From 434dff3b9430b4c738a78d73ae462b3f45cb417a Mon Sep 17 00:00:00 2001 From: marc Date: Sat, 2 Apr 2005 23:38:01 +0000 Subject: [PATCH] + Added Dutch ide translation from Marmin * Updated Catalan translation from Jordi git-svn-id: trunk@7051 - --- .gitattributes | 1 + .../codetools/languages/codetools.ca.po | 232 +- components/synedit/languages/synedit.ca.po | 36 +- examples/listview/listview.lpr | 2 +- languages/lazaruside.ar.po | 20 +- languages/lazaruside.ca.po | 2390 ++--- languages/lazaruside.de.po | 22 +- languages/lazaruside.es.po | 22 +- languages/lazaruside.esutf.po | 22 +- languages/lazaruside.fi.po | 22 +- languages/lazaruside.fiwin.po | 22 +- languages/lazaruside.fr.po | 22 +- languages/lazaruside.he.po | 22 +- languages/lazaruside.it.po | 22 +- languages/lazaruside.itiso.po | 22 +- languages/lazaruside.nl.po | 7748 +++++++++++++++++ languages/lazaruside.pl.po | 22 +- languages/lazaruside.pliso.po | 22 +- languages/lazaruside.plwin.po | 22 +- languages/lazaruside.po | 22 +- languages/lazaruside.ru.po | 22 +- languages/lazaruside.ruutf.po | 22 +- languages/lazaruside.ruwin.po | 22 +- languages/objinspstrconsts.ca.po | 216 +- lcl/languages/lcl.ca.po | 148 +- localize.sh | 2 +- 26 files changed, 9594 insertions(+), 1553 deletions(-) create mode 100644 languages/lazaruside.nl.po diff --git a/.gitattributes b/.gitattributes index 17df9f2561..bd3c597fa8 100644 --- a/.gitattributes +++ b/.gitattributes @@ -1283,6 +1283,7 @@ languages/lazaruside.fr.po svneol=native#text/plain languages/lazaruside.he.po svneol=native#text/plain languages/lazaruside.it.po svneol=native#text/plain languages/lazaruside.itiso.po svneol=native#text/plain +languages/lazaruside.nl.po svneol=native#text/plain languages/lazaruside.pl.po svneol=native#text/plain languages/lazaruside.pliso.po svneol=native#text/plain languages/lazaruside.plwin.po svneol=native#text/plain diff --git a/components/codetools/languages/codetools.ca.po b/components/codetools/languages/codetools.ca.po index 164985b76d..86cf95cbc0 100644 --- a/components/codetools/languages/codetools.ca.po +++ b/components/codetools/languages/codetools.ca.po @@ -12,7 +12,7 @@ msgstr "Projecte %s" #: codetoolsstrconsts:ctsstrexpectedbutatomfound msgid "%s expected, but %s found" -msgstr "esperava %s, per s'ha trobat %s" +msgstr "s'esperava %s, per s'ha trobat %s" #: codetoolsstrconsts:ctsfilehascircularsymlink msgid "%s has a circular symbolic link" @@ -28,7 +28,7 @@ msgstr "%s sense %s" #: codetoolsstrconsts:ctsunknownmainfilename msgid "(unknown mainfilename)" -msgstr "(Nom de fitxer principal desconegut)" +msgstr "(Nom del fitxer principal desconegut)" #: codetoolsstrconsts:ctsunknownsubdescriptor msgid "(unknown subdescriptor %s)" @@ -40,11 +40,11 @@ msgstr ". Indicaci #: codetoolsstrconsts:ctspointstartat msgid ". start at " -msgstr ". comenar a" +msgstr ". comena a" #: codetoolsstrconsts:ctssemicolonafterpropspecmissing msgid "; expected after \"%s\" property specifier, but %s found" -msgstr "; esperat desprs de l'especificador de propietat \"%s\", per s'ha trobat %s" +msgstr "s'esperava ; desprs de l'especificador de propietat \"%s\", per s'ha trobat %s" #: codetoolsstrconsts:ctsanoymdefinitionsarenotallowed msgid "Anonym %s definitions are not allowed" @@ -52,11 +52,11 @@ msgstr "No estan permeses les definicions an #: codetoolsstrconsts:ctscpudirectory msgid "CPU directory" -msgstr "Directori de CPU" +msgstr "Directori de la CPU" #: codetoolsstrconsts:ctsclasssnotfound msgid "Class %s not found" -msgstr "Classe %s no trobada" +msgstr "No s'ha trobat la classe %s" #: codetoolsstrconsts:ctscommandlineparameters msgid "Command line parameters" @@ -64,11 +64,11 @@ msgstr "Par #: codetoolsstrconsts:ctscommentendnotfound msgid "Comment end not found" -msgstr "Final de comentari no trobat" +msgstr "No s'ha trobat el final del comentari" #: codetoolsstrconsts:ctscompiledsrcpath msgid "Compiled SrcPath" -msgstr "SrcPath de compilats" +msgstr "SrcPath dels compilats" #: codetoolsstrconsts:ctscompiler msgid "Compiler" @@ -76,15 +76,15 @@ msgstr "Compilador" #: codetoolsstrconsts:ctscomponentsdirectory msgid "Components Directory" -msgstr "Directori de Components" +msgstr "Directori dels components" #: codetoolsstrconsts:ctscustomcomponentsdirectory msgid "Custom Components Directory" -msgstr "Directori de Components Personalitzats" +msgstr "Directori dels components personalitzats" #: codetoolsstrconsts:ctsdebuggerdirectory msgid "Debugger Directory" -msgstr "Directori del Depurador" +msgstr "Directori del depurador" #: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem msgid "Default ppc386 source Operating System" @@ -92,7 +92,7 @@ msgstr "SO font predeterminat del ppc386" #: codetoolsstrconsts:ctsdefaultppc386source2operatingsystem msgid "Default ppc386 source Operating System 2" -msgstr "" +msgstr "So font 2 predeterminat del ppc386" #: codetoolsstrconsts:ctsdefaultppc386symbol msgid "Default ppc386 symbol" @@ -108,35 +108,35 @@ msgstr "Processador destinaci #: codetoolsstrconsts:ctsdefine msgid "Define " -msgstr "Definir" +msgstr "Defineix" #: codetoolsstrconsts:ctsdefinemacroname msgid "Define Macro %s" -msgstr "Definir macroinstrucci %s" +msgstr "Defineix macroinstrucci %s" #: codetoolsstrconsts:ctsdefinemacrocarbon1 msgid "Define macro carbon1" -msgstr "Definir macroinstrucci carbon1" +msgstr "Defineix macroinstrucci carbon1" #: codetoolsstrconsts:ctsdefinemacrognome2 msgid "Define macro gnome2" -msgstr "Definir macroinstrucci gnome2" +msgstr "Defineix macroinstrucci gnome2" #: codetoolsstrconsts:ctsdefinemacrogtk1 msgid "Define macro gtk1" -msgstr "Definir macroinstrucci gtk1" +msgstr "Defineix macroinstrucci gtk1" #: codetoolsstrconsts:ctsdefinemacrogtk2 msgid "Define macro gtk2" -msgstr "Definir macroinstrucci gtk2" +msgstr "Defineix macroinstrucci gtk2" #: codetoolsstrconsts:ctsdefineprocessortype msgid "Define processor type" -msgstr "Definir tipus de processador" +msgstr "Defineix el tipus de processador" #: codetoolsstrconsts:ctsdefsforlazarussources msgid "Definitions for the Lazarus Sources" -msgstr "Definicions per les fonts del Lazarus" +msgstr "Definicions de les fonts del Lazarus" #: codetoolsstrconsts:ctsdesignerdirectory msgid "Designer Directory" @@ -152,15 +152,15 @@ msgstr "Directori de l'editor de documents" #: codetoolsstrconsts:ctsendofsourcenotfound msgid "End of source not found" -msgstr "Final de codi font no trobat" +msgstr "No s'ha trobat el final del codi font" #: codetoolsstrconsts:ctsforward msgid "Forward" -msgstr "Avanar" +msgstr "Avana" #: codetoolsstrconsts:ctsforwardclassdefinitionnotresolved msgid "Forward class definition not resolved: %s" -msgstr "Definici de classe Forward no resolta: %s" +msgstr "No s'ha resolt la definici de la classe: %s" #: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros msgid "Free Pascal Compiler initial macros" @@ -168,7 +168,7 @@ msgstr "Macroinstruccions inicials del Free Pascal Compiler" #: codetoolsstrconsts:ctsfreepascalcomponentlibrary msgid "Free Pascal Component Library" -msgstr "Biblioteca de Components del Free Pascal" +msgstr "Biblioteca dels components del Free Pascal" #: codetoolsstrconsts:ctsfreepascalsourcedir msgid "Free Pascal Source Directory" @@ -196,11 +196,11 @@ msgstr "If LCLWidgetType=gtk2 then" #: codetoolsstrconsts:ctsiftargetosisnotsrcos msgid "If TargetOS<>SrcOS" -msgstr "" +msgstr "If TargetOS<>SrcOS" #: codetoolsstrconsts:ctsiftargetosisnotsrcos2 msgid "If TargetOS<>SrcOS2" -msgstr "" +msgstr "If TargetOS<>SrcOS2" #: codetoolsstrconsts:ctsiftargetosisnotwin32 msgid "If TargetOS<>win32 then" @@ -208,7 +208,7 @@ msgstr "If targetOS<>win32 then" #: codetoolsstrconsts:ctsincludecircledetected msgid "Include circle detected" -msgstr "Detectat cercle Include" +msgstr "S'ha detectat un cercle Include" #: codetoolsstrconsts:ctsinstallerdirectories msgid "Installer directories" @@ -216,7 +216,7 @@ msgstr "Directoris de l'instal #: codetoolsstrconsts:ctsjitformdirectory msgid "JITForm Directory" -msgstr "Directori de JitForm" +msgstr "Directori de les JitForm" #: codetoolsstrconsts:ctslazarussources msgid "Lazarus Sources" @@ -224,31 +224,31 @@ msgstr "Fonts del Lazarus" #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" -msgstr "Activar comentaris niats" +msgstr "Activa els comentaris niats" #: codetoolsstrconsts:ctsnoscanneravailable msgid "No scanner available" -msgstr "Analitzador no disponible" +msgstr "L'analitzador no est disponible" #: codetoolsstrconsts:ctsnoscannerfound msgid "No scanner found for \"%s\". If this is an include file, please open the main source first." -msgstr "No es troba analitzador per \"%s\". Si aquest s un fitxer incls, si us plau, obre primer el codi font principal" +msgstr "No s'ha trobat l'analitzador per \"%s\". Si aquest s un fitxer incls, si us plau, obriu primer el codi font principal" #: codetoolsstrconsts:ctspackagedirectories msgid "Package directories" -msgstr "Directoris de paquets" +msgstr "Directoris dels paquets" #: codetoolsstrconsts:ctspackagerdirectory msgid "Packager Directory" -msgstr "Directori d'empaquetador" +msgstr "Directori de l'empaquetador" #: codetoolsstrconsts:ctspackagerregistrationdirectory msgid "Packager Registration Directory" -msgstr "Directori de registrador d'empaquetador" +msgstr "Directori del registrador de l'empaquetador" #: codetoolsstrconsts:ctspackagerunitsdirectory msgid "Packager Units Directory" -msgstr "Directori d'unitats d'empaquetador" +msgstr "Directori de les unitats de l'empaquetador" #: codetoolsstrconsts:ctspositionnotinsource msgid "Position not in source" @@ -256,7 +256,7 @@ msgstr "La posici #: codetoolsstrconsts:ctsresetalldefines msgid "Reset all defines" -msgstr "Reiniciar totes les definicions" +msgstr "Reinicia totes les definicions" #: codetoolsstrconsts:ctsruntimelibrary msgid "Runtime library" @@ -264,7 +264,7 @@ msgstr "Biblioteca de temps d'execuci #: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits msgid "Source filenames for the standard fpc units" -msgstr "Noms de fitxers font de les unitats normalitzades del fpc" +msgstr "Noms dels fitxers font de les unitats normalitzades del fpc" #: codetoolsstrconsts:ctssrcpathinitialization msgid "SrcPath Initialization" @@ -272,7 +272,7 @@ msgstr "Inicialitzaci #: codetoolsstrconsts:ctssyntaxerrorinexpr msgid "Syntax Error in expression \"%s\"" -msgstr "Error de sintaxi a l'expressi \"%s\"" +msgstr "S'ha produt un error de sintaxi en l'expressi \"%s\"" #: codetoolsstrconsts:ctstermnotsimple msgid "Term has no simple type" @@ -280,11 +280,11 @@ msgstr "Term no te un tipus simple" #: codetoolsstrconsts:ctstoolsdirectory msgid "Tools Directory" -msgstr "Directori d'Eines" +msgstr "Directori de les eines" #: codetoolsstrconsts:ctsunitpathinitialization msgid "UnitPath Initialization" -msgstr "Inicialitzaci de UnitPath" +msgstr "Inicialitzaci d'UnitPath" #: codetoolsstrconsts:ctsunknownfunction msgid "Unknown function %s" @@ -296,35 +296,35 @@ msgstr "No analitzat" #: codetoolsstrconsts:ctsutilsdirectories msgid "Utils directories" -msgstr "Directoris d'utilitats" +msgstr "Directoris de les utilitats" #: codetoolsstrconsts:ctswidgetdirectory msgid "Widget Directory" -msgstr "Directori de ginys" +msgstr "Directori dels ginys" #: codetoolsstrconsts:ctswordnotfound msgid "\"%s\" not found" -msgstr "\"%S\" no trobat/ada" +msgstr "No s'ha trobat \"%S\"" #: codetoolsstrconsts:ctsclassofdefinitionnotresolved msgid "\"class of\" definition not resolved: %s" -msgstr "\"classe de \" definici no resolta: %s" +msgstr "No s'ha resolt la definici de \"class of \": %s" #: codetoolsstrconsts:ctsendforclassnotfound msgid "\"end\" for class/object not found" -msgstr "\"end\" per class/object no trobat" +msgstr "No s'ha trobat \"end\" per class/object" #: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink msgid "a directory component in %s does not exist or is a dangling symlink" -msgstr "un component del directori a %s no existeix o s un enlla simblic no vlid" +msgstr "No existeix un component del directori a %s, o s un enlla simblic no vlid" #: codetoolsstrconsts:ctsdircomponentisnotdir msgid "a directory component in %s is not a directory" -msgstr "un directori de components a %s no s un directori" +msgstr "un directori dels components a %s no s un directori" #: codetoolsstrconsts:ctsaddsdirtosourcepath msgid "adds %s to SrcPath" -msgstr "afegir %s a SrcPath" +msgstr "afegeix %s a SrcPath" #: codetoolsstrconsts:ctsanlclproject msgid "an LCL project" @@ -336,7 +336,7 @@ msgstr "el progenitor de propietat sense tipus no #: codetoolsstrconsts:ctsbasetypeofnotfound msgid "base type of \"%s\" not found" -msgstr "no trobat tipus base de \"%s\"" +msgstr "no s'ha trobat tipus base de \"%s\"" #: codetoolsstrconsts:ctsbinaryoperator msgid "binary operator" @@ -344,23 +344,23 @@ msgstr "operador binari" #: codetoolsstrconsts:ctsbracketnotfound msgid "bracket %s not found" -msgstr "claudtor %s no trobat" +msgstr "no s'ha trobat %s" #: codetoolsstrconsts:ctsbracketcloseexpectedbutatomfound msgid "bracket close expected, but %s found" -msgstr "S'esperava claudtor de tancament, per s'ha trobat %s" +msgstr "S'esperava claudtor de tancar, per s'ha trobat %s" #: codetoolsstrconsts:ctsbracketopenexpectedbutatomfound msgid "bracket open expected, but %s found" -msgstr "S'esperava claudtor d'obertura, per s'ha trobat %s" +msgstr "S'esperava claudtor d'obrir, per s'ha trobat %s" #: codetoolsstrconsts:ctscircleindefinitions msgid "circle in definitions" -msgstr "cercle a les definicions" +msgstr "hi ha un cercle en les definicions" #: codetoolsstrconsts:ctsclassnotfound msgid "class %s%s%s not found" -msgstr "classe %s%s%s no trobada" +msgstr "no s'ha trobat la classe %s%s%s" #: codetoolsstrconsts:ctsclassidentifierexpected msgid "class identifier expected" @@ -384,23 +384,23 @@ msgstr "posici #: codetoolsstrconsts:ctsdefaultclassancestortobjectnotfound msgid "default class ancestor TObject not found" -msgstr "classe predeterminada progenitora TObject no trobada" +msgstr "no s'ha trobat la classe predeterminada progenitora TObject" #: codetoolsstrconsts:ctsdefaultinterfaceancestoriinterfacenotfound msgid "default interface ancestor IInterface not found" -msgstr "interfcie predeterminada progenitora IInterface no trobada" +msgstr "no s'ha trobat l'interfcie predeterminada progenitora IInterface" #: codetoolsstrconsts:ctsdefaultparameterexpectedbutatomfound msgid "default parameter expected, but %s found" -msgstr "s'esperava parmetre predeterminat, per s'ha trobat %s" +msgstr "s'esperava un parmetre predeterminat, per s'ha trobat %s" #: codetoolsstrconsts:ctsdefaultpropertynotfound msgid "default property not found" -msgstr "propietat predeterminada no trobada" +msgstr "no s'ha trobat la propietat predeterminada" #: codetoolsstrconsts:ctsdefaultspecifierredefined msgid "default specifier redefined" -msgstr "especificador predeterminat redefinit" +msgstr "s'ha redefinit l'especificador predeterminat" #: codetoolsstrconsts:ctsduplicateidentifier msgid "duplicate identifier: %s" @@ -412,43 +412,43 @@ msgstr "else" #: codetoolsstrconsts:ctsendforrecordnotfound msgid "end for record not found" -msgstr "final del registre no trobat" +msgstr "no s'ha trobat el final del registre" #: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies msgid "error during creation of new proc bodies" -msgstr "error mentre creava els cossos del nou procediment" +msgstr "s'ha produt un error mentre es creaven els cossos del nou procediment" #: codetoolsstrconsts:ctserrorduringinsertingnewclassparts msgid "error during inserting new class parts" -msgstr "error mentre inseria parts de la nova classe" +msgstr "s'ha produt un error mentre s'inserien parts de la nova classe" #: codetoolsstrconsts:ctserrorindirectiveexpression msgid "error in directive expression" -msgstr "error en expressi de directiva" +msgstr "s'ha produt un error en l'expressi de la directiva" #: codetoolsstrconsts:ctserrorinparamlist msgid "error in paramlist" -msgstr "error a llista de parmetres" +msgstr "s'ha produt un error en llista dels parmetres" #: codetoolsstrconsts:ctsexecuteaccessdeniedforfile msgid "execute access denied for %s" -msgstr "denegat l'accs d'execuci per: %s" +msgstr "s'ha denegat l'accs