgid "Insert modified LGPL notice (translated)" -msgstr "" +msgstr "Módosított LGPL megjegyzés beszúrása (lefordítva)" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" @@ -18625,8 +18199,9 @@ msgid "Select to absolute beginning" msgstr "Kijelölés a legelejéig" #: lazarusidestrconsts.srkmecselgotoxy +#, fuzzy msgid "Select Goto XY" -msgstr "" +msgstr "Pozíció kijelölése" #: lazarusidestrconsts.srkmecselhalfwordleft msgid "Select half-word left" @@ -18923,11 +18498,11 @@ msgstr "Hívási verem megjelenítése" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" -msgstr "Kódböngésző megjelenítése" +msgstr "Kódtallózó megjelenítése" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" -msgstr "Kódtallózó megjelenítése" +msgstr "Kódböngésző megjelenítése" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" @@ -19177,7 +18752,7 @@ msgstr "Zárolva" #: lazarusidestrconsts.uemacrorecording msgid "Recording" -msgstr "Felvétel" +msgstr "Rögzítés" #: lazarusidestrconsts.uemacrorecordingpaused msgid "Rec-pause" @@ -19373,5 +18948,5 @@ msgstr "Csak olvasható" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" -msgstr "Verzió információk" +msgstr "Változatinformációk" diff --git a/lcl/languages/lclstrconsts.hu.po b/lcl/languages/lclstrconsts.hu.po index c3a69a57a6..49d3040d4b 100644 --- a/lcl/languages/lclstrconsts.hu.po +++ b/lcl/languages/lclstrconsts.hu.po @@ -5,29 +5,26 @@ msgstr "" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" +"Language: hu\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: Poedit 1.5.4\n" -"Language: hu\n" #: lclstrconsts.hhshelpbrowsernotexecutable -#, fuzzy #| msgid "Browser %s%s%s not executable." msgid "Browser \"%s\" not executable." -msgstr "A böngésző nem végrehajtható: %s%s%s" +msgstr "A böngésző nem végrehajtható: \"%s\"" #: lclstrconsts.hhshelpbrowsernotfound -#, fuzzy #| msgid "Browser %s%s%s not found." msgid "Browser \"%s\" not found." -msgstr "A böngésző nem található: %s%s%s" +msgstr "A böngésző nem található: \"%s\"" #: lclstrconsts.hhshelperrorwhileexecuting -#, fuzzy #| msgid "Error while executing %s%s%s:%s%s" msgid "Error while executing \"%s\":%s%s" -msgstr "Hiba a végrehajtás közben: %s%s%s:%s%s" +msgstr "Hiba a végrehajtás közben: \"%s\":%s%s" #: lclstrconsts.hhshelpnohtmlbrowserfound msgid "Unable to find a HTML browser." @@ -38,10 +35,9 @@ msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help -> msgstr "Nincs HTML böngésző. %s Meg kell adni egyet: Eszközök -> Beállítások -> Súgó -> Súgó beállítások" #: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile -#, fuzzy #| msgid "The help database %s%s%s was unable to find file %s%s%s." msgid "The help database \"%s\" was unable to find file \"%s\"." -msgstr "A(z) %s%s%s súgóadatbázishoz hiányzik a %s%s%s fájl." +msgstr "A(z) \"%s\" súgóadatbázishoz hiányzik a \"%s\" fájl." #: lclstrconsts.hhshelpthemacrosinbrowserparamswillbereplacedbytheurl msgid "The macro %s in BrowserParams will be replaced by the URL." @@ -60,9 +56,8 @@ msgid "Accept" msgstr "Elfogadás" #: lclstrconsts.ifsvk_apps -#, fuzzy msgid "application key" -msgstr "Alkalmazás gomb" +msgstr "Alkalmazás billentyű" #: lclstrconsts.ifsvk_back msgid "Backspace" @@ -159,7 +154,7 @@ msgstr "Balra" #: lclstrconsts.ifsvk_lwin msgid "left windows key" -msgstr "bal windows gomb" +msgstr "bal windows billentyű" #: lclstrconsts.ifsvk_mbutton msgid "Mouse Button Middle" @@ -198,7 +193,7 @@ msgstr "Numpad %d" #: lclstrconsts.ifsvk_pause msgid "Pause key" -msgstr "Pause gomb" +msgstr "Pause billentyű" #: lclstrconsts.ifsvk_print msgid "Print" @@ -224,7 +219,7 @@ msgstr "Jobbra" #: lclstrconsts.ifsvk_rwin msgid "right windows key" -msgstr "jobb windows gomb" +msgstr "jobb windows billentyű" #: lclstrconsts.ifsvk_scroll msgid "Scroll" @@ -538,12 +533,10 @@ msgid "First" msgstr "Első" #: lclstrconsts.rsfixedcolstoobig -#| msgid "FixedCols can't be >= ColCount" msgid "FixedCols can't be > ColCount" msgstr "FixedCols nem lehet > ColCount" #: lclstrconsts.rsfixedrowstoobig -#| msgid "FixedRows can't be >= RowCount" msgid "FixedRows can't be > RowCount" msgstr "FixedRows nem lehet > RowCount" @@ -569,11 +562,11 @@ msgstr "Fukszia" #: lclstrconsts.rsgdkoptiondebug msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." -msgstr "" +msgstr "--gdk-debug jelzők Bekapcsolja a megadott GDK nyomkövetési/hibakeresési üzeneteket." #: lclstrconsts.rsgdkoptionnodebug msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages." -msgstr "" +msgstr "--gdk-no-debug jelzők Kikapcsolja a megadott GDK nyomkövetési/hibakeresési üzeneteket." #: lclstrconsts.rsgif msgid "Graphics Interchange Format" @@ -581,7 +574,7 @@ msgstr "Graphics Interchange Format" #: lclstrconsts.rsgoptionfatalwarnings msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." -msgstr "" +msgstr "--g-fatal-warnings A Gtk+/GDK által generált figyelmeztetések és hibák leállítják az alkalmazást." #: lclstrconsts.rsgradientactivecaptioncolorcaption msgid "Gradient Active Caption" @@ -593,7 +586,7 @@ msgstr "Inaktív gradiens cím" #: lclstrconsts.rsgraphic msgid "Graphic" -msgstr "" +msgstr "Grafika" #: lclstrconsts.rsgraycolorcaption msgid "Gray" @@ -633,7 +626,7 @@ msgstr "" #: lclstrconsts.rsgtkoptiondebug msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages." -msgstr "" +msgstr "--gtk-debug jelzők Bekapcsolja a megadott Gtk+ nyomkövetési/hibakeresési üzeneteket." #: lclstrconsts.rsgtkoptiondisplay msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." @@ -641,23 +634,23 @@ msgstr "" #: lclstrconsts.rsgtkoptionmodule msgid "--gtk-module module Load the specified module at startup." -msgstr "" +msgstr "--gtk-module modul Betölti a megadott modult induláskor." #: lclstrconsts.rsgtkoptionname msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStrUTF8(0)." -msgstr "" +msgstr "--name prognév Beállítja a program nevét a \"prognév\" értékére. Ha nincs megadva, a program neve a ParamStrUTF8(0) értékére lesz beállítva." #: lclstrconsts.rsgtkoptionnodebug msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." -msgstr "" +msgstr "--gtk-no-debug jelzők Kikapcsolja a megadott Gtk+ nyomkövetési/hibakeresési üzeneteket." #: lclstrconsts.rsgtkoptionnotransient msgid "--lcl-no-transient Do not set transient order for modal forms" -msgstr "" +msgstr "--lcl-no-transient Nem lesz beállítva ideiglenes sorrend a modal form-ok számára" #: lclstrconsts.rsgtkoptionnoxshm msgid "--no-xshm Disable use of the X Shared Memory Extension." -msgstr "" +msgstr "--no-xshm Letiltja az X Shared Memory Extension használatát." #: lclstrconsts.rsgtkoptionsync msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediately after the protocol request that generated the error has been processed by the X server." @@ -684,52 +677,45 @@ msgid "Help context %s not found." msgstr "A(z) %s súgó témakör nem található" #: lclstrconsts.rshelphelpcontextnotfoundindatabase -#, fuzzy #| msgid "Help context %s not found in Database %s%s%s." msgid "Help context %s not found in Database \"%s\"." -msgstr "A(z) %s súgó témakör nem található a(z) %s%s%s adatbázisban." +msgstr "A(z) %s súgó témakör nem található a(z) \"%s\" adatbázisban." #: lclstrconsts.rshelphelpdatabasedidnotfoundaviewerforahelppageoftype #, fuzzy -#| msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" +#| msgid "Help Database %s%s%s did not found a viewer for a help page of type %sHelp Database \"%s\" did not found a viewer for a help page of type %s" msgid "Help Database \"%s\" did