d'execuci per: %s" #: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound msgid "expected end., but %s found" -msgstr "esperava end., per he trobat %s" +msgstr "esperava end., per s'ha trobat %s" #: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries msgid "exports clause only allowed in libraries" -msgstr "clausula exportada noms s permesa en biblioteques" +msgstr "la clausula exportada noms es permet en biblioteques" #: codetoolsstrconsts:ctsexprtypemustbeclassorrecord msgid "expression type must be class or record type" -msgstr "el tipus d'expressi ha de ser del tipus CLASS o RECORD" +msgstr "el tipus de l'expressi ha de ser CLASS o RECORD" #: codetoolsstrconsts:ctsfiledoesnotexists msgid "file \"%s\" does not exist" -msgstr "el fitxer \"%s\" no existeix" +msgstr "no existeix el fitxer \"%s\"" #: codetoolsstrconsts:ctsfileisreadonly msgid "file is read only" @@ -456,11 +456,11 @@ msgstr "el fitxer #: codetoolsstrconsts:ctsgnomeintfdirectory msgid "gnome interface directory" -msgstr "directori d'interfcie gnome" +msgstr "directori d'interfcie del gnome" #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" -msgstr "directori d'interfcie gtk2" +msgstr "directori d'interfcie del gtk2" #: codetoolsstrconsts:ctsidentifier msgid "identifier" @@ -468,35 +468,35 @@ msgstr "identificador" #: codetoolsstrconsts:ctsidentexpectedbutatomfound msgid "identifier expected, but %s found" -msgstr "esperava identificador, per s'ha trobat %s" +msgstr "esperava un identificador, per s'ha trobat %s" #: codetoolsstrconsts:ctsidentexpectedbutkeywordfound msgid "identifier expected, but keyword %s found" -msgstr "esperava identificador, per s'ha trobat paraula clau %s" +msgstr "esperava un identificador, per s'ha trobat paraula clau %s" #: codetoolsstrconsts:ctsidentifiernotfound msgid "identifier not found: %s" -msgstr "identificador no trobat: %s" +msgstr "no s'ha trobat l'identificador: %s" #: codetoolsstrconsts:ctsillegalcircleinusedunits msgid "illegal circle using unit: %s" -msgstr "cercle illegal utilitzant la unitat: %s" +msgstr "hi ha un cercle illegal utilitzant la unitat: %s" #: codetoolsstrconsts:ctsillegalqualifier msgid "illegal qualifier %s found" -msgstr "s'ha trobat qualificador illegal %s" +msgstr "s'ha trobat el qualificador illegal %s" #: codetoolsstrconsts:ctsimplementationnodenotfound msgid "implementation node not found" -msgstr "node implementation no trobat" +msgstr "no s'ha trobat el node d'implementaci" #: codetoolsstrconsts:ctsincludedirectoriesplusdirs msgid "include directories: %s" -msgstr "directoris d'inclosos: %s" +msgstr "directoris dels inclosos: %s" #: codetoolsstrconsts:ctsincludefilenotfound msgid "include file not found \"%s\"" -msgstr "fitxer incls no trobat \"%s\"" +msgstr "no s'ha trobat el fitxer incls \"%s\"" #: codetoolsstrconsts:ctsincompatibletypesgotexpected msgid "incompatibles types: expected \"%s\" but got \"%s\"" @@ -508,15 +508,15 @@ msgstr "s'esperava par #: codetoolsstrconsts:ctsindexspecifierredefined msgid "index specifier redefined" -msgstr "especificador d'ndex redefinit" +msgstr "s'ha tornat a definir l'especificador de l'ndex" #: codetoolsstrconsts:ctsinheritedkeywordonlyallowedinmethods msgid "inherited keyword only allowed in methods" -msgstr "la paraula clau Inherited noms s permesa dins dels mtodes" +msgstr "la paraula clau Inherited noms es permet dins dels mtodes" #: codetoolsstrconsts:ctsinsufficientmemory msgid "insufficient memory" -msgstr "memria insuficient" +msgstr "no hi ha prou memria" #: codetoolsstrconsts:ctsintfdirectory msgid "interface directory" @@ -524,39 +524,39 @@ msgstr "directori d'interf #: codetoolsstrconsts:ctsinterfacesectionnotfound msgid "interface section not found" -msgstr "secci Interface no trobada" +msgstr "no s'ha trobat la secci Interface" #: codetoolsstrconsts:ctsinvalidclassname2 msgid "invalid class name %s%s%s" -msgstr "nom de classe no vlid %s%s%s" +msgstr "el nom de la classe no s vlid: %s%s%s" #: codetoolsstrconsts:ctsinvalidclassname msgid "invalid class name=%s%s%s" -msgstr "nom de classe no vlid=%s%s%s" +msgstr "el nom de la classe no s vlid=%s%s%s" #: codetoolsstrconsts:ctsinvalidflagvaluefordirective msgid "invalid flag value \"%s\" for directive %s" -msgstr "valor de marcador \"%s\" no vlid per directiva %s" +msgstr "el valor del marcador \"%s\" no s vlid per la directiva %s" #: codetoolsstrconsts:ctsinvalidmode msgid "invalid mode \"%s\"" -msgstr "mode no vlid \"%s\"" +msgstr "el mode \"%s\" no s vlid" #: codetoolsstrconsts:ctsinvalidsubrange msgid "invalid subrange" -msgstr "sot-abast no vlid" +msgstr "sotabast no s vlid" #: codetoolsstrconsts:ctsinvalidtype msgid "invalid type" -msgstr "tipus invlid" +msgstr "el tipus no s vlid" #: codetoolsstrconsts:ctsinvalidvariablename msgid "invalid variable name %s%s%s" -msgstr "nom de variable no vlid %s%s%s" +msgstr "el nom de la variable %s%s%s no s vlid" #: codetoolsstrconsts:ctsinvalidvariabletype msgid "invalid variable type %s%s%s" -msgstr "tipus de variable no vlid %s%s%s" +msgstr "el tipus de la variable %s%s%s no s vlid" #: codetoolsstrconsts:ctskeyword msgid "keyword" @@ -564,7 +564,7 @@ msgstr "Paraula clau" #: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound msgid "keyword (e.g. %s) expected, but %s found" -msgstr "esperava paraula clau (p.e.%s), per s'ha trobat %s" +msgstr "s'esperava paraula clau (p.ex.%s), per s'ha trobat %s" #: codetoolsstrconsts:ctskeywordin msgid "keyword \"in\"" @@ -576,11 +576,11 @@ msgstr "Directori principal del Lazarus" #: codetoolsstrconsts:ctsmethodname msgid "method name" -msgstr "nom de mtode" +msgstr "nom del mtode" #: codetoolsstrconsts:ctsmethodtypedefinitionnotfound msgid "method type definition not found" -msgstr "definici de tipus de mtode no trobat" +msgstr "no s'ha trobat la definici del tipus del mtode" #: codetoolsstrconsts:ctsmissingpointafterend msgid "missing . after end" @@ -588,27 +588,27 @@ msgstr "falta el punt (.) despr #: codetoolsstrconsts:ctsmissingenumlist msgid "missing enum list" -msgstr "falta llista d'enumerats" +msgstr "falta la llista dels enumerats" #: codetoolsstrconsts:ctsmissingtypeidentifier msgid "missing type identifier" -msgstr "falta identificador de tipus" +msgstr "falta l'identificador del tipus" #: codetoolsstrconsts:ctsnewprocbodynotfound msgid "new proc body not found" -msgstr "cos del nou procediment no trobat" +msgstr "no s'ha trobat el cos del nou procediment" #: codetoolsstrconsts:ctsnocontextnodefoundatcursor msgid "no context node found at cursor" -msgstr "node sense context trobat al cursor" +msgstr "s'ha trobat un node sense context al cursor" #: codetoolsstrconsts:ctsnopascalcodefound msgid "no pascal code found (first token is %s)" -msgstr "no es troba codi Pascal (el primer testimoni s %s)" +msgstr "no s'ha trobat el codi Pascal (el primer testimoni s %s)" #: codetoolsstrconsts:ctsnonodefoundatcursor msgid "no pascal node found at cursor (i.e. in unparsed code)" -msgstr "node no Pascal trobat al cursor. (p.e. en codi no analitzat)" +msgstr "s'ha trobat un node no Pascal al cursor. (p.ex. en codi no analitzat)" #: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice msgid "nodefault specifier defined twice" @@ -616,7 +616,7 @@ msgstr "l'especificador no predeterminat s'ha definit dues vegades" #: codetoolsstrconsts:ctsoldmethodnotfound msgid "old method not found: %s" -msgstr "mtode vell no trobat: %s" +msgstr "no s'ha trobat el mtode antic: %s" #: codetoolsstrconsts:ctsprocedureorfunction msgid "procedure or function" @@ -628,19 +628,19 @@ msgstr "espec #: codetoolsstrconsts:ctspropertyspecifieralreadydefined msgid "property specifier already defined: %s" -msgstr "especificador de propietat ja definit: %s" +msgstr "l'especificador de la propietat ja est definit: %s" #: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound msgid "property type expected, but %s found" -msgstr "esperava tipus de propietat, per s'ha trobat %s" +msgstr "s'esperava un tipus de propietat, per s'ha trobat %s" #: codetoolsstrconsts:ctsqualifierexpectedbutatomfound msgid "qualifier expected but %s found" -msgstr "esperava qualificador per s'ha trobat %s" +msgstr "s'esperava un qualificador, per s'ha trobat %s" #: codetoolsstrconsts:ctssemicolonnotfound msgid "semicolon not found" -msgstr "punt i coma no trobat" +msgstr "no s'ha trobat el punt i coma" #: codetoolsstrconsts:ctssetsincpathto msgid "sets IncPath to %s" @@ -656,7 +656,7 @@ msgstr "la font no #: codetoolsstrconsts:ctssourcenotfoundunit msgid "source not found: unit %s" -msgstr "no s'ha trobat font: unitat %s" +msgstr "no s'ha trobat la font: unitat %s" #: codetoolsstrconsts:ctssrcpathforcompiledunits msgid "src path for compiled units" @@ -664,19 +664,19 @@ msgstr "traject #: codetoolsstrconsts:ctsstringconstant msgid "string constant" -msgstr "constant de cadena" +msgstr "constant de la cadena" #: codetoolsstrconsts:ctstypeidentifier msgid "type identifier" -msgstr "identificador de tipus" +msgstr "identificador del tipus" #: codetoolsstrconsts:ctstypesectionofclassnotfound msgid "type section of class not found" -msgstr "secci tipus de classe no trobada" +msgstr "no s'ha trobat la secci del tipus de la classe" #: codetoolsstrconsts:ctsunabletoapplychanges msgid "unable to apply changes" -msgstr "no es pot aplicar els canvis" +msgstr "no es poden aplicar els canvis" #: codetoolsstrconsts:ctsunabletocompleteproperty msgid "unable to complete property" @@ -692,27 +692,27 @@ msgstr "final de codi font inesperat" #: codetoolsstrconsts:ctsunexpectedkeyword msgid "unexpected keyword \"%s\"" -msgstr "paraula clau inesperada \"%s\"" +msgstr "no s'esperava la paraula clau \"%s\"" #: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards msgid "unexpected keyword \"%s\" found while reading blocks backwards" -msgstr "paraula clau \"%S\" inesperada trobada mentre llegia blocs enrera" +msgstr "s'ha trobat la paraula clau \"%S\" mentre es llegia blocs enrera" #: codetoolsstrconsts:ctsunexpectedkeywordinasmblock msgid "unexpected keyword \"%s\" in asm block found" -msgstr "paraula clau \"%s\" inesperada en bloc asm" +msgstr "paraula clau \"%s\" no esperada en el bloc asm" #: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock msgid "unexpected keyword \"%s\" in begin..end found" -msgstr "paraula clau \"%S\" inesperada a begin..end" +msgstr "paraula clau \"%S\" no esperada a begin..end" #: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound msgid "unexpected subrange operator '..' found" -msgstr "s'ha trobat operador de sot-abast '..' inesperat" +msgstr "s'ha trobat operador de sotabast '..' no esperat" #: codetoolsstrconsts:ctsunitnotfound msgid "unit not found: %s" -msgstr "unitat no trobada: %s" +msgstr "no s'ha trobat la unitat: %s" #: codetoolsstrconsts:ctsunknownsectionkeyword msgid "unknown section keyword %s found" diff --git a/components/synedit/languages/synedit.ca.po b/components/synedit/languages/synedit.ca.po index 488431f3f2..d0ada816cb 100644 --- a/components/synedit/languages/synedit.ca.po +++ b/components/synedit/languages/synedit.ca.po @@ -4,7 +4,7 @@ msgstr "%d - %d" #: syneditstrconst:syns_filterasm68hc11 msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" -msgstr "Fitxers d'assemblador 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" +msgstr "Fitxers de l'assemblador 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" #: syneditstrconst:syns_shortcutnone msgid "" @@ -84,7 +84,7 @@ msgstr "HTML" #: syneditstrconst:syns_filterhtml msgid "HTML Document (*.htm,*.html)|*.htm;*.html" -msgstr "Document HTML (*.htm,*.html)|*.htm;*.html" +msgstr "Document d'HTML (*.htm,*.html)|*.htm;*.html" #: syneditstrconst:syns_filterini msgid "INI Files (*.ini)|*.ini" @@ -96,11 +96,11 @@ msgstr "Fitxers de seq #: syneditstrconst:syns_filterjava msgid "Java Files (*.java)|*.java" -msgstr "Fitxers Java (*.java)|*.java" +msgstr "Fitxers de Java (*.java)|*.java" #: syneditstrconst:syns_filterjscript msgid "Javascript Files (*.js)|*.js" -msgstr "Fitxers Javascript (*.js)|*.js" +msgstr "Fitxers de Javascript (*.js)|*.js" #: syneditstrconst:syns_filterkix msgid "KiXtart scripts (*.kix)|*.kix" @@ -116,11 +116,11 @@ msgstr "Fitxers de lot MS-DOS (*.bat;*.cmd)|*.bat;*.cmd" #: syneditstrconst:syns_filtermodelica msgid "Modelica Files (*.mo)|*.mo" -msgstr "Fitxers Modelica (*.mo)|*.mo" +msgstr "Fitxers de Modelica (*.mo)|*.mo" #: syneditstrconst:syns_filtermodula3 msgid "Modula-3 Files (*.m3)|*.m3" -msgstr "Fitxers Modula-3 (*.m3)|*.m3" +msgstr "Fitxers de Modula-3 (*.m3)|*.m3" #: syneditstrconst:syns_filtersyngenmsgfiles msgid "Msg files (*.msg)|*.msg" @@ -128,7 +128,7 @@ msgstr "Fitxers Msg (*.msg)|*.msg" #: syneditstrconst:syns_filterphp msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" -msgstr "Fitxers PHP (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" +msgstr "Fitxers de PHP (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" #: syneditstrconst:syns_previewscrollinfofmt msgid "Page: %d" @@ -136,19 +136,19 @@ msgstr "P #: syneditstrconst:syns_filterpascal msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" -msgstr "Fitxers Pascal (*.pas,*.dpr,*dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" +msgstr "Fitxers de Pascal (*.pas,*.dpr,*dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" #: syneditstrconst:syns_filterperl msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" -msgstr "Fitxers Perl (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" +msgstr "Fitxers de Perl (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" #: syneditstrconst:syns_filterprogress msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" -msgstr "Fitxers Progress (*.w,*.p,*.i)|*.w;*.p;*.i" +msgstr "Fitxers de Progress (*.w,*.p,*.i)|*.w;*.p;*.i" #: syneditstrconst:syns_filterpython msgid "Python Files (*.py)|*.py" -msgstr "Fitxers Python (*.py)|*.py" +msgstr "Fitxers de Python (*.py)|*.py" #: syneditstrconst:syns_exporterformatrtf msgid "RTF" @@ -160,11 +160,11 @@ msgstr "Rich Text Format (*.rtf)|*.rtf" #: syneditstrconst:syns_filtersql msgid "SQL Files (*.sql)|*.sql" -msgstr "Fitxers SQL (*.sql)|*.sql" +msgstr "Fitxers de SQL (*.sql)|*.sql" #: syneditstrconst:syns_filtersdd msgid "Semanta DD files (*.sdd)|*.sdd" -msgstr "Fitxers Semanta DD (*.sdd)|*.sdd" +msgstr "Fitxers de Semanta DD (*.sdd)|*.sdd" #: syneditstrconst:syns_eduplicateshortcut msgid "Shortcut already exists" @@ -176,11 +176,11 @@ msgstr "Fitxers normalitzats ML (*.sml)|*.sml" #: syneditstrconst:syns_filtertcltk msgid "Tcl/Tk Files (*.tcl)|*.tcl" -msgstr "Fitxers Tcl/Tk (*.tcl)|*.tcl" +msgstr "Fitxers de Tcl/Tk (*.tcl)|*.tcl" #: syneditstrconst:syns_filtertex msgid "TeX Files (*.tex)|*.tex" -msgstr "Fitxers TeX (*.tex)|*.tex" +msgstr "Fitxers de TeX (*.tex)|*.tex" #: syneditstrconst:syns_duplicateshortcutmsg msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" @@ -196,15 +196,15 @@ msgstr "Seq #: syneditstrconst:syns_filtervbscript msgid "VBScript Files (*.vbs)|*.vbs" -msgstr "Fitxers VBScript (*.vbs)|*.vbs" +msgstr "Fitxers de VBScript (*.vbs)|*.vbs" #: syneditstrconst:syns_filtervisualbasic msgid "Visual Basic Files (*.bas)|*.bas" -msgstr "Fitxers Visual Basic (*.bas)|*.bas" +msgstr "Fitxers de Visual Basic (*.bas)|*.bas" #: syneditstrconst:syns_filterxml msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" -msgstr "Document XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" +msgstr "Document d'XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" #: syneditstrconst:syns_filterx86asm msgid "x86 Assembly Files (*.asm)|*.ASM" diff --git a/examples/listview/listview.lpr b/examples/listview/listview.lpr index c6daabd09c..51c1934cb6 100644 --- a/examples/listview/listview.lpr +++ b/examples/listview/listview.lpr @@ -5,7 +5,7 @@ program listview; uses Interfaces, testform, - Forms; + Forms, Unit1; begin Application.Initialize; diff --git a/languages/lazaruside.ar.po b/languages/lazaruside.ar.po index 80dfd738a0..c73c7d528f 100644 --- a/languages/lazaruside.ar.po +++ b/languages/lazaruside.ar.po @@ -618,7 +618,7 @@ msgid "Back" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" +msgid "Background" msgstr "" #: lazarusidestrconsts:srvk_back @@ -1625,6 +1625,10 @@ msgstr "" msgid "Default pascal extension" msgstr "" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" @@ -7169,7 +7185,7 @@ msgstr "" msgid "User overrides" msgstr "" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/lazaruside.ca.po b/languages/lazaruside.ca.po index 3e225e1170..6c1fce72a7 100644 --- a/languages/lazaruside.ca.po +++ b/languages/lazaruside.ca.po @@ -1,22 +1,22 @@ #: lazarusidestrconsts:lisdonotshowsplashscreen msgid " Do not show splash screen" -msgstr " No mostrar pantalla flaix" +msgstr " No mostris la pantalla flaix" #: lazarusidestrconsts:lisskiploadinglastproject msgid " Skip loading last project" -msgstr " No carregar l'ltim projecte" +msgstr " No carreguis l'ltim projecte" #: lazarusidestrconsts:lisfilewheredebugoutputiswritten msgid " file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr " fitxer on s'escriu la sortida de depuraci. Si no s'especifica, la sortida de depuraci s'escriu a la consola" +msgstr " el fitxer on s'escriu la sortida de depuraci. Si no s'especifica, la sortida de depuraci s'escriu a la consola" #: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid " primary config directory, where Lazarus stores its config files. Default is " -msgstr " directori de configuraci principal, on el Lazarus guarda els fitxers de configuraci. El predeterminat s " +msgstr " el directori de configuraci principal, on el Lazarus guarda els fitxers de configuraci. El predeterminat s " #: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor msgid " secondary config directory, where Lazarus searches for config template files. Default is " -msgstr " directori de configuraci secundari, on el Lazarus busca els fitxers on hi ha les plantilles de configuraci. El predeterminat s " +msgstr " el directori de configuraci secundari, on el Lazarus cerca els fitxers on hi ha les plantilles de configuraci. El predeterminat s " #: lazarusidestrconsts:srkmcommand1 msgid " command1 \"" @@ -40,11 +40,11 @@ msgstr "conflicte amb" #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" -msgstr "%s (compilant ...)" +msgstr "%s (s'est compilant ...)" #: lazarusidestrconsts:lisdebugging msgid "%s (debugging ...)" -msgstr "%s (depurant ...)" +msgstr "%s (s'est depurant ...)" #: lazarusidestrconsts:lisnewproject msgid "%s - (new project)" @@ -68,7 +68,7 @@ msgstr "directori del projecte %s" #: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "%s%s%s s un nom de projecte invlid. %s Si et plau, tria'n un altre (p.e. project1.lpi)" +msgstr "%s%s%s no s un nom de projecte vlid. %s Si us plau, escolliu-ne un altre (p.e. project1.lpi)" #: lazarusidestrconsts:lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." @@ -80,15 +80,15 @@ msgstr "%s%s%s no #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if are sure to do that." -msgstr "%s%sPrem D'ACORD si n'ests segur." +msgstr "%s%sPremeu D'ACORD si n'esteu segur." #: lazarusidestrconsts:lispkgsysfilename msgid "%s%sFile Name: %s%s%s" -msgstr "%s%sNom de fitxer: %s%s%s" +msgstr "%s%sNom del fitxer: %s%s%s" #: lazarusidestrconsts:lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" -msgstr "%s%sNom d'unitat: %s%s%s" +msgstr "%s%sNom de la unitat: %s%s%s" #: lazarusidestrconsts:lispckeditpage msgid "%s, Page: %s" @@ -96,7 +96,7 @@ msgstr "%s, P #: lazarusidestrconsts:liscodetoolsdefsautogenerated msgid "%s, auto generated" -msgstr "%s, auto-generat" +msgstr "%s, generat automticament" #: lazarusidestrconsts:liscodetoolsdefsprojectspecific msgid "%s, project specific" @@ -108,11 +108,11 @@ msgstr "%s/Nom #: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" -msgstr "%sAfegint nova dependncia pel paquet %s: paquet %s%s" +msgstr "%sS'est afegint nova dependncia pel paquet %s: paquet %s%s" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" -msgstr "%sAfegint nova dependncia pel projecte %s: paquet %s%s" +msgstr "%sS'est afegint nova dependncia pel projecte %s: paquet %s%s" #: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." @@ -128,7 +128,7 @@ msgstr "%sFitxer existent: %s%s%s" #: lazarusidestrconsts:lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" -msgstr "" +msgstr "%sMireu Projecte -> Inspector del Projecte" #: lazarusidestrconsts:lispckexplstate msgid "%sState: " @@ -136,31 +136,31 @@ msgstr "%sEstat: " #: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "%sLes segents unitats seran afegides a la secci USES de%s%s:%s%s%s" +msgstr "%sLes segents unitats s'afegiran a la secci USES de%s%s:%s%s%s" #: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" -msgstr "%sAquest paquet est intallat, per no he trobat el fitxer lpk" +msgstr "%sAquest paquet est intallat, per no s'ha trobat el fitxer lpk" #: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" -msgstr "%sAquest paquet ha estat creat automticament" +msgstr "%sAquest paquet s'ha creat automticament" #: lazarusidestrconsts:uemaddbreakpoint msgid "&Add Breakpoint" -msgstr "&Afegir punt de trencament" +msgstr "&Afegeix punt de ruptura" #: lazarusidestrconsts:uemclosepage msgid "&Close Page" -msgstr "Tan&car pgina" +msgstr "Tan&ca la pgina" #: lazarusidestrconsts:lismenucomponents msgid "&Components" -msgstr "&Components" +msgstr "C&omponents" #: lazarusidestrconsts:lismenuedit msgid "&Edit" -msgstr "&Editar" +msgstr "&Edita" #: lazarusidestrconsts:lismenufile msgid "&File" @@ -168,11 +168,11 @@ msgstr "&Fitxer" #: lazarusidestrconsts:uemfinddeclaration msgid "&Find Declaration" -msgstr "&Buscar declaraci" +msgstr "&Cerca la declaraci" #: lazarusidestrconsts:uemgotobookmark msgid "&Goto Bookmark" -msgstr "&Anar al marcador" +msgstr "&Vs al marcador" #: lazarusidestrconsts:lismenuhelp msgid "&Help" @@ -180,7 +180,7 @@ msgstr "A&juda" #: lazarusidestrconsts:uemopenfileatcursor msgid "&Open file at cursor" -msgstr "&Obrir fitxer al cursor" +msgstr "&Obre el fitxer al cursor" #: lazarusidestrconsts:lismenuproject msgid "&Project" @@ -192,23 +192,23 @@ msgstr "&Reempla #: lazarusidestrconsts:lismenurun msgid "&Run" -msgstr "E&xecutar" +msgstr "E&xecuta" #: lazarusidestrconsts:uemruntocursor msgid "&Run to Cursor" -msgstr "&Executar al cursor" +msgstr "&Executa al cursor" #: lazarusidestrconsts:lismenusearch msgid "&Search" -msgstr "&Buscar" +msgstr "&Cerca" #: lazarusidestrconsts:uemsetbookmark msgid "&Set Bookmark" -msgstr "Especificar &marcador" +msgstr "Especifica el &marcador" #: lazarusidestrconsts:dlgtexttofing msgid "&Text to Find" -msgstr "&Text a buscar" +msgstr "Cerca el &text" #: lazarusidestrconsts:lismenutools msgid "&Tools" @@ -216,7 +216,7 @@ msgstr "Eine&s" #: lazarusidestrconsts:lismenuview msgid "&View" -msgstr "&Veure" +msgstr "&Visualitza" #: lazarusidestrconsts:lismenuwindows msgid "&Windows" @@ -224,7 +224,7 @@ msgstr "F&inestres" #: lazarusidestrconsts:dlgbakdirectory msgid "(no subdirectoy)" -msgstr "(no sub-directori)" +msgstr "(sense subdirectori)" #: lazarusidestrconsts:listmunknownmacro msgid "(unknown macro: %s)" @@ -232,23 +232,23 @@ msgstr "(macroinstrucci #: lazarusidestrconsts:lislazarusversionstring msgid "0.9.7 beta" -msgstr "" +msgstr "0.9.7 beta" #: lazarusidestrconsts:lisa2pchooseanexistingfile msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts:lisctdefnovariableselected msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." -msgstr "" +msgstr "Un %s no pot manegar TControls. %sNoms hi podeu posar components no visuals." #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "Ja existeix un fitxer %s%s%s. %sEl substitueixo?" +msgstr "Ja existeix un fitxer %s%s%s. %sVoleu que el substitueixi?" #: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" @@ -256,7 +256,7 @@ msgstr "Una unitat Pascal ha de tenir l'extensi #: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." -msgstr "Un paquet necessari no ha estat trobat. Mira't la grfica de paquets" +msgstr "No s'ha trobat un paquet necessari. Mireu-vos la grfica dels paquets" #: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." @@ -264,11 +264,11 @@ msgstr "Una eina v #: lazarusidestrconsts:lismenuabortbuild msgid "Abort Build" -msgstr "Avortar muntatge" +msgstr "Avorta el muntatge" #: lazarusidestrconsts:lismenutemplateabout msgid "About" -msgstr "Quan a" +msgstr "Quant a" #: lazarusidestrconsts:lismenuaboutlazarus msgid "About Lazarus" @@ -276,7 +276,7 @@ msgstr "Quant al Lazarus" #: lazarusidestrconsts:srvk_accept msgid "Accept" -msgstr "Acceptar" +msgstr "Accepta" #: lazarusidestrconsts:liscodetoolsdefsaction msgid "Action: %s" @@ -284,107 +284,107 @@ msgstr "Acci #: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "Activar sintaxi d'expressins regulars pel texte i reemplaament (ms similar a perl)" +msgstr "Activa sintaxi d'expressins regulars pel texte i reemplaament (ms similar a perl)" #: lazarusidestrconsts:liscodetempladd msgid "Add" -msgstr "Afegir" +msgstr "Afegeix" #: lazarusidestrconsts:lisaddtoproject msgid "Add %s to project?" -msgstr "Afegir %s al projecte?" +msgstr "Voleu afegir %s al projecte?" #: lazarusidestrconsts:uemaddwatchatcursor msgid "Add &Watch At Cursor" -msgstr "Afegir &Vigilant al cursor" +msgstr "Afegeix &Control al cursor" #: lazarusidestrconsts:lisa2paddfile msgid "Add File" -msgstr "Afegir fitxer" +msgstr "Afegeix el fitxer" #: lazarusidestrconsts:lisa2paddfiles msgid "Add Files" -msgstr "Afegir fitxers" +msgstr "Afegeix els fitxers" #: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" -msgstr "Afegir fitxers LFM i LRS, si existeixen" +msgstr "Afegeix els fitxers LFM i LRS, si existeixen" #: lazarusidestrconsts:lisa2paddunit msgid "Add Unit" -msgstr "Afegir unitat" +msgstr "Afegeix la unitat" #: lazarusidestrconsts:lismenuaddcurunittopkg msgid "Add active unit to a package" -msgstr "Afegir unitat activa a un paquet" +msgstr "Afegeix la unitat activa a un paquet" #: lazarusidestrconsts:lispckeditaddanitem msgid "Add an item" -msgstr "Afegir un element" +msgstr "Afegeix un element" #: lazarusidestrconsts:lismenuaddbreakpoint msgid "Add breakpoint" -msgstr "Afegir un punt de trencament" +msgstr "Afegeix un punt de ruptura" #: lazarusidestrconsts:liscodetempladdcodetemplate msgid "Add code template" -msgstr "Afegir plantilla de codi" +msgstr "Afegeix la plantilla del codi" #: lazarusidestrconsts:lismenuaddtoproject msgid "Add editor file to Project" -msgstr "Afegir fitxer de l'editor al Projecte" +msgstr "Afegeix el fitxer de l'editor al Projecte" #: lazarusidestrconsts:lisprojaddeditorfile msgid "Add editor files" -msgstr "Afegir fitxers de l'editor" +msgstr "Afegeix els fitxers de l'editor" #: lazarusidestrconsts:lisaf2paddfiletoapackage msgid "Add file to a package" -msgstr "Afegir fitxer al paquet" +msgstr "Afegeix el fitxer a un paquet" #: lazarusidestrconsts:lisprojaddaddfiletoproject msgid "Add file to project:" -msgstr "Afegir fitxer al projecte" +msgstr "Afegeix el fitxer al projecte" #: lazarusidestrconsts:lisprojaddfiles msgid "Add files" -msgstr "Afegir fitxers" +msgstr "Afegeix els fitxers" #: lazarusidestrconsts:lisa2paddfilestopackage msgid "Add files to package" -msgstr "Afegir fitxers al paquet" +msgstr "Afegeix els fitxers al paquet" #: lazarusidestrconsts:srkmecaddjumppoint msgid "Add jump point" -msgstr "Afegir punt de salt" +msgstr "Afegeix un punt de salt" #: lazarusidestrconsts:lismenuaddjumppointtohistory msgid "Add jump point to history" -msgstr "Afegir punt de salt a la histria" +msgstr "Afegeix un punt de salt a la histria" #: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" -msgstr "Afegir opcions als paquets i projectes dependents" +msgstr "Afegeix les opcions en els paquets i projectes dependents" #: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" -msgstr "Afegir trajectries als paquets/projectes dependents" +msgstr "Afegeix les trajectries en els paquets/projectes dependents" #: lazarusidestrconsts:lisa2paddtopackage msgid "Add to package" -msgstr "Afegir al paquet" +msgstr "Afegeix al paquet" #: lazarusidestrconsts:lisprojaddtoproject msgid "Add to project" -msgstr "Afegir al projecte" +msgstr "Afegeix al projecte" #: lazarusidestrconsts:lismenuaddwatch msgid "Add watch ..." -msgstr "Afegir vigilant ..." +msgstr "Afegeix control ..." #: lazarusidestrconsts:dlgedadd msgid "Add..." -msgstr "Afegir..." +msgstr "Afegeix" #: lazarusidestrconsts:dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" @@ -396,15 +396,15 @@ msgstr "Opcions addicionals del compilador heretades dels paquets" #: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "Fitxers addicionals a buscar (p.e. /trajectria/*.pas;/trajec2/*.pp)" +msgstr "Fitxers addicionals a cercar (p.e. /trajectria/*.pas;/trajec2/*.pp)" #: lazarusidestrconsts:dlgadjusttopline msgid "Adjust top line due to comment in front" -msgstr "Ajustar la lnia de sobre a causa del comentari de davant" +msgstr "Ajusta la lnia de sobre a causa del comentari de davant" #: lazarusidestrconsts:fdmalignword msgid "Align" -msgstr "Alinear" +msgstr "Alinea" #: lazarusidestrconsts:lisalignment msgid "Alignment" @@ -420,11 +420,11 @@ msgstr "Tots els paquets" #: lazarusidestrconsts:dlglabelgoto msgid "Allow LABEL and GOTO" -msgstr "Permetre LABEL i GOTO" +msgstr "Permet LABEL i GOTO" #: lazarusidestrconsts:lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" -msgstr "Permetre buscar per mltiples lnies" +msgstr "Permet la recerca per mltiples lnies" #: lazarusidestrconsts:dlgalphabetically msgid "Alphabetically" @@ -436,51 +436,51 @@ msgstr "Alt" #: lazarusidestrconsts:dlgaltsetclmode msgid "Alt-Key sets column mode" -msgstr "La tecla alt defineix mode columna" +msgstr "La tecla d'alternativa defineix el mode columna" #: lazarusidestrconsts:srkmalternkey msgid "Alternative Key" -msgstr "Tecla alternativa" +msgstr "Tecla d'alternativa" #: lazarusidestrconsts:lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" -msgstr "Tipus d'avantpassat ambigu" +msgstr "" #: lazarusidestrconsts:lisa2pambiguousclassname msgid "Ambiguous Class Name" -msgstr "Nom de classe ambigu" +msgstr "" #: lazarusidestrconsts:lisa2pambiguousunitname msgid "Ambiguous Unit Name" -msgstr "Nom d'unitat ambigu" +msgstr "" #: lazarusidestrconsts:lisambiguousunitfound msgid "Ambiguous Unit found" -msgstr "He trobat unitat ambigua" +msgstr "" #: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" -msgstr "Fitxer de configuraci addicional ambigu" +msgstr "" #: lazarusidestrconsts:dlgambigfileact msgid "Ambiguous file action:" -msgstr "Acci ambigua del fitxer:" +msgstr "" #: lazarusidestrconsts:lisambiguousfilefound msgid "Ambiguous file found" -msgstr "He trobat un fitxer ambigu" +msgstr "" #: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" -msgstr "He trobat un fitxer ambigu: %s%s%s%sAquest fitxer pot ser confs amb %s%s%s%s%sEsborrar el fitxer ambigu?" +msgstr "" #: lazarusidestrconsts:lisambiguousfilesfound msgid "Ambiguous files found" -msgstr "He trobat fitxers ambigus" +msgstr "" #: lazarusidestrconsts:lispkgmangambiguousunitsfound msgid "Ambiguous units found" -msgstr "He trobat unitats ambiges" +msgstr "" #: lazarusidestrconsts:lisa2pancestortype msgid "Ancestor Type" @@ -488,7 +488,7 @@ msgstr "Tipus d'avantpassat" #: lazarusidestrconsts:lismakeresstrappendtosection msgid "Append to section" -msgstr "Afegir a la secci" +msgstr "Afegeix a la secci" #: lazarusidestrconsts:dlgpoapplication msgid "Application" @@ -500,15 +500,15 @@ msgstr "Par #: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "Aplicaci%sUn programa grfic lcl/freepascal. El fitxer de programa s mantingut automticament pel Lazarus" +msgstr "Aplicaci%sUn programa grfic lcl/freepascal. El Lazarus mant automticament el fitxer del programa" #: lazarusidestrconsts:dlgbutapply msgid "Apply" -msgstr "Aplicar" +msgstr "Aplica" #: lazarusidestrconsts:lispckeditapplychanges msgid "Apply changes" -msgstr "Aplicar canvis" +msgstr "Aplica els canvis" #: lazarusidestrconsts:rslanguagearabic msgid "Arabic" @@ -524,11 +524,11 @@ msgstr "Ascendent" #: lazarusidestrconsts:dlgenvask msgid "Ask" -msgstr "Demanar" +msgstr "Demana" #: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" -msgstr "Demanar abans de reemplaar cada text trobat" +msgstr "Demana abans de reemplaar cada text trobat" #: lazarusidestrconsts:liscodetoolsoptsat msgid "At" @@ -540,15 +540,15 @@ msgstr "Autor" #: lazarusidestrconsts:dlgautoform msgid "Auto create form when opening unit" -msgstr "Crear forma aut. quan s'obri