not found a viewer for a help page of type %s" -msgstr "A(z) %s%s%s súgó adatbázis nem talált megjelenítőt a(z) %s típusú súgó oldalhoz" +msgstr "A(z) \"%s\" súgó adatbázis nem talált megjelenítőt a(z) %s típusú súgó oldalhoz" #: lclstrconsts.rshelphelpdatabasenotfound -#, fuzzy #| msgid "Help Database %s%s%s not found" msgid "Help Database \"%s\" not found" -msgstr "A(z) %s%s%s súgó adatbázis nem található" +msgstr "A(z) \"%s\" súgó adatbázis nem található" #: lclstrconsts.rshelphelpfordirectivenotfound -#, fuzzy #| msgid "Help for directive %s%s%s not found." msgid "Help for directive \"%s\" not found." -msgstr "Nem található súgó a(z) %s%s%s direktívához." +msgstr "Nem található súgó a(z) \"%s\" direktívához." #: lclstrconsts.rshelphelpfordirectivenotfoundindatabase -#, fuzzy #| msgid "Help for directive %s%s%s not found in Database %s%s%s." msgid "Help for directive \"%s\" not found in Database \"%s\"." -msgstr "Nem található súgó a(z) %s%s%s direktívához a(z) %s%s%s adatbázisban." +msgstr "Nem található súgó a(z) \"%s\" direktívához a(z) \"%s\" adatbázisban." #: lclstrconsts.rshelphelpkeywordnotfound -#, fuzzy #| msgid "Help keyword %s%s%s not found." msgid "Help keyword \"%s\" not found." -msgstr "A(z) %s%s%s súgó kulcsszó nem található" +msgstr "A(z) \"%s\" súgó kulcsszó nem található." #: lclstrconsts.rshelphelpkeywordnotfoundindatabase -#, fuzzy #| msgid "Help keyword %s%s%s not found in Database %s%s%s." msgid "Help keyword \"%s\" not found in Database \"%s\"." -msgstr "A(z) %s%s%s súgó kulcsszó nem található a(z) %s%s%s adatbázisban." +msgstr "A(z) \"%s\" súgó kulcsszó nem található a(z) \"%s\" adatbázisban." #: lclstrconsts.rshelphelpnodehasnohelpdatabase -#, fuzzy #| msgid "Help node %s%s%s has no Help Database" msgid "Help node \"%s\" has no Help Database" -msgstr "A(z) %s%s%s elemhez nincs súgó az adatbázisban" +msgstr "A(z) \"%s\" elemhez nincs súgó adatbázis" #: lclstrconsts.rshelpnohelpfoundforsource msgid "No help found for line %d, column %d of %s." @@ -752,10 +738,9 @@ msgid "Help Selector Error" msgstr "Súgó kiválasztó hiba" #: lclstrconsts.rshelpthereisnoviewerforhelptype -#, fuzzy #| msgid "There is no viewer for help type %s%s%s" msgid "There is no viewer for help type \"%s\"" -msgstr "Nincs megjelenítő a(z) %s%s%s típusú súgóhoz" +msgstr "Nincs megjelenítő a(z) \"%s\" típusú súgóhoz." #: lclstrconsts.rshelpviewererror msgid "Help Viewer Error" @@ -915,7 +900,7 @@ msgstr "&Súgó" #: lclstrconsts.rsmbignore msgid "&Ignore" -msgstr "M&ellőz" +msgstr "Ki&hagyás" #: lclstrconsts.rsmbno msgid "&No" @@ -1084,7 +1069,7 @@ msgstr "Lila" #: lclstrconsts.rsqtoptiondograb msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG." -msgstr "" +msgstr "-dograb (csak X11 alatt), a hibakeresőben történő futtatás akaratlan \"-nograb\"-ot okozhat, a -dograb használata ezt bírálja felül. QT_DEBUG szükséges hozzá." #: lclstrconsts.rsqtoptiongraphicsstyle msgid "-graphicssystem param, sets the backend to be used for on-screen widgets and QPixmaps. Available options are native, raster and opengl. OpenGL is still unstable." @@ -1092,15 +1077,15 @@ msgstr "" #: lclstrconsts.rsqtoptionnograb msgid "-nograb, tells Qt that it must never grab the mouse or the keyboard. Need QT_DEBUG." -msgstr "" +msgstr "-nograb, utasítja a Qt rendszert, hogy ne sajátítsa ki az egeret vagy a billentyűzetet. QT_DEBUG szükséges hozzá." #: lclstrconsts.rsqtoptionreverse msgid "-reverse, sets the application's layout direction to Qt::RightToLeft." -msgstr "" +msgstr "-reverse, beállítja az alkalmazás elrendezési irányát a Qt::RightToLeft értékre." #: lclstrconsts.rsqtoptionsession msgid "-session session, restores the application from an earlier session." -msgstr "" +msgstr "-session munkamenet, visszaállítja az alkalmazást egy korábbi munkamenetből." #: lclstrconsts.rsqtoptionstyle msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)." @@ -1112,7 +1097,7 @@ msgstr "" #: lclstrconsts.rsqtoptionsync msgid "-sync (only under X11), switches to synchronous mode for debugging." -msgstr "" +msgstr "-sync (csak X11 alatt), szinkronmódba kapcsol a hibakereséshez." #: lclstrconsts.rsqtoptionwidgetcount msgid "-widgetcount, prints debug message at the end about number of widgets left undestroyed and maximum number of widgets existed at the same time." @@ -1120,35 +1105,35 @@ msgstr "" #: lclstrconsts.rsqtoptionx11bgcolor msgid "-bg or -background color, sets the default background color and an application palette (light and dark shades are calculated)." -msgstr "" +msgstr "-bg vagy -background szín, beállítja az alkalmazás alapértelmezett háttérszínét és színkészletét (a világos és sötét árnyalatok számított értékek)." #: lclstrconsts.rsqtoptionx11btncolor msgid "-btn or -button color, sets the default button color." -msgstr "" +msgstr "-btn vagy -button szín, beállítja a gombok alapértelmezett színét." #: lclstrconsts.rsqtoptionx11cmap msgid "-cmap, causes the application to install a private color map on an 8-bit display." -msgstr "" +msgstr "-cmap, egyéni színösszeállítás használatára kényszeríti az alkalmazást 8-bites megjelenítőn." #: lclstrconsts.rsqtoptionx11display msgid "-display display, sets the X display (default is $DISPLAY)." -msgstr "" +msgstr "-display megjelenítő, beállítja az X megjelenítőt (alapértelmezett a $DISPLAY)." #: lclstrconsts.rsqtoptionx11fgcolor msgid "-fg or -foreground color, sets the default foreground color." -msgstr "" +msgstr "-fg vagy -foreground szín, beállítja az alapértelmezett előtérszínt." #: lclstrconsts.rsqtoptionx11font msgid "-fn or -font font, defines the application font. The font should be specified using an X logical font description." -msgstr "" +msgstr "-fn vagy -font betűtípus, beállítja az alkalmazás betűtípusát, A betűtípust az X logikai betűtípus leírás használatával kell megadni." #: lclstrconsts.rsqtoptionx11geometry msgid "-geometry geometry, sets the client geometry of the first window that is shown." -msgstr "" +msgstr "-geometry elhelyezés, megadja az elsőként megjelenő ablak elhelyezkedését." #: lclstrconsts.rsqtoptionx11im msgid "-im, sets the input method server (equivalent to setting the XMODIFIERS environment variable)." -msgstr "" +msgstr "-im, beállítja a beviteli mód kiszolgálóját (ugyanúgy mint az XMODIFIERS környezeti változó beállítása)." #: lclstrconsts.rsqtoptionx11inputstyle msgid "-inputstyle, defines how the input is inserted into the given widget, e.g. onTheSpot makes the input appear directly in the widget, while overTheSpot makes the input appear in a box floating over the widget and is not inserted until the editing is done." @@ -1156,7 +1141,7 @@ msgstr "" #: lclstrconsts.rsqtoptionx11name msgid "-name name, sets the application name." -msgstr "" +msgstr "-name név, beállítja az alkalmazás nevét." #: lclstrconsts.rsqtoptionx11ncols msgid "-ncols count, limits the number of colors allocated in the color cube on an 8-bit display, if the application is using the QApplication::ManyColor color specification. If count is 216 then a 6x6x6 color cube is used (i.e. 6 levels of red, 6 of green, and 6 of blue); for other values, a cube approximately proportional to a 2x3x1 cube is used." @@ -1164,23 +1149,25 @@ msgstr "" #: lclstrconsts.rsqtoptionx11title msgid "-title title, sets the application title." -msgstr "" +msgstr "-title cím, beállítja az alkalmazás címét." #: lclstrconsts.rsqtoptionx11visual msgid "-visual TrueColor, forces the application to use a TrueColor