unitat" +msgstr "Quan s'obri una unitat, crea la forma aut." #: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." -msgstr "Els nodes auto-generats no es poden editar, %sni poden tenir nodes fills" +msgstr "Els nodes generats automticament ni es poden editar, %sni poden tenir nodes fills" #: lazarusidestrconsts:dlgautodel msgid "Auto delete file" -msgstr "Esborrar fitxer automticament" +msgstr "Elimina el fitxer automticament" #: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." @@ -556,27 +556,27 @@ msgstr "Els nodes generats autom #: lazarusidestrconsts:dlgautoident msgid "Auto indent" -msgstr "Sagnar automticament" +msgstr "Sagna automticament" #: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" -msgstr "Muntar de nou automticament quan es munti tot" +msgstr "Munta de nou automticament quan es munti tot" #: lazarusidestrconsts:dlgautoren msgid "Auto rename file lowercase" -msgstr "" +msgstr "Canvia el nom del fitxer a minscules automticament" #: lazarusidestrconsts:dlgautosave msgid "Auto save" -msgstr "Guardar automticament" +msgstr "Desa automticament" #: lazarusidestrconsts:dlgautocreateforms msgid "Auto-create forms:" -msgstr "Crear automticament les formes" +msgstr "Crea les formes automticament" #: lazarusidestrconsts:lispckexplautocreated msgid "AutoCreated" -msgstr "AutoCreat" +msgstr "Creat automticament" #: lazarusidestrconsts:rslanguageautomatic msgid "Automatic (or english)" @@ -584,7 +584,7 @@ msgstr "Autom #: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" -msgstr "Incrementar la versi automticament en muntar" +msgstr "En muntar, incrementa la versi automticament" #: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" @@ -592,7 +592,7 @@ msgstr "Paquets instal #: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" -msgstr "Muntar de nou automticament quan es necessiti" +msgstr "Munta de nou automticament quan es necessiti" #: lazarusidestrconsts:dlgavailableforms msgid "Available forms:" @@ -604,11 +604,11 @@ msgstr "Paquets disponibles" #: lazarusidestrconsts:dlgedback msgid "Back" -msgstr "Tornar" +msgstr "Torna" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Color de fons" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -620,11 +620,11 @@ msgstr "C #: lazarusidestrconsts:lisbackupfilefailed msgid "Backup file failed" -msgstr "Cpia de seguretat fallida" +msgstr "Ha fallat la cpia de seguretat" #: lazarusidestrconsts:lisfrbackwardsearch msgid "Backward search" -msgstr "Recerca cap enrera" +msgstr "Recerca inversa" #: lazarusidestrconsts:dlgbehindmethods msgid "Behind methods" @@ -640,7 +640,7 @@ msgstr "Bloc" #: lazarusidestrconsts:dlgblockindent msgid "Block indent:" -msgstr "Sagnat bloc:" +msgstr "Sagna bloc:" #: lazarusidestrconsts:dlgedbold msgid "Bold" @@ -652,7 +652,7 @@ msgstr "Marcador" #: lazarusidestrconsts:lisbottomspaceequally msgid "Bottom space equally" -msgstr "Igualar espais inferiors" +msgstr "Iguala els espais inferiors" #: lazarusidestrconsts:lisbottoms msgid "Bottoms" @@ -660,27 +660,27 @@ msgstr "Inferiors" #: lazarusidestrconsts:dlgbrachighlight msgid "Bracket highlighting" -msgstr "Claudtor ressaltat" +msgstr "Ressalta el claudtor" #: lazarusidestrconsts:lismenubeaklinesinselection msgid "Break Lines in selection" -msgstr "Interrompre lnies en la selecci" +msgstr "Interromp les lnies en la selecci" #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" -msgstr "Interrompre lnia i moure el cursor" +msgstr "Interromp la lnia i mou el cursor" #: lazarusidestrconsts:srkmecinsertline msgid "Break line, leave cursor" -msgstr "Interrompre lnia, deixar el cursor" +msgstr "Interromp la lnia, deixa el cursor" #: lazarusidestrconsts:lismenuviewbreakpoints msgid "BreakPoints" -msgstr "Punts de trencament" +msgstr "Punts de ruptura" #: lazarusidestrconsts:fdmbringtofront msgid "Bring to front" -msgstr "Portar a primer pla" +msgstr "Porta a primer pla" #: lazarusidestrconsts:lisa2pbrokendependencies msgid "Broken Dependencies" @@ -692,91 +692,91 @@ msgstr "Depend #: lazarusidestrconsts:lispatheditbrowse msgid "Browse" -msgstr "Navegar" +msgstr "Navega" #: lazarusidestrconsts:lisbrowseforcompiler msgid "Browse for Compiler (%s)" -msgstr "Navegar pel Compilador (%s)" +msgstr "Navega pel Compilador (%s)" #: lazarusidestrconsts:dlgunitdepbrowse msgid "Browse..." -msgstr "Navegar..." +msgstr "Navega..." #: lazarusidestrconsts:lismenubuild msgid "Build" -msgstr "Muntar" +msgstr "Munta" #: lazarusidestrconsts:lisbuildcodetools msgid "Build CodeTools" -msgstr "Muntar les eines del codi" +msgstr "Munta les eines del codi" #: lazarusidestrconsts:lisbuildcomponent msgid "Build Component" -msgstr "Muntar el component" +msgstr "Munta el component" #: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools msgid "Build Components (SynEdit, CodeTools)" -msgstr "Muntar components (SynEdit, CodeTools)" +msgstr "Munta els components (SynEdit, CodeTools)" #: lazarusidestrconsts:lisbuildexamples msgid "Build Examples" -msgstr "Muntar exemples" +msgstr "Munta els exemples" #: lazarusidestrconsts:lismenubuildfile msgid "Build File" -msgstr "Muntar fitxer" +msgstr "Munta el fitxer" #: lazarusidestrconsts:lisbuildide msgid "Build IDE" -msgstr "Muntar IDE" +msgstr "Munta l'IDE" #: lazarusidestrconsts:lisbuildideintf msgid "Build IDE Interface" -msgstr "Muntar interfcie IDE" +msgstr "Munta l'interfcie IDE" #: lazarusidestrconsts:lisbuildjitform msgid "Build JIT Form" -msgstr "Muntar forma JIT" +msgstr "Munta la forma JIT" #: lazarusidestrconsts:lislazbuildbuildjitform msgid "Build JITForm" -msgstr "Muntar JITForm" +msgstr "Munta la forma JIT" #: lazarusidestrconsts:lisbuildlcl msgid "Build LCL" -msgstr "Muntar LCL" +msgstr "Munta la LCL" #: lazarusidestrconsts:lismenubuildlazarus msgid "Build Lazarus" -msgstr "Muntar Lazarus" +msgstr "Munta el Lazarus" #: lazarusidestrconsts:lisbuildnumber msgid "Build Number" -msgstr "Muntar Nmero" +msgstr "Munta el nmero" #: lazarusidestrconsts:lisbuildpkgreg msgid "Build Package Registration" -msgstr "Muntar Registre del Paquet" +msgstr "Munta el registre del paquet" #: lazarusidestrconsts:lisbuildstarter msgid "Build Starter" -msgstr "Muntar Iniciador" +msgstr "Munta l'iniciador" #: lazarusidestrconsts:lisbuildsynedit msgid "Build SynEdit" -msgstr "Muntar SynEdit" +msgstr "Munta el SynEdit" #: lazarusidestrconsts:lismenubuildall msgid "Build all" -msgstr "Muntar-ho Tot" +msgstr "Munta-ho Tot" #: lazarusidestrconsts:srkmecbuildlazarus msgid "Build lazarus" -msgstr "Muntar Lazarus" +msgstr "Munta el Lazarus" #: lazarusidestrconsts:lisbuildnewproject msgid "Build new project" -msgstr "Muntar projecte nou" +msgstr "Munta un projecte nou" #: lazarusidestrconsts:dlgcmacro msgid "C Style Macros (global)" @@ -792,23 +792,23 @@ msgstr "INLINE estil C++" #: lazarusidestrconsts:lismenuinsertcvskeyword msgid "CVS keyword" -msgstr "Paraula de pas de CVS" +msgstr "Paraula clau del CVS" #: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" -msgstr "Cridar %sRegistre%s procediment de l'unitat seleccionada" +msgstr "Crida %sRegistre%s procediment de l'unitat seleccionada" #: lazarusidestrconsts:lismenuviewcallstack msgid "Call Stack" -msgstr "Cridar pila" +msgstr "Pila de les Crides" #: lazarusidestrconsts:liscocallon msgid "Call on:" -msgstr "Visitar:" +msgstr "Marqueu:" #: lazarusidestrconsts:liscannotcopytoplevelcomponent msgid "Can not copy top level component." -msgstr "No es pot copiar component de nivell superior." +msgstr "No es pot copiar el component de nivell superior." #: lazarusidestrconsts:liscannotcreatefile msgid "Can not create file %s%s%s" @@ -816,15 +816,15 @@ msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" -msgstr "No es pot registrar components sense unitat" +msgstr "No es poden registrar els components sense unitat" #: lazarusidestrconsts:dlgcancel msgid "Cancel" -msgstr "Cancellar" +msgstr "Cancella" #: lazarusidestrconsts:liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" -msgstr "No es pot trobar iniciador Lazarus:%s%s" +msgstr "No es pot trobar l'iniciador del Lazarus:%s%s" #: lazarusidestrconsts:srvk_capital msgid "Capital" @@ -832,15 +832,15 @@ msgstr "Maj #: lazarusidestrconsts:lisdiffdlgcaseinsensitive msgid "Case Insensitive" -msgstr "No distingir entre majscules i minscules" +msgstr "No distingeixis entre majscules i minscules" #: lazarusidestrconsts:dlgcasesensitive msgid "Case Sensitive" -msgstr "Distingir entre majscules i minscules" +msgstr "Distingeix entre majscules i minscules" #: lazarusidestrconsts:lisfindfilecasesensitive msgid "Case sensitive" -msgstr "Distingir entre majscules i minscules" +msgstr "Distingeix entre majscules i minscules" #: lazarusidestrconsts:rslanguagecatalan msgid "Catalan" @@ -852,7 +852,7 @@ msgstr "Centra la l #: lazarusidestrconsts:liscenterinwindow msgid "Center in window" -msgstr "Centrar a la finestra" +msgstr "Centra a la finestra" #: lazarusidestrconsts:liscenters msgid "Centers" @@ -860,11 +860,11 @@ msgstr "Centres" #: lazarusidestrconsts:liscodetemplchange msgid "Change" -msgstr "Canviar" +msgstr "Canvia" #: lazarusidestrconsts:lischangeclass msgid "Change Class" -msgstr "Canviar Classe" +msgstr "Canvia la Classe" #: lazarusidestrconsts:lismenuinsertchangelogentry msgid "ChangeLog entry" @@ -876,7 +876,7 @@ msgstr "Fitxers canviats:" #: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "Canviar el nom del paquet o versi, trenca dependncies. S'haurien de canviar aquestes dependncies tamb?%sSelecciona Si per canviar totes les dependncies llistades.%sSelecciona Ignorar per trencar les dependncies i continuar." +msgstr "Canviar el nom del paquet o versi, trenca les dependncies. Voleu canviar aquestes dependncies tamb?%sSeleccioneu Si per canviar totes les dependncies llistades.%sSeleccioneu - Ignora - per trencar les dependncies i continuar." #: lazarusidestrconsts:srkmecchar msgid "Char" @@ -888,11 +888,11 @@ msgstr "Mapa de Car #: lazarusidestrconsts:lismenuchecklfm msgid "Check LFM file in editor" -msgstr "Comprova fitxer LFM en l'editor" +msgstr "Comprova el fitxer LFM en l'editor" #: lazarusidestrconsts:dlgcheckconsistency msgid "Check consistency" -msgstr "Verificar consistncia" +msgstr "Verifica la consistncia" #: lazarusidestrconsts:dlgcochecks msgid "Checks:" @@ -900,63 +900,63 @@ msgstr "Comprovacions:" #: lazarusidestrconsts:lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" -msgstr "Escollir projecte Delphi (*.dpr)" +msgstr "Tria un projecte Delphi (*.dpr)" #: lazarusidestrconsts:lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" -msgstr "Escollir unitat Delphi (*.pas)" +msgstr "Tria una unitat Delphi (*.pas)" #: lazarusidestrconsts:lisctdefchoosedirectory msgid "Choose Directory" -msgstr "Escollir Directori" +msgstr "Tria un directori" #: lazarusidestrconsts:lischoosefpcsourcedir msgid "Choose FPC source directory" -msgstr "Escollir directori de codi font del FPC" +msgstr "Tria un directori del codi font del FPC" #: lazarusidestrconsts:lischooselazarussourcedirectory msgid "Choose Lazarus Directory" -msgstr "Escollir directori Lazarus" +msgstr "Tria un directori del Lazarus" #: lazarusidestrconsts:lisedoptschoosescheme msgid "Choose Scheme" -msgstr "Escollir Esquema" +msgstr "Tria un Esquema" #: lazarusidestrconsts:lischooseadifferentname msgid "Choose a different name" -msgstr "Escollir un nom diferent" +msgstr "Tria un nom diferent" #: lazarusidestrconsts:dlgchscodetempl msgid "Choose code template file (*.dci)" -msgstr "Escollir fitxer de plantilla (*.dci)" +msgstr "Tria un fitxer de plantilla (*.dci)" #: lazarusidestrconsts:lischoosecompilerpath msgid "Choose compiler filename (%s)" -msgstr "escollir nom del fitxer del compilador (%s)" +msgstr "Tria el nom del fitxer del compilador (%s)" #: lazarusidestrconsts:lischoosedebuggerpath msgid "Choose debugger filename" -msgstr "Escollir nom del depurador" +msgstr "Tria el nom del depurador" #: lazarusidestrconsts:lischoosedirectory msgid "Choose directory" -msgstr "Escollir directori" +msgstr "Tria el directori" #: lazarusidestrconsts:lischoosemakepath msgid "Choose make path" -msgstr "Escollir trajectria per a construir" +msgstr "Tria la trajectria per a crear" #: lazarusidestrconsts:lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "Escollir codi font del programa (*.pp, *.pas, *.lpr)" +msgstr "Tria el codi font del programa (*.pp, *.pas, *.lpr)" #: lazarusidestrconsts:lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" -msgstr "Escollir estructura per contenir selecci" +msgstr "Tria l'estructura per a contenir la selecci" #: lazarusidestrconsts:lischoosetestbuilddir msgid "Choose the directory for tests" -msgstr "Escollir el directori per les proves" +msgstr "Tria el directori per a les proves" #: lazarusidestrconsts:lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" @@ -968,11 +968,11 @@ msgstr "La classe %s%s%s no est #: lazarusidestrconsts:lisa2pclassnamealreadyexists msgid "Class Name already exists" -msgstr "El nom de classe ja existeix" +msgstr "Ja existeix el nom de la classe" #: lazarusidestrconsts:lisclassnotfound msgid "Class not found" -msgstr "Classe no trobada" +msgstr "No s'ha trobat la classe" #: lazarusidestrconsts:dlgcdtclassorder msgid "Class order" @@ -984,47 +984,47 @@ msgstr "Pol #: lazarusidestrconsts:liscldircleandirectory msgid "Clean Directory" -msgstr "Netejar directori" +msgstr "Neteja el directori" #: lazarusidestrconsts:liscleanlazarussource msgid "Clean Lazarus Source" -msgstr "Netejar el codi Lazarus" +msgstr "Neteja el codi del Lazarus" #: lazarusidestrconsts:lislazbuildcleanall msgid "Clean all" -msgstr "Netejar-ho tot" +msgstr "Neteja-ho tot" #: lazarusidestrconsts:lismenucleandirectory msgid "Clean directory" -msgstr "Netejar directori" +msgstr "Neteja el directori" #: lazarusidestrconsts:liscldircleansubdirectories msgid "Clean sub directories" -msgstr "Netejar subdirectoris" +msgstr "Neteja els subdirectoris" #: lazarusidestrconsts:lislazbuildcleanbuild msgid "Clean+Build" -msgstr "Netejar i muntar" +msgstr "Neteja i munta" #: lazarusidestrconsts:srvk_clear msgid "Clear" -msgstr "Netejar" +msgstr "Neteja" #: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" -msgstr "Fer un clic en els elements d'amunt per veure les diferencies" +msgstr "Feu un clic en els elements d'amunt per veure'n les diferencies" #: lazarusidestrconsts:lismenuclose msgid "Close" -msgstr "Tancar" +msgstr "Tanca" #: lazarusidestrconsts:srkmeccloseall msgid "Close all" -msgstr "Tancar tot" +msgstr "Tanca-ho tot" #: lazarusidestrconsts:lismenucloseall msgid "Close all editor files" -msgstr "Tancar tots els fitxers de l'editor" +msgstr "Tanca tots els fitxers de l'editor" #: lazarusidestrconsts:dlgcodegeneration msgid "Code" @@ -1048,7 +1048,7 @@ msgstr "Par #: lazarusidestrconsts:srkmecautocompletion msgid "Code template completion" -msgstr "Completar plantilla de codi" +msgstr "Completa la plantilla del codi" #: lazarusidestrconsts:dlgedcodetempl msgid "Code templates" @@ -1056,19 +1056,19 @@ msgstr "Plantilles del codi" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" -msgstr "Editor Definicions CodeTools" +msgstr "Editor de les definicions de les eines del codi" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" -msgstr "Vista Prvia Definicions CodeTools" +msgstr "Vista Prvia de les definicions de les eines del codi" #: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" -msgstr "Valors del Directori de CodeTools" +msgstr "Valors del directori de les eines del codi" #: lazarusidestrconsts:dlgcodetoolsopts msgid "CodeTools Options" -msgstr "Opcions de CodeTools" +msgstr "Opcions de les eines del codi" #: lazarusidestrconsts:srkmcatcodetools msgid "CodeTools commands" @@ -1084,15 +1084,15 @@ msgstr "Opcions de les eines del codi" #: lazarusidestrconsts:srkmeccodetoolsdefinesed msgid "Codetools defines editor" -msgstr "Editor de definicions de CodeTools" +msgstr "Editor de les definicions de les eines del codi" #: lazarusidestrconsts:srkmeccodetoolsoptions msgid "Codetools options" -msgstr "Opcions de CodeTools" +msgstr "Opcions de les eines del codi" #: lazarusidestrconsts:lismenucollectpofil msgid "Collect .po files" -msgstr "Recollir fitxers .po" +msgstr "Recull els fitxers .po" #: lazarusidestrconsts:liscodetoolsoptscolon msgid "Colon" @@ -1132,7 +1132,7 @@ msgstr "Ordre despr #: lazarusidestrconsts:srkmcatcmdcmd msgid "Command commands" -msgstr "Ordres d'instruccions" +msgstr "Ordres de les instruccions" #: lazarusidestrconsts:dlgcommandlineparams msgid "Command line parameters (without application name)" @@ -1148,7 +1148,7 @@ msgstr "Ordre:" #: lazarusidestrconsts:lismenucommentselection msgid "Comment selection" -msgstr "Comentar selecci" +msgstr "Comenta la selecci" #: lazarusidestrconsts:liscodetemplcomment msgid "Comment:" @@ -1160,23 +1160,23 @@ msgstr "Compilaci #: lazarusidestrconsts:liscocalloncompile msgid "Compile" -msgstr "Compilar" +msgstr "Compila" #: lazarusidestrconsts:liscompileidewithoutlinking msgid "Compile IDE (without linking)" -msgstr "Compilar IDE (sense enllaar)" +msgstr "Compila l'IDE (sense enllaar)" #: lazarusidestrconsts:lispckeditcompileeverything msgid "Compile everything?" -msgstr "Compilar-ho tot?" +msgstr "Voleu compilar-ho tot?" #: lazarusidestrconsts:lispckeditcompilepackage msgid "Compile package" -msgstr "Compilar paquet" +msgstr "Compila el paquet" #: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" -msgstr "Afegir CompiledSrcPath" +msgstr "Afegeix CompiledSrcPath" #: lazarusidestrconsts:liscompiler msgid "Compiler" @@ -1196,11 +1196,11 @@ msgstr "Opcions del compilador pel projecte: %s" #: lazarusidestrconsts:lismenucompileroptions msgid "Compiler Options..." -msgstr "Opcions del compilador" +msgstr "Opcions del compilador..." #: lazarusidestrconsts:liscompilererror msgid "Compiler error" -msgstr "Error del compilador" +msgstr "S'ha produt un error del compilador" #: lazarusidestrconsts:liscompilerfilename msgid "Compiler filename" @@ -1212,15 +1212,15 @@ msgstr "Traject #: lazarusidestrconsts:lismenucompletecode msgid "Complete Code" -msgstr "Completar el codi" +msgstr "Completa el codi" #: lazarusidestrconsts:srkmeccompletecode msgid "Complete code" -msgstr "Completar el codi" +msgstr "Completa el codi" #: lazarusidestrconsts:dlgcompleteproperties msgid "Complete properties" -msgstr "Completar propietats" +msgstr "Completa les propietats" #: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" @@ -1244,43 +1244,43 @@ msgstr "Fitxers de configuraci #: lazarusidestrconsts:lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" -msgstr "Configurar %sMuntar Lazarus%s" +msgstr "Configura %sMunta el Lazarus%s" #: lazarusidestrconsts:lismenuconfigbuildfile msgid "Configure Build+Run File" -msgstr "Configurar fitxer de muntatje/execuci" +msgstr "Configura fitxer de muntatje/execuci" #: lazarusidestrconsts:lismenuconfigurehelp msgid "Configure Help" -msgstr "Configurar ajuda" +msgstr "Configura l'ajuda" #: lazarusidestrconsts:lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" -msgstr "Configurar \"Muntar Lazarus\"" +msgstr "Configura \"Munta el Lazarus\"" #: lazarusidestrconsts:lismenuconfigcustomcomps msgid "Configure custom components" -msgstr "Configurar els components personalitzats" +msgstr "Configura els components personalitzats" #: lazarusidestrconsts:lismenusettings msgid "Configure custom tools ..." -msgstr "Configurar les eines personalitzades ..." +msgstr "Configura les eines personalitzades ..." #: lazarusidestrconsts:lismenueditinstallpkgs msgid "Configure installed packages" -msgstr "Configurar paquets intallats" +msgstr "Configura els paquets intallats" #: lazarusidestrconsts:lisconfirmchanges msgid "Confirm changes" -msgstr "Confirmar canvis" +msgstr "Confirma els canvis" #: lazarusidestrconsts:lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" -msgstr "Confirmar esborrar dependncies" +msgstr "Confirma l'eliminaci de les dependncies" #: lazarusidestrconsts:lisprojinspconfirmremovingfile msgid "Confirm removing file" -msgstr "Confirmar esborrar fitxer" +msgstr "Confirma l'eliminaci del fitxer" #: lazarusidestrconsts:srkmconflic msgid "Conflict " @@ -1312,59 +1312,59 @@ msgstr "Opcions de conversi #: lazarusidestrconsts:lisconversionerror msgid "Conversion error" -msgstr "Error de conversi" +msgstr "S'ha produt un error de conversi" #: lazarusidestrconsts:srvk_convert msgid "Convert" -msgstr "Convertir" +msgstr "Converteix" #: lazarusidestrconsts:lismenuconvertdfmtolfm msgid "Convert DFM file to LFM" -msgstr "Convertir fitxer DFM a LFM" +msgstr "Converteix el fitxer DFM a LFM" #: lazarusidestrconsts:lismenuconvertdelphiproject msgid "Convert Delphi Project to Lazarus Project" -msgstr "Convertit projecte Delphi a projecte Lazarus" +msgstr "Converteix el projecte Delphi a projecte Lazarus" #: lazarusidestrconsts:lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit" -msgstr "Convertir unitat Delphi a unitat Lazarus" +msgstr "Converteix la unitat Delphi a unitat Lazarus" #: lazarusidestrconsts:liscodetoolsdefsconvertnode msgid "Convert node" -msgstr "Convertir el node" +msgstr "Converteix el node" #: lazarusidestrconsts:srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" -msgstr "Convertir tabuladors en espais en la selecci" +msgstr "Converteix els tabuladors en espais en la selecci" #: lazarusidestrconsts:lismenucopy msgid "Copy" -msgstr "Copiar" +msgstr "Copia" #: lazarusidestrconsts:liscopyerror msgid "Copy Error" -msgstr "Error de cpia" +msgstr "S'ha produt un error de cpia" #: lazarusidestrconsts:liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" -msgstr "Copiar tots els missatges al porta-retalls" +msgstr "Copia tots els missatges al porta-retalls" #: lazarusidestrconsts:liscopyerror2 msgid "Copy error" -msgstr "Error de cpia" +msgstr "S'ha produt un error de cpia" #: lazarusidestrconsts:lisdsgcopycomponents msgid "Copy selected components to clipboard" -msgstr "Copiar els components seleccionats al porta-retalls" +msgstr "Copia els components seleccionats al porta-retalls" #: lazarusidestrconsts:srkmeccopy msgid "Copy selection to clipboard" -msgstr "Copiar la selecci al porta-retalls" +msgstr "Copia la selecci al porta-retalls" #: lazarusidestrconsts:dlgcopywordatcursoroncopynone msgid "Copy word on copy none" -msgstr "Copiar paraula en no copiar-ne cap" +msgstr "Copia paraula abans de no copiar-la" #: lazarusidestrconsts:liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." @@ -1384,91 +1384,91 @@ msgstr "Comptador (.pp;1)" #: lazarusidestrconsts:lisnpcreate msgid "Create" -msgstr "Crear" +msgstr "Crea" #: lazarusidestrconsts:lismenucreatepofile msgid "Create .po files" -msgstr "Crear fitxers .po" +msgstr "Crea els fitxers .po" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" -msgstr "Crear definicions pel directori %s" +msgstr "Crea les definicions pel directori %s" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" -msgstr "Crear definicions pel projecte %s" +msgstr "Crea les definicions pel projecte %s" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcvssources msgid "Create Defines for Free Pascal CVS Sources" -msgstr "Crear definicions per les fonts CVS del Free Pascal" +msgstr "Crea les definicions per les fonts CVS del Free Pascal" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" -msgstr "Crear definicions pel compilador Free Pascal" +msgstr "Crea les definicions pel compilador Free Pascal" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" -msgstr "Crear definicions pel directori del Lazarus" +msgstr "Crea les definicions pel directori del Lazarus" #: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" -msgstr "Crear macroinstruccions FPC i trajectries per un directori de projecte FPC" +msgstr "Crea les macroinstruccions FPC i les trajectries per un directori de projecte FPC" #: lazarusidestrconsts:lismenueditorcreatesubmenu msgid "Create Submenu" -msgstr "Crear submen" +msgstr "Crea submen" #: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "Crear una nova aplicaci dgi.%sEl fitxer del programa est mantingut pel Lazarus." +msgstr "Crea una nova aplicaci cgi.%sEl Lazarus mant el fitxer del programa." #: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." -msgstr "Crear un nou fitxer d'editor.%sEscull-ne un tipus" +msgstr "Crea un nou fitxer d'editor.%sEscolliu-ne un tipus" #: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." -msgstr "Crear un nou fitxer de text buit." +msgstr "Crea un nou fitxer de text buit." #: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "Crear una nova aplicaci grfica.%sEl fitxer del programa est mantingut pel Lazarus" +msgstr "Crea una nova aplicaci grfica.%sEl Lazarus mant el fitxer del programa" #: lazarusidestrconsts:lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." -msgstr "Crear una nova unitat Pascal." +msgstr "Crea una nova unitat Pascal." #: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram msgid "Create a new program." -msgstr "Crear un nou programa." +msgstr "Crea un nou programa." #: lazarusidestrconsts:lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "Crear un nou programa.%sEl fitxer del programa est mantingut pel Lazarus." +msgstr "Crea un nou programa.%sEl Lazarus mant el fitxer del programa." #: lazarusidestrconsts:lisnpcreateanewproject msgid "Create a new project" -msgstr "Crear un nou projecte" +msgstr "Crea un nou projecte" #: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." -msgstr "Crear un nou projecte.%sEscull-ne un tipus." +msgstr "Crea un nou projecte.%sEscolliu-ne un tipus." #: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "Crear un nou paquet normalitzat.%sUn paquet s una collecci d'unitats i components." +msgstr "Crea un nou paquet normalitzat.%sUn paquet s una collecci d'unitats i components." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." -msgstr "Crear una nova unitat amb una forma LCL." +msgstr "Crea una nova unitat amb una forma LCL." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." -msgstr "Crear una nova unitat amb un mdul de dades." +msgstr "Crea una nova unitat amb un mdul de dades." #: lazarusidestrconsts:liscreateaprojectfirst msgid "Create a project first!" -msgstr "Crear primer un projecte!" +msgstr "Creeu primer un projecte!" #: lazarusidestrconsts:dlgruberbandcreationcolor msgid "Creation" @@ -1508,7 +1508,7 @@ msgstr "Ordres de moviment del cursor" #: lazarusidestrconsts:liscursorrowincurrenteditor msgid "Cursor row in current editor" -msgstr "Lnia del cursor en l'editor actual" +msgstr "La lnia del cursor en l'editor actual" #: lazarusidestrconsts:lispckoptscustom msgid "Custom" @@ -1544,19 +1544,19 @@ msgstr "Eina personalitzada %d" #: lazarusidestrconsts:lismenucut msgid "Cut" -msgstr "Tallar" +msgstr "Talla" #: lazarusidestrconsts:lisdsgcutcomponents msgid "Cut selected components to clipboard" -msgstr "Tallar els components seleccionats al porta-retalls" +msgstr "Retalla els components seleccionats al porta-retalls" #: lazarusidestrconsts:srkmeccut msgid "Cut selection to clipboard" -msgstr "Retallar la selecci al porta-retalls" +msgstr "Retalla la selecci al porta-retalls" #: lazarusidestrconsts:lishlpoptsdatabases msgid "Databases" -msgstr "BaseDades" +msgstr "Base de dades" #: lazarusidestrconsts:lisdate msgid "Date" @@ -1568,11 +1568,11 @@ msgstr "Depuraci #: lazarusidestrconsts:lismenuviewdebugoutput msgid "Debug output" -msgstr "Sortida Depuraci" +msgstr "Sortida de depuraci" #: lazarusidestrconsts:lismenudebugwindows msgid "Debug windows" -msgstr "Finestres Depuraci" +msgstr "Finestres de depuraci" #: lazarusidestrconsts:lismendebuggeroptions msgid "Debugger Options" @@ -1580,11 +1580,11 @@ msgstr "Opcions del depurador" #: lazarusidestrconsts:lisdebuggererror msgid "Debugger error" -msgstr "Error del depurador" +msgstr "S'ha produt un error del depurador" #: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "Error del depurador%sAtenci!! el depurador a entrat en estat d'error%sGuarda el teu treball ara mateix!!%sPrem Stop i creua els dits ..." +msgstr "S'ha produt un error del depurador%sAtenci!! el depurador a entrat en estat d'error%sDeseu el vostre treball ara mateix!!%sPremeu Atura i espereu el millor ..." #: lazarusidestrconsts:lisdebuggerinvalid msgid "Debugger invalid" @@ -1592,7 +1592,7 @@ msgstr "Depurador inv #: lazarusidestrconsts:dlgcodebugpath msgid "Debugger path addition (none):" -msgstr "Afegir trajectria addicional del depurador (cap):" +msgstr "Afegeix la trajectria addicional del depurador (cap):" #: lazarusidestrconsts:dlgdebugtype msgid "Debugger type and path" @@ -1614,13 +1614,17 @@ msgstr "Font de l'editor predeterminat" msgid "Default pascal extension" msgstr "Extensi Pascal predeterminada" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" -msgstr "Definir" +msgstr "Defineix" #: lazarusidestrconsts:liscodetoolsdefsdefinerecurse msgid "Define Recurse" -msgstr "Definir recurs" +msgstr "Defineix el recurs" #: lazarusidestrconsts:dlgeddelay msgid "Delay" @@ -1628,39 +1632,39 @@ msgstr "Retard" #: lazarusidestrconsts:dlgeddelete msgid "Delete" -msgstr "Esborrar" +msgstr "Elimina" #: lazarusidestrconsts:lismenueditordeletefromtemplate msgid "Delete From Template..." -msgstr "Esborrar desde la plantilla..." +msgstr "Elimina desde la plantilla..." #: lazarusidestrconsts:lismenueditordeleteitem msgid "Delete Item" -msgstr "Esborrar element" +msgstr "Elimina l'element" #: lazarusidestrconsts:srkmecdeletelastchar msgid "Delete Last Char" -msgstr "Esborrar l'ltim carcter" +msgstr "Elimina l'ltim carcter" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" -msgstr "Esborrar fitxer de paquet antic?" +msgstr "Voleu eliminar el fitxer de paquet antic?" #: lazarusidestrconsts:lisdeleteambiguousfile msgid "Delete ambiguous file?" -msgstr "Esborrar fitxer ambigu?" +msgstr "" #: lazarusidestrconsts:srkmecdeletechar msgid "Delete char at cursor" -msgstr "Esborrar el carcter al cursor" +msgstr "Elimina el carcter al cursor" #: lazarusidestrconsts:srkmecdeleteline msgid "Delete current line" -msgstr "Esborrar lnia actual" +msgstr "Elimina la lnia actual" #: lazarusidestrconsts:lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" -msgstr "Esborrar dependncia per %s?" +msgstr "Voleu eliminar la dependncia per %s?" #: lazarusidestrconsts:lispkgmangdeletefailed msgid "Delete failed" @@ -1672,43 +1676,43 @@ msgstr "Ha fallat l'eliminaci #: lazarusidestrconsts:liscodetoolsdefsdeletenode msgid "Delete node" -msgstr "Esborrar el node" +msgstr "Elimina el node" #: lazarusidestrconsts:lisdeleteoldfile msgid "Delete old file %s%s%s?" -msgstr "Esborrat fitxer vell %s%s%s?" +msgstr "Voleu eliminar el fitxer antic %s%s%s?" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" -msgstr "Esborrar fitxer de paquet vell %s%s%s?" +msgstr "Voleu eliminar el fitxer de paquet antic %s%s%s?" #: lazarusidestrconsts:fdmdeleteselection msgid "Delete selection" -msgstr "Esborrar la selecci" +msgstr "Elimina la selecci" #: lazarusidestrconsts:dlgdeltemplate msgid "Delete template " -msgstr "Esborrar plantilla" +msgstr "Elimina la plantilla" #: lazarusidestrconsts:srkmecdeletebol msgid "Delete to beginning of line" -msgstr "Esborrar fins al comenament de la lnia" +msgstr "Elimina fins al comenament de la lnia" #: lazarusidestrconsts:srkmecdeleteeol msgid "Delete to end of line" -msgstr "Esborrar fins al final de la lnia" +msgstr "Elimina fins al final de la lnia" #: lazarusidestrconsts:srkmecdeleteword msgid "Delete to end of word" -msgstr "Esborrar fins el final de la paraula" +msgstr "Elimina fins al final de la paraula" #: lazarusidestrconsts:srkmecdeletelastword msgid "Delete to start of word" -msgstr "Esborrar fins el principi de la paraula" +msgstr "Elimina fins el principi de la paraula" #: lazarusidestrconsts:srkmecclearall msgid "Delete whole text" -msgstr "Esborrar tot el text" +msgstr "Elimina tot el text" #: lazarusidestrconsts:lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." @@ -1728,7 +1732,7 @@ msgstr "Depend #: lazarusidestrconsts:lispckeditdependencyproperties msgid "Dependency Properties" -msgstr "Propietats de dependncia" +msgstr "Propietats de la dependncia" #: lazarusidestrconsts:lisprojadddependencyalreadyexists msgid "Dependency already exists" @@ -1776,15 +1780,15 @@ msgstr "Escriptori" #: lazarusidestrconsts:dlgdesktopfiles msgid "Desktop files" -msgstr "Fitxers d'escriptori" +msgstr "Fitxers de l'escriptori" #: lazarusidestrconsts:lisaf2pdestinationpackage msgid "Destination Package" -msgstr "Paquet destinaci" +msgstr "Paquet de destinaci" #: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." -msgstr "El directori de destinaci %s%s%s s incorrecte.%sSi us plau, escull una trajectria completa." +msgstr "El directori de destinaci %s%s%s no s correcte.%sSi us plau, escolliu-ne la trajectria completa." #: lazarusidestrconsts:rslanguagedeutsch msgid "Deutsch" @@ -1792,7 +1796,7 @@ msgstr "Alemany" #: lazarusidestrconsts:lismenudiff msgid "Diff" -msgstr "Diff" +msgstr "Mostra les diferncies" #: lazarusidestrconsts:dlgdirection msgid "Direction" @@ -1808,11 +1812,11 @@ msgstr "El directori no existeix" #: lazarusidestrconsts:dlgtestprjdir msgid "Directory for building test projects" -msgstr "Directori per a muntar projectes de prova" +msgstr "Directori per a muntar els projectes de prova" #: lazarusidestrconsts:lisenvoptdlgdirectorynotfound msgid "Directory not found" -msgstr "Directori no trobat" +msgstr "No s'ha trobat el directori" #: lazarusidestrconsts:lisfindfiledirectoryoptions msgid "Directory options" @@ -1820,31 +1824,31 @@ msgstr "Opcions del directori" #: lazarusidestrconsts:dlgeddisplay msgid "Display" -msgstr "Veure a pantalla" +msgstr "Visualitza a pantalla" #: lazarusidestrconsts:dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" -msgstr "Pantalla(no per win32, p.e. 198.112.45.11:0, x.org:1, hydra:0.1)" +msgstr "Pantalla(no per win32, p.ex. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts:dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" -msgstr "Mostrar nmeros de lnia en errors en temps d'execuci en seguiments inversos" +msgstr "Mostra els nmeros de lnia en errors en temps d'execuci en seguiments inversos" #: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" -msgstr "Distingir lletres grans i petites p.e. A i a" +msgstr "Distingeix entre lletres grans i petites p.ex. A i a" #: lazarusidestrconsts:dlgnotsplitlinefront msgid "Do not split line In front of:" -msgstr "No separar la lnia abans de:" +msgstr "No separis la lnia abans de:" #: lazarusidestrconsts:dlgnotsplitlineafter msgid "Do not split line after:" -msgstr "No separar la lnia desprs de:" +msgstr "No separis la lnia desprs de:" #: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" -msgstr "Vols obviar tots els canvis al paquet %s i recarregar-lo del fitxer?" +msgstr "Voleu obviar tots els canvis del paquet %s i recarregar-lo del fitxer?" #: lazarusidestrconsts:rsiwpdocked msgid "Docked" @@ -1860,7 +1864,7 @@ msgstr "Domini" #: lazarusidestrconsts:dlgdoubleclickline msgid "Double click line" -msgstr "Fer doble clic a la lnia" +msgstr "Fes doble clic a la lnia" #: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" @@ -1876,7 +1880,7 @@ msgstr "Edici #: lazarusidestrconsts:dlgdropfiles msgid "Drop files" -msgstr "Deixar anar fitxers" +msgstr "Deixa anar els fitxers" #: lazarusidestrconsts:lismenuenvironent msgid "E&nvironment" @@ -1884,35 +1888,35 @@ msgstr "E&ntorn" #: lazarusidestrconsts:liscodetoolsdefsedit msgid "Edit" -msgstr "Editar" +msgstr "Edita" #: lazarusidestrconsts:lispckediteditgeneraloptions msgid "Edit General Options" -msgstr "Editar opcions generals" +msgstr "Edita les opcions generals" #: lazarusidestrconsts:srkmeditkeys msgid "Edit Keys" -msgstr "Editar tecles" +msgstr "Edita les tecles" #: lazarusidestrconsts:lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" -msgstr "Editar opcions per compilar el paquet" +msgstr "Edita les opcions per a compilar el paquet" #: lazarusidestrconsts:lisedtexttooledittool msgid "Edit Tool" -msgstr "Editar eina" +msgstr "Edita l'eina" #: lazarusidestrconsts:liscodetempleditcodetemplate msgid "Edit code template" -msgstr "Editar plantilla de codi" +msgstr "Edita la plantilla del codi" #: lazarusidestrconsts:srkmeditforcmd msgid "Edit keys for command" -msgstr "Editar tecles per l'ordre" +msgstr "Edita les tecles per l'ordre" #: lazarusidestrconsts:dlgededit msgid "Edit..." -msgstr "Editar..." +msgstr "Edita" #: lazarusidestrconsts:dlgedfiles msgid "Editor files" @@ -1924,7 +1928,7 @@ msgstr "Font de l'editor" #: lazarusidestrconsts:dlgeditorfontheight msgid "Editor font height" -msgstr "Alada de fonts de l'editor" +msgstr "Alada fonts editor" #: lazarusidestrconsts:lismenueditoroptions msgid "Editor options" @@ -1948,15 +1952,15 @@ msgstr "ElseIf" #: lazarusidestrconsts:lisenclose msgid "Enclose" -msgstr "Contenir" +msgstr "Tanca" #: lazarusidestrconsts:uemencloseselection msgid "Enclose Selection" -msgstr "Contenir selecci" +msgstr "Tanca la selecci" #: lazarusidestrconsts:lismenuencloseselection msgid "Enclose selection" -msgstr "Contenir selecci" +msgstr "Tanca la selecci" #: lazarusidestrconsts:srvk_end msgid "End" @@ -1968,15 +1972,15 @@ msgstr "Angl #: lazarusidestrconsts:lismacropromptenterdata msgid "Enter data" -msgstr "Entrar dades" +msgstr "Entra les dades" #: lazarusidestrconsts:lismacropromptenterrunparameters msgid "Enter run parameters" -msgstr "Entrar parmetres d'execuci" +msgstr "Entra els parmetres d'execuci" #: lazarusidestrconsts:lisentertransla msgid "Enter translation language" -msgstr "Entrar llenguatge de traducci" +msgstr "Entra el llenguatge de traducci" #: lazarusidestrconsts:dlgentirescope msgid "Entire Scope" @@ -1996,95 +2000,95 @@ msgstr "Opcions de l'entorn" #: lazarusidestrconsts:liscodetemplerror msgid "Error" -msgstr "Error" +msgstr "S'ha produt un error" #: lazarusidestrconsts:lispkgmangerrorreadingpackage msgid "Error Reading Package" -msgstr "Error llegint paquet" +msgstr "S'ha produt un error mentre es llegia el paquet" #: lazarusidestrconsts:lispkgmangerrorwritingpackage msgid "Error Writing Package" -msgstr "Error escrivint paquet" +msgstr "S'ha produt un error mentre s'escrivia el paquet" #: lazarusidestrconsts:liserrorcreatingfile msgid "Error creating file" -msgstr "Error creant fitxer" +msgstr "S'ha produt un error mentre es creava el fitxer" #: lazarusidestrconsts:liserrorcreatinglrs msgid "Error creating lrs" -msgstr "Error creant lrs" +msgstr "S'ha produt un error mentre es creava lrs" #: lazarusidestrconsts:liserrordeletingfile msgid "Error deleting file" -msgstr "Error esborrant fitxer" +msgstr "S'ha produt un error mentre s'eliminava el fitxer" #: lazarusidestrconsts:liserrorin msgid "Error in %s" -msgstr "Error a %s" +msgstr "Hi ha un error a %s" #: lazarusidestrconsts:lisueerrorinregularexpression msgid "Error in regular expression" -msgstr "Error en expressi regular" +msgstr "Hi ha un error a l'expressi regular" #: lazarusidestrconsts:liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" -msgstr "Error inicialitzant programa%s%s%s%s%sError: %s" +msgstr "S'ha produt un error mentre s'inicialitzava el programa%s%s%s%s%sError: %s" #: lazarusidestrconsts:liserrormovingcomponent msgid "Error moving component" -msgstr "Error movent component" +msgstr "S'ha produt un error mentre es movia el component" #: lazarusidestrconsts:liserrormovingcomponent2 msgid "Error moving component %s:%s" -msgstr "Error movent component %s:%s" +msgstr "S'ha produt un error mentre es movia el component %s:%s" #: lazarusidestrconsts:liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" -msgstr "Error llegint %s%s%s%s%s" +msgstr "S'ha produt un error mentre es llegia %s%s%s%s%s" #: lazarusidestrconsts:lispkgmangerrorreadingfile msgid "Error reading file" -msgstr "Error llegint fitxer" +msgstr "S'ha produt un error mentre es llegia el fitxer" #: lazarusidestrconsts:lisdiskdifferrorreadingfile msgid "Error reading file: %s" -msgstr "Error llegint fitxer" +msgstr "S'ha produt un error mentre es llegia el fitxer: %s" #: lazarusidestrconsts:liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" -msgstr "Error llegint llista de paquets des del fitxer%s%s%s%s" +msgstr "S'ha produt un error mentre es llegia la llista de paquets des del fitxer%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" -msgstr "Error mentre llegia el fitxer d'informaci del projecte %s%s%s%s%s" +msgstr "S'ha produt un error mentre es llegia el fitxer d'informaci del projecte %s%s%s%s%s" #: lazarusidestrconsts:liserrorrenamingfile msgid "Error renaming file" -msgstr "Error canviant el nom del fitxer" +msgstr "S'ha produt un error mentre es canviava el nom del fitxer" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" -msgstr "Error mentre escrivia %s%s%s%s%s" +msgstr "S'ha produt un error mentre s'escrivia %s%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" -msgstr "Error mentre escrivia informaci del projecte al fitxer %s%s%s%s%s" +msgstr "S'ha produt un error mentre s'escrivia l'informaci del projecte al fitxer %s%s%s%s%s" #: lazarusidestrconsts:lispkgmangerrorwritingfile msgid "Error writing file" -msgstr "Error escrivint fitxer" +msgstr "S'ha produt un error mentre s'escrivia el fitxer" #: lazarusidestrconsts:liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" -msgstr "Error escrivint llista de paquest al fitxer%s%s%s%s" +msgstr "S'ha produt un error mentre s'escrivia la llista de paquets al fitxer%s%s%s%s" #: lazarusidestrconsts:liserror msgid "Error: " -msgstr "Error: " +msgstr "S'ha produt un error: " #: lazarusidestrconsts:liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" -msgstr "Error: compilador no vlid: %s" +msgstr "S'ha produt un error: el compilador %s no s vlid." #: lazarusidestrconsts:liserrors msgid "Errors" @@ -2096,51 +2100,51 @@ msgstr "Escapament" #: lazarusidestrconsts:lismenuevaluate msgid "Evaluate/Modify ..." -msgstr "Avaluar/Modificar ..." +msgstr "Avalua/Modifica ..." #: lazarusidestrconsts:srvk_execute msgid "Execute" -msgstr "Executar" +msgstr "Executa" #: lazarusidestrconsts:liscoexecuteafter msgid "Execute after" -msgstr "Executar desprs" +msgstr "Executa desprs de" #: lazarusidestrconsts:liscoexecutebefore msgid "Execute before" -msgstr "Executar abans" +msgstr "Executa abans de" #: lazarusidestrconsts:lisexecutingcommandafter msgid "Executing command after" -msgstr "Executant ordre desprs" +msgstr "Executa l'ordre desprs" #: lazarusidestrconsts:lisexecutingcommandbefore msgid "Executing command befor" -msgstr "Executant ordre abans" +msgstr "Executa l'ordre abans" #: lazarusidestrconsts:lisexecutionpaused msgid "Execution paused" -msgstr "Execuci pausada" +msgstr "S'ha pausat l'execuci" #: lazarusidestrconsts:lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" -msgstr "Execuci pausada%s Adrea: $%s%s Procediment: %s%s Fitxer: %s%s(Algun dia una finestra d'assemblador emergir aqu :)" +msgstr "S'ha pausat l'execuci%s Adrea: $%s%s Procediment: %s%s Fitxer: %s%s(Algun dia una finestra d'assemblador emergir aqu :)" #: lazarusidestrconsts:lisexecutionstopped msgid "Execution stopped" -msgstr "Execuci aturada" +msgstr "S'ha aturat l'execuci" #: lazarusidestrconsts:lisexecutionstoppedon msgid "Execution stopped%s" -msgstr "Execuci aturada%s" +msgstr "S'ha aturat l'execuci%s" #: lazarusidestrconsts:liscodetoolsdefsexit msgid "Exit" -msgstr "Sortir" +msgstr "Surt" #: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave msgid "Exit without Save" -msgstr "Sortir sense guardar" +msgstr "Surt sense desar" #: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" @@ -2148,7 +2152,7 @@ msgstr "Nom del fitxer est #: lazarusidestrconsts:lisexportlist msgid "Export list" -msgstr "Exportar llista" +msgstr "Exporta la llista" #: lazarusidestrconsts:lisexttoolexternaltools msgid "External Tools" @@ -2156,11 +2160,11 @@ msgstr "Eines externes" #: lazarusidestrconsts:srkmecexttool msgid "External tool %d" -msgstr "Eina exterior %d" +msgstr "Eina externa %d" #: lazarusidestrconsts:srkmecexttoolsettings msgid "External tools settings" -msgstr "Parmetres de les eines exteriors" +msgstr "Parmetres de les eines externes" #: lazarusidestrconsts:dlgextralinespacing msgid "Extra line spacing" @@ -2168,15 +2172,15 @@ msgstr "Espaiat extra entre l #: lazarusidestrconsts:lisextract msgid "Extract" -msgstr "Extraure" +msgstr "Extrau" #: lazarusidestrconsts:uemextractproc msgid "Extract Procedure" -msgstr "Extraure procediment" +msgstr "Extrau el procediment" #: lazarusidestrconsts:lismenuextractproc msgid "Extract procedure" -msgstr "Extraure procediment" +msgstr "Extrau el procediment" #: lazarusidestrconsts:liscodetoolsdefsfpccvssourcedirectory msgid "FPC CVS source directory" @@ -2184,7 +2188,7 @@ msgstr "Directori CVS del codi font del FPC" #: lazarusidestrconsts:lisfpcsourcedirectoryerror msgid "FPC Source Directory error" -msgstr "Error al directori del codi font del FPC" +msgstr "S'ha produt un error en el directori del codi font del FPC" #: lazarusidestrconsts:dlgfpcsrcpath msgid "FPC source directory" @@ -2192,11 +2196,11 @@ msgstr "Directori del codi font del FPC" #: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." -msgstr "No trobo el directori del codi font del FPC \"%s\"" +msgstr "No es pot trobar el directori del codi font del FPC \"%s\"" #: lazarusidestrconsts:lisexttoolfailedtoruntool msgid "Failed to run tool" -msgstr "Ha fallat executar eina" +msgstr "S'ha fallat en executar l'eina" #: lazarusidestrconsts:dlgcofast msgid "Faster Code" @@ -2212,7 +2216,7 @@ msgstr "El fitxer %s%s%s ja existeix en el projecte." #: lazarusidestrconsts:lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" -msgstr "El fitxer %s%s%s ha canviat. El guardo?" +msgstr "El fitxer %s%s%s ha canviat. Voleu desar-lo?" #: lazarusidestrconsts:lisfileisvirtual msgid "File %s%s%s is virtual." @@ -2220,19 +2224,19 @@ msgstr "El fitxer %s%s%s #: lazarusidestrconsts:lispkgmangfilenotfound msgid "File %s%s%s not found." -msgstr "No trobo el fitxer %s%s%s." +msgstr "No s'ha trobat el fitxer %s%s%s." #: lazarusidestrconsts:lisfilenotfound2 msgid "File %s%s%s not found.%s" -msgstr "No trobo el fitxer %s%s%s.%s" +msgstr "No s'ha trobat el fitxer %s%s%s.%s" #: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "No trobo el fitxer %s%s%s.%sEl vols crear?%s" +msgstr "No s'ha trobat el fitxer %s%s%s.%sEl voleu crear?%s" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sL'obro igualment?" +msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sEl voleu obrir igualment?" #: lazarusidestrconsts:lispckeditfileproperties msgid "File Properties" @@ -2248,7 +2252,7 @@ msgstr "Ja existeix el fitxer" #: lazarusidestrconsts:lisa2pfilealreadyinpackage msgid "File already in package" -msgstr "Ja hi ha el fitxer en el paquet" +msgstr "El fitxer ja s al paquet" #: lazarusidestrconsts:dlgfileexts msgid "File extensions:" @@ -2256,11 +2260,11 @@ msgstr "Ext. de fitxers" #: lazarusidestrconsts:lispkgmangfileisalreadyinpackage msgid "File is already in package" -msgstr "Ja hi ha el fitxer en el paquet" +msgstr "El fitxer ja s al paquet" #: lazarusidestrconsts:lispkgmangfileisinproject msgid "File is in Project" -msgstr "El fitxer s en el projecte" +msgstr "El fitxer forma part del projecte" #: lazarusidestrconsts:lisfileisnotwritable msgid "File is not writable" @@ -2280,7 +2284,7 @@ msgstr "M #: lazarusidestrconsts:srkmcatfilemenu msgid "File menu commands" -msgstr "Ordres de mens de fitxers" +msgstr "Ordres de mens dels fitxers" #: lazarusidestrconsts:lisa2pfilename msgid "File name:" @@ -2292,31 +2296,31 @@ msgstr "El fitxer no #: lazarusidestrconsts:lisfilenotfound msgid "File not found" -msgstr "Fitxer no trobat" +msgstr "No s'ha trobat el fitxer" #: lazarusidestrconsts:lisfilenotlowercase msgid "File not lowercase" -msgstr "Fitxer sense minscules" +msgstr "El fitxer no s en minscules" #: lazarusidestrconsts:lispkgmangfilenotsaved msgid "File not saved" -msgstr "Fitxer no guardat" +msgstr "No s'ha desat el fitxer" #: lazarusidestrconsts:lisfilenottext msgid "File not text" -msgstr "Fitxer no de text" +msgstr "No s un fitxer de text" #: lazarusidestrconsts:lisa2pfilenotunit msgid "File not unit" -msgstr "Fitxer no unitat" +msgstr "El fitxer no s una unitat" #: lazarusidestrconsts:lisa2pfilename2 msgid "Filename" -msgstr "Nom de fitxer" +msgstr "Nom del fitxer" #: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" -msgstr "El nom de fitxer s diferent del nom del paquet" +msgstr "El nom del fitxer s diferent del nom del paquet" #: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" @@ -2324,7 +2328,7 @@ msgstr "El nom del fitxer est #: lazarusidestrconsts:lispkgmangfilenameisusedbyproject msgid "Filename is used by project" -msgstr "El nom del fitxer s utilitzat pel projecte" +msgstr "El nom del fitxer est essent