visual on an 8-bit display." -msgstr "" +msgstr "-visual TrueColor, az alkalmazást TrueColor megjelenítés használatára kényszeríti 8-bites megjelenítőn." #: lclstrconsts.rsrasterimageendupdate +#, fuzzy msgid "Endupdate while no update in progress" -msgstr "" +msgstr "Endupdate esemény miközben nincs frissítés folyamatban" #: lclstrconsts.rsrasterimagesaveinupdate msgid "Cannot save image while update in progress" msgstr "A kép mentése nem lehetséges frissítés közben" #: lclstrconsts.rsrasterimageupdateall +#, fuzzy msgid "Cannot begin update all when canvas only update in progress" -msgstr "" +msgstr "Nem kezdhető el az összes frissítése amikor helyi frissítés van folyamatban" #: lclstrconsts.rsredcolorcaption msgid "Red" @@ -1201,7 +1188,7 @@ msgstr "Mindet cseréli" #: lclstrconsts.rsresourcenotfound msgctxt "lclstrconsts.rsresourcenotfound" msgid "Resource %s not found" -msgstr "Az erőforrás nincs meg: %s" +msgstr "Az erőforrás nem található: %s" #: lclstrconsts.rsscrollbarcolorcaption msgid "ScrollBar" @@ -1499,7 +1486,7 @@ msgstr "Érvénytelen egész szám: %s" #: lclstrconsts.sparlocinfo msgid " (at %d,%d, stream offset %d)" -msgstr "(itt: %d,%d, az adatfolyamban itt: %d)" +msgstr " (itt: %d,%d, az adatfolyamban itt: %d)" #: lclstrconsts.sparunterminatedbinvalue msgid "Unterminated byte value" diff --git a/tools/lazdatadesktop/languages/lazdatadesktop.hu.po b/tools/lazdatadesktop/languages/lazdatadesktop.hu.po index bc970a7cbe..3d32810f39 100644 --- a/tools/lazdatadesktop/languages/lazdatadesktop.hu.po +++ b/tools/lazdatadesktop/languages/lazdatadesktop.hu.po @@ -1,19 +1,19 @@ msgid "" msgstr "" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n" "Language-Team: Magyar (Hungarian)\n" -"X-Generator: Poedit 1.5.4\n" "Language: hu\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: Poedit 1.5.4\n" #: lazdatadeskstr.eoaddterminator msgid "Add terminator" -msgstr "" +msgstr "Lezárás hozzáadása" #: lazdatadeskstr.eoandtermsinbrackets msgid "Put brackets around AND Terms" @@ -33,7 +33,7 @@ msgstr "Mezőnevek idézőjelben" #: lazdatadeskstr.eoskipforeignkeys msgid "Skip foreign keys" -msgstr "" +msgstr "Külső kulcsok átugrása" #: lazdatadeskstr.eouseoldinwhereparams msgid "Use OLD prefix in where parameters" @@ -153,7 +153,7 @@ msgstr "Mező" #: lazdatadeskstr.sforeignkey msgid "Foreign key" -msgstr "" +msgstr "Külső kulcs" #: lazdatadeskstr.shintclose msgid "Close query result data panel" @@ -205,11 +205,11 @@ msgstr "Tartomány hozzáadása az adatszótárhoz" #: lazdatadeskstr.sld_actionaddforeignkey msgid "New Foreign Key" -msgstr "" +msgstr "Új külső kulcs" #: lazdatadeskstr.sld_actionaddforeignkeyh msgid "Add a foreign key to the table" -msgstr "" +msgstr "Külső kulcs hozzáadása a táblához" #: lazdatadeskstr.sld_actionaddsequence msgid "New sequence" @@ -624,11 +624,11 @@ msgstr "Az új mező nevének megadása:" #: lazdatadeskstr.snewforeignkey msgid "Create new foreign key in table %s" -msgstr "" +msgstr "Új külső kulcs létrehozása a(z) %s táblában" #: lazdatadeskstr.snewforeignkeyname msgid "Enter a name for the new foreign key:" -msgstr "" +msgstr "Név megadása az új külső kulcs számára:" #: lazdatadeskstr.snewindex msgid "Create new index on table %s" @@ -644,11 +644,11 @@ msgstr "Új %s létrehozása" #: lazdatadeskstr.snewsequence msgid "Create new sequence" -msgstr "" +msgstr "Új sorozat étrehozása" #: lazdatadeskstr.snewsequencename msgid "Enter a name for the new sequence:" -msgstr "" +msgstr "Név megadása az új sorozat számára:" #: lazdatadeskstr.snewtable msgid "Create new table" @@ -682,7 +682,7 @@ msgstr "Mezők" #: lazdatadeskstr.snodeforeignkeys msgid "Foreign keys" -msgstr "" +msgstr "Külső kulcsok" #: lazdatadeskstr.snodeindexes msgid "Indexes"