utilitzat pel projecte" #: lazarusidestrconsts:lisoipfilename msgid "Filename: %s" @@ -2340,91 +2344,91 @@ msgstr "Final" #: lazarusidestrconsts:lismenufind msgid "Find" -msgstr "Buscar" +msgstr "Cerca" #: lazarusidestrconsts:lismenufindnext msgid "Find &Next" -msgstr "Buscar Segent" +msgstr "Cerca el sege&nt" #: lazarusidestrconsts:lismenufindprevious msgid "Find &Previous" -msgstr "Buscar Anterior" +msgstr "Cerca l'an&terior" #: lazarusidestrconsts:lismenufindinfiles msgid "Find &in files" -msgstr "Buscar en els Fitxers" +msgstr "Cerca &en els Fitxers" #: lazarusidestrconsts:lismenufinddeclarationatcursor msgid "Find Declaration at cursor" -msgstr "Buscar la declaraci al cursor" +msgstr "Cerca la declaraci al cursor" #: lazarusidestrconsts:lismenufindidentifierrefs msgid "Find Identifier References" -msgstr "Buscar referncies d'identificador" +msgstr "Cerca les referncies de l'identificador" #: lazarusidestrconsts:lismenutemplatefindnext msgid "Find Next" -msgstr "Buscar el segent" +msgstr "Cerca el segent" #: lazarusidestrconsts:lisfrifindreferences msgid "Find References" -msgstr "Buscar referncies" +msgstr "Cerca les referncies" #: lazarusidestrconsts:srkmecfindblockotherend msgid "Find block other end" -msgstr "Buscar l'altre cap del bloc" +msgstr "Cerca l'altre cap del bloc" #: lazarusidestrconsts:srkmecfindblockstart msgid "Find block start" -msgstr "Buscar l'inici de bloc" +msgstr "Cerca l'inici del bloc" #: lazarusidestrconsts:lismenufindcodeblockstart msgid "Find code block start" -msgstr "Buscar l'inici del bloc de codi" +msgstr "Cerca l'inici del bloc del codi" #: lazarusidestrconsts:srkmecfinddeclaration msgid "Find declaration" -msgstr "Buscar la declaraci" +msgstr "Cerca la declaraci" #: lazarusidestrconsts:srkmecfindidentifierrefs msgid "Find identifier references" -msgstr "Buscar referncies d'identificador" +msgstr "Cerca les referncies de l'identificador" #: lazarusidestrconsts:srkmecfindinfiles msgid "Find in files" -msgstr "Buscar en fitxers" +msgstr "Cerca en els fitxers" #: lazarusidestrconsts:srkmecfindnext msgid "Find next" -msgstr "Buscar el segent" +msgstr "Cerca el segent" #: lazarusidestrconsts:lisfrifindorrenameidentifier msgid "Find or Rename Identifier" -msgstr "Buscar o renombrar identificador" +msgstr "Cerca o reanomena l'identificador" #: lazarusidestrconsts:lismenufindblockotherendofcodeblock msgid "Find other end of code block" -msgstr "Buscar un altre cap del bloc de codi" +msgstr "Cerca l'altre cap del bloc del codi" #: lazarusidestrconsts:srkmecfindprevious msgid "Find previous" -msgstr "Buscar l'anterior" +msgstr "Cerca l'anterior" #: lazarusidestrconsts:srkmecfindproceduredefinition msgid "Find procedure definiton" -msgstr "Buscar la definici de procediment" +msgstr "Cerca la definici del procediment" #: lazarusidestrconsts:srkmecfindproceduremethod msgid "Find procedure method" -msgstr "Buscar el mtode de procediment" +msgstr "Cerca el mtode del procediment" #: lazarusidestrconsts:srkmecfind msgid "Find text" -msgstr "Buscar text" +msgstr "Cerca el text" #: lazarusidestrconsts:dlgfindtextatcursor msgid "Find text at cursor" -msgstr "Buscar el text al cursor" +msgstr "Cerca el text al cursor" #: lazarusidestrconsts:rslanguagefinnish msgid "Finnish" @@ -2432,19 +2436,19 @@ msgstr "Finland #: lazarusidestrconsts:rslanguagefinnishwin msgid "Finnish for MS Windows" -msgstr "" +msgstr "Finlands per a MS Windows" #: lazarusidestrconsts:lisfixlfmfile msgid "Fix LFM file" -msgstr "Fixar fitxer LFM" +msgstr "Fixa el fitxer LFM" #: lazarusidestrconsts:srkmecjumptoeditor msgid "Focus to source editor" -msgstr "Focalitzar a editor de codi font" +msgstr "Focalitza a editor del codi font" #: lazarusidestrconsts:dlgforecolor msgid "Foreground color" -msgstr "Color de text" +msgstr "Color primer pla " #: lazarusidestrconsts:dlgfrmeditor msgid "Form Editor" @@ -2452,11 +2456,11 @@ msgstr "Editor de forma" #: lazarusidestrconsts:lisformloaderror msgid "Form load error" -msgstr "Error carregant forma" +msgstr "S'ha produt un error mentre es carregava la forma" #: lazarusidestrconsts:lisformaterror msgid "Format error" -msgstr "Error de format" +msgstr "S'ha produt un error de format" #: lazarusidestrconsts:dlgpofroms msgid "Forms" @@ -2468,15 +2472,15 @@ msgstr "Formes..." #: lazarusidestrconsts:lisfrforwardsearch msgid "Forward search" -msgstr "Recerca inversa" +msgstr "Recerca cap endavant" #: lazarusidestrconsts:lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" -msgstr "No trobo el compilador Free Pascal" +msgstr "No s'ha trobat el compilador Free Pascal" #: lazarusidestrconsts:lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" -msgstr "No trobo el codi font del Free Pascal" +msgstr "No s'ha trobat el codi font del Free Pascal" #: lazarusidestrconsts:lisfreepascalsourcedirectory msgid "Freepascal source directory" @@ -2492,15 +2496,15 @@ msgstr "Des del cursor" #: lazarusidestrconsts:listmfunctionappendpathdelimiter msgid "Function: append path delimiter" -msgstr "Funci: afegir delimitador de trajectria" +msgstr "Funci: afegir el delimitador de la trajectria" #: lazarusidestrconsts:listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" -msgstr "Funci: eliminar delimitadors de trajectria" +msgstr "Funci: eliminar el delimitador de la trajectria" #: lazarusidestrconsts:listmfunctionextractfileextension msgid "Function: extract file extension" -msgstr "Funci: extreure extensi del fitxer" +msgstr "Funci: extreure l'extensi del fitxer" #: lazarusidestrconsts:listmfunctionextractfilenameonly msgid "Function: extract file name only" @@ -2536,27 +2540,27 @@ msgstr "Opcions generals de l'entorn" #: lazarusidestrconsts:dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" -msgstr "Generar informaci de depuraci pel DBX (Compilaci ms lenta)" +msgstr "Genera informaci de depuraci pel DBX (Compilaci ms lenta)" #: lazarusidestrconsts:dlgcogdb msgid "Generate Debugging Info For GDB (Slows Compiling)" -msgstr "Generar informaci de depuraci pel GDB (Compilaci ms lenta)" +msgstr "Genera informaci de depuraci pel GDB (Compilaci ms lenta)" #: lazarusidestrconsts:dlggprof msgid "Generate code for gprof" -msgstr "Generar codi pel gprof" +msgstr "Genera codi pel gprof" #: lazarusidestrconsts:dlgcovalgrind msgid "Generate code for valgrind" -msgstr "Generar codi per Valgrind" +msgstr "Genera codi pel Valgrind" #: lazarusidestrconsts:dlgcogenerate msgid "Generate:" -msgstr "Generar:" +msgstr "Genera:" #: lazarusidestrconsts:dlggetposition msgid "Get position" -msgstr "Aconseguir posici" +msgstr "Posici" #: lazarusidestrconsts:dlgglobal msgid "Global" @@ -2564,55 +2568,55 @@ msgstr "Global" #: lazarusidestrconsts:lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" -msgstr "Afegir Trajectria Font Global" +msgstr "Afegeix trajectria font global" #: lazarusidestrconsts:srkmecgotomarker msgid "Go to Marker %d" -msgstr "Anar al marcador %d" +msgstr "Vs al marcador %d" #: lazarusidestrconsts:srkmecgotoeditor msgid "Go to editor %d" -msgstr "Anar a l'editor %d" +msgstr "Vs a l'editor %d" #: lazarusidestrconsts:srkmecgotolinenumber msgid "Go to line number" -msgstr "Anar a lnia nmero" +msgstr "Vs a la lnia nmero" #: lazarusidestrconsts:srkmecmatchbracket msgid "Go to matching bracket" -msgstr "Anar a claudtor coincident" +msgstr "Vs al claudtor coincident" #: lazarusidestrconsts:srkmecnexteditor msgid "Go to next editor" -msgstr "Anar al segent editor" +msgstr "Vs al segent editor" #: lazarusidestrconsts:srkmecpreveditor msgid "Go to prior editor" -msgstr "Anar a l'editor anterior" +msgstr "Vs a l'editor anterior" #: lazarusidestrconsts:srkmecgotoincludedirective msgid "Go to to include directive of current include file" -msgstr "Anar a la directiva include del fitxer incls actual" +msgstr "Vs a la directiva include del fitxer incls actual" #: lazarusidestrconsts:srkmecgotoxy msgid "Goto XY" -msgstr "Anar a XY" +msgstr "Vs a XY" #: lazarusidestrconsts:lismenugotoincludedirective msgid "Goto include directive" -msgstr "Anar a la directiva Include" +msgstr "Vs a la directiva Include" #: lazarusidestrconsts:lismenugotoline msgid "Goto line" -msgstr "Anar a lnia" +msgstr "Vs a la lnia" #: lazarusidestrconsts:lisuegotoline msgid "Goto line :" -msgstr "Anar a lnia:" +msgstr "Vs a la lnia:" #: lazarusidestrconsts:listodolistgotoline msgid "Goto selected source line" -msgstr "Anar a la lnia de codi seleccionada" +msgstr "Vs a la lnia del codi seleccionada" #: lazarusidestrconsts:srkmgrabkey msgid "Grab Key" @@ -2620,7 +2624,7 @@ msgstr "Enregistrar" #: lazarusidestrconsts:dlggrabbercolor msgid "Grabber color" -msgstr "Grabber color" +msgstr "Color capturador" #: lazarusidestrconsts:dlgenvgrid msgid "Grid" @@ -2632,27 +2636,27 @@ msgstr "Color de la graella" #: lazarusidestrconsts:dlggridx msgid "Grid size X" -msgstr "Tamany X de graella" +msgstr "Tamany X de la graella" #: lazarusidestrconsts:dlggridy msgid "Grid size Y" -msgstr "Tamany Y de graella" +msgstr "Tamany Y de la graella" #: lazarusidestrconsts:srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" -msgstr "Suposar $IFDEF inexistent" +msgstr "Suposa $IFDEF inexistent" #: lazarusidestrconsts:lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" -msgstr "Suposar IFDEF/ENDIF oms" +msgstr "Suposa IFDEF/ENDIF oms" #: lazarusidestrconsts:lismenuguessunclosedblock msgid "Guess unclosed block" -msgstr "Suposar bloc no tancat" +msgstr "Suposa bloc no tancat" #: lazarusidestrconsts:dlgenvlguidelines msgid "Guide lines" -msgstr "Lnies de guia" +msgstr "Lnies de la guia" #: lazarusidestrconsts:dlgguttercolor msgid "Gutter color" @@ -2664,11 +2668,11 @@ msgstr "Ample del canal" #: lazarusidestrconsts:dlghalfpagescroll msgid "Half page scroll" -msgstr "Desplaar mitja pgina" +msgstr "Desplaa mitja pgina" #: lazarusidestrconsts:lismenueditorhandleonclickevent msgid "Handle OnClick Event" -msgstr "Gestionar esdeveniment OnClick" +msgstr "Gestiona esdeveniment OnClick" #: lazarusidestrconsts:srvk_hanja msgid "Hanja" @@ -2676,11 +2680,11 @@ msgstr "Hanja" #: lazarusidestrconsts:lisaf2phasregisterprocedure msgid "Has Register procedure" -msgstr "T procediment de registre" +msgstr "T procediment del registre" #: lazarusidestrconsts:lisheadercommentforclass msgid "Header comment for class" -msgstr "Comentari de capalera per la classe" +msgstr "Comentari de capalera per a la classe" #: lazarusidestrconsts:dlgheapsize msgid "Heap Size" @@ -2700,11 +2704,11 @@ msgstr "Ajuda" #: lazarusidestrconsts:lishelpcontextnotfound msgid "Help Context not found" -msgstr "No trobo el context d'ajuda" +msgstr "No s'ha trobat el context de l'ajuda" #: lazarusidestrconsts:lishelpdatabasenotfound msgid "Help Database not found" -msgstr "No trobo la base de dades de l'ajuda" +msgstr "No s'ha trobat la base de dades de l'ajuda" #: lazarusidestrconsts:lishlpoptshelpoptions msgid "Help Options" @@ -2712,51 +2716,51 @@ msgstr "Opcions de l'ajuda" #: lazarusidestrconsts:lishelpselectorerror msgid "Help Selector Error" -msgstr "Error del selector d'ajuda" +msgstr "S'ha produt un error en el selector de l'ajuda" #: lazarusidestrconsts:lishelpviewererror msgid "Help Viewer Error" -msgstr "Error del visor d'ajuda" +msgstr "S'ha produt un error en el visor de l'ajuda" #: lazarusidestrconsts:lishelpviewernotfound msgid "Help Viewer not found" -msgstr "No trobo el visor d'ajuda" +msgstr "No s'ha trobat el visor de l'ajuda" #: lazarusidestrconsts:srkmcarhelpmenu msgid "Help menu commands" -msgstr "Ordres del men d'ajuda" +msgstr "Ordres del men de l'ajuda" #: lazarusidestrconsts:lishelpnotfound msgid "Help not found" -msgstr "No trobo l'ajuda" +msgstr "No s'ha trobat l'ajuda" #: lazarusidestrconsts:dlghideideonrun msgid "Hide IDE windows on run" -msgstr "Amagar finestres IDE durant l'execuci" +msgstr "Amaga les finestres de l'IDE durant l'execuci" #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." -msgstr "Suggeriment: La funci de la cadena del recurs de Make espera una constant de cadena.%sSi us plau, selecciona noms una expressi de cadena i torna-ho a provar." +msgstr "Suggeriment: La funci de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu noms una expressi de cadena i torneu-ho a provar." #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." -msgstr "Suggeriment: La funci de la cadena del recurs de Make espera una constant de cadena.%sSi us plau, selecciona l'expressi i torna-ho a provar." +msgstr "Suggeriment: La funci de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu l'expressi i torneu-ho a provar." #: lazarusidestrconsts:dlgedhintcommand msgid "Hint: click on the command you want to edit" -msgstr "Suggeriment: Fes un clic a l'ordre que vols editar" +msgstr "Suggeriment: Feu un clic a l'ordre que voleu editar" #: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "Suggeriment: pots escollir la trajectria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectria del compilador" +msgstr "Suggeriment: podeu triar la trajectria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectria del compilador" #: lazarusidestrconsts:dlgpalhints msgid "Hints for component palette" -msgstr "Suggeriments per la paleta de components" +msgstr "Suggeriments per a la paleta de components" #: lazarusidestrconsts:dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" -msgstr "Suggeriments pels botons rpids principals (obrir, guardar, ...)" +msgstr "Suggeriments pels botons rpids principals (obre, guarda, ...)" #: lazarusidestrconsts:srvk_home msgid "Home" @@ -2764,7 +2768,7 @@ msgstr "Inici" #: lazarusidestrconsts:dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" -msgstr "" +msgstr "La tecla d'inici salta al comenament ms proper" #: lazarusidestrconsts:lishorizontal msgid "Horizontal" @@ -2780,7 +2784,7 @@ msgstr "Aplicaci #: lazarusidestrconsts:uenotimplcapagain msgid "I told You: Not implemented yet" -msgstr "T'ho he dit: Encara no est implementat" +msgstr "Us ho he dit: Encara NO est implementat" #: lazarusidestrconsts:lispckoptsideintegration msgid "IDE Integration" @@ -2808,7 +2812,7 @@ msgstr "Prefix de l'identificador" #: lazarusidestrconsts:dlgedidcomlet msgid "Identifier completion" -msgstr "Completar l'identificador" +msgstr "Completa l'identificador" #: lazarusidestrconsts:dlgidentifierpolicy msgid "Identifier policy" @@ -2820,11 +2824,11 @@ msgstr "Identificador: %s" #: lazarusidestrconsts:liscodetoolsdefsif msgid "If" -msgstr "Si" +msgstr "If" #: lazarusidestrconsts:uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "Si ens pots ajudar a implementar aquesta caracterstica, escriu a lazarus@miraclec.com" +msgstr "Si ens podeu ajudar a implementar aquesta caracterstica, escriviu a lazarus@miraclec.com" #: lazarusidestrconsts:liscodetoolsdefsifdef msgid "IfDef" @@ -2836,39 +2840,39 @@ msgstr "IfNDef" #: lazarusidestrconsts:dlgignoreverb msgid "Ignore" -msgstr "Ignorar" +msgstr "Ignora" #: lazarusidestrconsts:lissortselignorespace msgid "Ignore Space" -msgstr "Ignorar espai" +msgstr "Ignora l'espai" #: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" -msgstr "Ignorar la quantitat d'espais" +msgstr "Ignora la quantitat d'espais" #: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" -msgstr "Ignorar les diferncies al final de la lnia (p.e. #10 = #13#10)" +msgstr "Ignora les diferncies al final de la lnia (p.ex. #10 = #13#10)" #: lazarusidestrconsts:lisdiskdiffignorediskchanges msgid "Ignore disk changes" -msgstr "Ignorar els canvis del disc" +msgstr "Ignora els canvis del disc" #: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" -msgstr "Ignorar si s'han afegit o esborrat lnies buides" +msgstr "Ignora si s'han afegit o eliminat lnies buides" #: lazarusidestrconsts:lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" -msgstr "Ignorar espais (carcters noves lnies no inclosos)" +msgstr "Ignora els espais (excepte #10, #13#10)" #: lazarusidestrconsts:lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" -msgstr "Ignorar espais al final de la lnia" +msgstr "Ignora els espais al final de la lnia" #: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" -msgstr "Ignorar espais al comenament de la lnia" +msgstr "Ignora els espais al comenament de la lnia" #: lazarusidestrconsts:srkmecimestr msgid "Ime Str" @@ -2876,7 +2880,7 @@ msgstr "Ime Str" #: lazarusidestrconsts:lisimportlist msgid "Import list" -msgstr "importar llista" +msgstr "importar la llista" #: lazarusidestrconsts:dlginfrontofmethods msgid "In front of methods" @@ -2884,27 +2888,27 @@ msgstr "Davant dels m #: lazarusidestrconsts:lispckoptsinclude msgid "Include" -msgstr "Incloure" +msgstr "Inclou" #: lazarusidestrconsts:dlgassertcode msgid "Include Assertion Code" -msgstr "Incloure codi afirmat" +msgstr "Inclou el codi afirmat" #: lazarusidestrconsts:dlgcoincfiles msgid "Include Files (-Fi):" -msgstr "Fitxers Include (-Fi):" +msgstr "Fitxers Inclosos (-Fi):" #: lazarusidestrconsts:lispkgfiletypeinclude msgid "Include file" -msgstr "Incloure fitxer" +msgstr "Inclou el fitxer" #: lazarusidestrconsts:lisfindfileincludesubdirectories msgid "Include sub directories" -msgstr "Incloure subdirectoris" +msgstr "Inclou els subdirectoris" #: lazarusidestrconsts:dlgincludesystemvariables msgid "Include system variables" -msgstr "Incloure variables del sistema" +msgstr "Inclou les variables del sistema" #: lazarusidestrconsts:lisuidincludedby msgid "Included by:" @@ -2912,19 +2916,19 @@ msgstr "Incl #: lazarusidestrconsts:lismenuincrementalfind msgid "Incremental Find" -msgstr "Recerca Incremental" +msgstr "Recerca incremental" #: lazarusidestrconsts:srkmecblockindent msgid "Indent block" -msgstr "Sagnar bloc" +msgstr "Sagna el bloc" #: lazarusidestrconsts:dlgindentcodeto msgid "Indent code to" -msgstr "Sagnar el codi a" +msgstr "Sagna el codi a" #: lazarusidestrconsts:lismenuindentselection msgid "Indent selection" -msgstr "Sagnar selecci" +msgstr "Sagna la selecci" #: lazarusidestrconsts:lisinformationaboutunit msgid "Information about %s" @@ -2936,123 +2940,123 @@ msgstr "Heretat" #: lazarusidestrconsts:srvk_insert msgid "Insert" -msgstr "Inserir" +msgstr "Insereix" #: lazarusidestrconsts:lismenuconditionalselection msgid "Insert $IFDEF..." -msgstr "Inserir $IFDEF..." +msgstr "Insereix $IFDEF..." #: lazarusidestrconsts:srkmecinsertcvsauthor msgid "Insert CVS keyword Author" -msgstr "Inserir paraula clau CVS Author" +msgstr "Insereix paraula clau CVS Author" #: lazarusidestrconsts:srkmecinsertcvsdate msgid "Insert CVS keyword Date" -msgstr "Inserir paraula clau CVS Date" +msgstr "Insereix paraula clau CVS Date" #: lazarusidestrconsts:srkmecinsertcvsheader msgid "Insert CVS keyword Header" -msgstr "Inserir paraula clau CVS Header" +msgstr "Insereix paraula clau CVS Header" #: lazarusidestrconsts:srkmecinsertcvsid msgid "Insert CVS keyword ID" -msgstr "Inserir paraula clau CVS ID" +msgstr "Insereix paraula clau CVS ID" #: lazarusidestrconsts:srkmecinsertcvslog msgid "Insert CVS keyword Log" -msgstr "Inserir paraula clau CVS Log" +msgstr "Insereix paraula clau CVS Log" #: lazarusidestrconsts:srkmecinsertcvsname msgid "Insert CVS keyword Name" -msgstr "Inserir paraula clau CVS Name" +msgstr "Insereix paraula clau CVS Name" #: lazarusidestrconsts:srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" -msgstr "Inserir paraula clau CVS Revision" +msgstr "Insereix paraula clau CVS Revision" #: lazarusidestrconsts:srkmecinsertcvssource msgid "Insert CVS keyword Source" -msgstr "Inserir paraula clau CVS Source" +msgstr "Insereix paraula clau CVS Source" #: lazarusidestrconsts:srkmecinsertchangelogentry msgid "Insert ChangeLog entry" -msgstr "Inserir entrada de registres de canvis" +msgstr "Insereix entrada de registres de canvis" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" -msgstr "Inserir plantilla del compilador Delphi 5" +msgstr "Insereix plantilla del compilador Delphi 5" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" -msgstr "Inserir plantilla del directori del Delphi 5" +msgstr "Insereix plantilla del directori del Delphi 5" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" -msgstr "Inserir plantilla de projecte Delphi 5" +msgstr "Insereix plantilla de projecte Delphi 5" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" -msgstr "Inserir plantilla del compilador Delphi 6" +msgstr "Insereix plantilla del compilador Delphi 6" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" -msgstr "Inserir plantilla del directori del Delphi 6" +msgstr "Insereix plantilla del directori del Delphi 6" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" -msgstr "Inserir plantilla del projecte Delphi 6" +msgstr "Insereix plantilla del projecte Delphi 6" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" -msgstr "Inserir plantilla del compilador Delphi 7" +msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" -msgstr "Inserir plantilla del compilador Delphi 7" +msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" -msgstr "Inserir plantilla de projecte Delphi 7" +msgstr "Insereix plantilla de projecte Delphi 7" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcvssource msgid "Insert Free Pascal CVS Source Template" -msgstr "Inserir plantilla de les fonts CVS del Free Pascal" +msgstr "Insereix plantilla de les fonts CVS del Free Pascal" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" -msgstr "Inserir plantilla del compilador Free Pascal" +msgstr "Insereix plantilla del compilador Free Pascal" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" -msgstr "Inserir plantilla del projecte Free Pascal" +msgstr "Insereix plantilla del projecte Free Pascal" #: lazarusidestrconsts:lismenueditorinsertfromtemplate msgid "Insert From Template..." -msgstr "Inserir desde plantilla..." +msgstr "Insereix desde la plantilla..." #: lazarusidestrconsts:srkmecinsertgplnotice msgid "Insert GPL notice" -msgstr "Inserir comentari GPL" +msgstr "Insereix comentari GPL" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" -msgstr "Inserir plantilla del compilador Kylix 3" +msgstr "Insereix plantilla del compilador Kylix 3" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" -msgstr "Inserir plantilla del directori Kylix 3" +msgstr "Insereix plantilla del directori Kylix 3" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" -msgstr "Inserir plantilla de projecte Kylix 3" +msgstr "Insereix plantilla de projecte Kylix 3" #: lazarusidestrconsts:srkmecinsertlgplnotice msgid "Insert LGPL notice" -msgstr "Inserir comentari LGPL" +msgstr "Insereix comentari LGPL" #: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" -msgstr "Inserir plantilla del directori Lazarus" +msgstr "Insereix plantilla del directori Lazarus" #: lazarusidestrconsts:srkmecinsertmode msgid "Insert Mode" @@ -3060,79 +3064,79 @@ msgstr "Mode inserir" #: lazarusidestrconsts:lismenueditorinsertnewitemafter msgid "Insert New Item (after)" -msgstr "Inserir nou element (desprs)" +msgstr "Insereix nou element (desprs)" #: lazarusidestrconsts:lismenueditorinsertnewitembefore msgid "Insert New Item (before)" -msgstr "Inserir nou element (abans)" +msgstr "Insereix nou element (abans)" #: lazarusidestrconsts:liscodetoolsdefsinserttemplate msgid "Insert Template" -msgstr "Inserir plantilla" +msgstr "Insereix la plantilla" #: lazarusidestrconsts:lismakeresstrinsertalphabetically msgid "Insert alphabetically" -msgstr "Inserir alfabticament" +msgstr "Insereix alfabticament" #: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" -msgstr "Inserir sensitivament al context" +msgstr "Insereix sensitivament al context" #: lazarusidestrconsts:srkmecinsertdatetime msgid "Insert current date and time" -msgstr "Inserir data i hora actuals" +msgstr "Insereix data i hora actuals" #: lazarusidestrconsts:srkmecinsertusername msgid "Insert current username" -msgstr "Inserir nom d'usuari actual" +msgstr "Insereix nom d'usuari actual" #: lazarusidestrconsts:lismenuinsertcharacter msgid "Insert from Character Map" -msgstr "Inserir desde mapa de carcters" +msgstr "Insereix desde el mapa de carcters" #: lazarusidestrconsts:srkmecinsertcharacter msgid "Insert from Charactermap" -msgstr "Inserir desde mapa de carcters" +msgstr "Insereix desde el mapa de carcters" #: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" -msgstr "Inserir el node com a fill" +msgstr "Insereix el node com a fill" #: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow msgid "Insert node below" -msgstr "Inserir el node avall" +msgstr "Insereix el node avall" #: lazarusidestrconsts:dlginsspaceafter msgid "Insert space after" -msgstr "Inserir espai desprs de" +msgstr "Insereix espai desprs de" #: lazarusidestrconsts:dlginsspacefront msgid "Insert space in front of" -msgstr "Inserir espai davant de" +msgstr "Insereix espai davant de" #: lazarusidestrconsts:lismenuinserttext msgid "Insert text" -msgstr "Inserir text" +msgstr "Insereix el text" #: lazarusidestrconsts:lismenuinspect msgid "Inspect ..." -msgstr "Inspeccionar ..." +msgstr "Inspecciona ..." #: lazarusidestrconsts:lispckeditinstall msgid "Install" -msgstr "Installar" +msgstr "Installa" #: lazarusidestrconsts:lispckexplinstallonnextstart msgid "Install on next start" -msgstr "Installar en el proper inici" +msgstr "Installa en el proper inici" #: lazarusidestrconsts:lispckeditinstallpackageintheide msgid "Install package in the IDE" -msgstr "Installar el paquet en IDE" +msgstr "Installa el paquet a l'IDE" #: lazarusidestrconsts:lisinstallselection msgid "Install selection" -msgstr "Installar selecci" +msgstr "Installa la selecci" #: lazarusidestrconsts:lispckexplinstalled msgid "Installed" @@ -3144,7 +3148,7 @@ msgstr "Paquets instal #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstall msgid "Installing the package %s will automatically install the package(s):%s%s" -msgstr "Installar el paquet %s installar automticament el(s) paquet(s):%s%s" +msgstr "Installa el paquet %s installar automticament el(s) paquet(s):%s%s" #: lazarusidestrconsts:dlgintvinsec msgid "Interval in secs" @@ -3152,191 +3156,191 @@ msgstr "Interval en seg." #: lazarusidestrconsts:lisa2pinvalidancestortype msgid "Invalid Ancestor Type" -msgstr "Tipus d'avantpassat no vlid" +msgstr "El tipus d'avantpassat no s vlid" #: lazarusidestrconsts:lisa2pinvalidcircle msgid "Invalid Circle" -msgstr "Cercle no vlid" +msgstr "El cercle no s vlid" #: lazarusidestrconsts:lisa2pinvalidclassname msgid "Invalid Class Name" -msgstr "Nom de classe no vlid" +msgstr "El nom de la classe no s vlid" #: lazarusidestrconsts:lisinvalidcompilerfilename msgid "Invalid Compiler Filename" -msgstr "Nom de fitxer de compilador no vlid" +msgstr "El nom del fitxer del compilador no s vlid" #: lazarusidestrconsts:lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" -msgstr "Filtre Exclude no vlid" +msgstr "El filtre Exclude no s vlid" #: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" -msgstr "Directori del codi font de Free Pascal no vlid" +msgstr "El directori del codi font de Free Pascal no s vlid" #: lazarusidestrconsts:lisfriinvalididentifier msgid "Invalid Identifier" -msgstr "Identificador no vlid" +msgstr "L'identificador no s vlid" #: lazarusidestrconsts:lispublprojinvalidincludefilter msgid "Invalid Include filter" -msgstr "Filtre Include no vlid" +msgstr "El filtre Include no s vlid" #: lazarusidestrconsts:lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" -msgstr "Versi min/max no vlida" +msgstr "La versi min/max no s vlida" #: lazarusidestrconsts:lisaf2pinvalidpackage msgid "Invalid Package" -msgstr "Paquet no vlid" +msgstr "El paquet no s vlid" #: lazarusidestrconsts:lispkgmanginvalidpackagename2 msgid "Invalid Package Name" -msgstr "Nom de paquet no vlid" +msgstr "El nom del paquet no s vlid" #: lazarusidestrconsts:lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" -msgstr "Identificador de Pascal no vlid" +msgstr "L'identificador de Pascal no s vlid" #: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" -msgstr "Secci de la cadena del recurs no vlida" +msgstr "La secci de la cadena del recurs no s vlida" #: lazarusidestrconsts:lisa2pinvalidunitname msgid "Invalid Unit Name" -msgstr "Nom d'unitat no vlid" +msgstr "El nom de la unitat no s vlid" #: lazarusidestrconsts:lispkgsysinvalidunitname msgid "Invalid Unitname: %s" -msgstr "Nom d'unitat no vlid: %s" +msgstr "El nom de la unitat no s vlid: %s" #: lazarusidestrconsts:lisinvalidcommand msgid "Invalid command" -msgstr "Ordre invlida" +msgstr "L'ordre no s vlida" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" -msgstr "Nom de compilador no vlid" +msgstr "El nom del compilador no s vlid" #: lazarusidestrconsts:lispkgsysinvalidcomponentclass msgid "Invalid component class" -msgstr "Classe de component no vlida" +msgstr "La classe del component no s vlida" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" -msgstr "Nom de depurador no vlid" +msgstr "El nom del depurador no s vlid" #: lazarusidestrconsts:lisinvaliddelete msgid "Invalid delete" -msgstr "Esborrat no vlid" +msgstr "L'eliminaci no s vlida" #: lazarusidestrconsts:lisinvaliddestinationdirectory msgid "Invalid destination directory" -msgstr "Directori destinaci no vlid" +msgstr "El directori de destinaci no s vlid" #: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." -msgstr "Expressi no vlida.%sSuggeriment: La funci de la cadena del recurs de Make espera una constant de cadena en un sol fitxer. Si us plau, selecciona l'expressi i torna-ho a provar." +msgstr "L'expressi no s vlida.%sSuggeriment: La funci de la cadena del recurs espera una constant de cadena en un sol fitxer. Si us plau, seleccioneu l'expressi i torneu-ho a provar." #: lazarusidestrconsts:lisa2pinvalidfile msgid "Invalid file" -msgstr "Fitxer no vlid" +msgstr "El fitxer no s vlid" #: lazarusidestrconsts:lispkgmanginvalidfileextension msgid "Invalid file extension" -msgstr "Extensi de fitxer no vlida" +msgstr "L'extensi del fitxer no s vlida" #: lazarusidestrconsts:lisa2pinvalidfilename msgid "Invalid filename" -msgstr "Nom de fitxer no vlid" +msgstr "El nom del fitxer no s vlid" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilename msgid "Invalid make filename" -msgstr "Nom de fitxer Make no vlid" +msgstr "El nom del fitxer a crear no s vlid" #: lazarusidestrconsts:lispckeditinvalidmaximumversion msgid "Invalid maximum version" -msgstr "Versi mxima no vlida" +msgstr "la versi mxima no s vlida" #: lazarusidestrconsts:lispckeditinvalidminimumversion msgid "Invalid minimum version" -msgstr "Versi mnima no vlida" +msgstr "La versi mnima no s vlida" #: lazarusidestrconsts:lisinvalidmultiselection msgid "Invalid multiselection" -msgstr "Multiselecci no vlida" +msgstr "La multiselecci no s vlida" #: lazarusidestrconsts:fdinvalidmutliselectioncap msgid "Invalid mutliselection" -msgstr "Multiselecci no vlida" +msgstr "La multiselecci no s vlida" #: lazarusidestrconsts:lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" -msgstr "ID de paquet no vlida: %s%s%s" +msgstr "L'ID del paquet no s vlida: %s%s%s" #: lazarusidestrconsts:lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" -msgstr "Extensi de paquet no vlida" +msgstr "L'extensi del paquet no s vlida" #: lazarusidestrconsts:lispkgmanginvalidpackagefilename msgid "Invalid package filename" -msgstr "Nom de fitxer de paquet no vlid" +msgstr "El nom del fitxer del paquet no s vlid" #: lazarusidestrconsts:lispkgmanginvalidpackagename msgid "Invalid package name" -msgstr "Nom de paquet no vlid" +msgstr "El nom del paquet no s vlid" #: lazarusidestrconsts:lispckoptsinvalidpackagetype msgid "Invalid package type" -msgstr "Tipus de paquet no vlid" +msgstr "El tipus del paquet no s vlid" #: lazarusidestrconsts:lisprojaddinvalidpackagename msgid "Invalid packagename" -msgstr "Nom de paquet no vlid" +msgstr "El nom del paquet no s vlid" #: lazarusidestrconsts:liscodetoolsdefsinvalidparent msgid "Invalid parent" -msgstr "Pare no vlid" +msgstr "El pare no s vlid" #: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" -msgstr "Node pare no vlid" +msgstr "El node pare no s vlid" #: lazarusidestrconsts:lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" -msgstr "Nom d'unitat pascal no vlid" +msgstr "El nom de la unitat pascal no s vlid" #: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" -msgstr "Node anterior no vlid" +msgstr "El node anterior no s vlid" #: lazarusidestrconsts:lisinvalidprocname msgid "Invalid proc name" -msgstr "Nom de procediment no vlid" +msgstr "El nom del procediment no s vlid" #: lazarusidestrconsts:lisinvalidprojectfilename msgid "Invalid project filename" -msgstr "Nom de fitxer de projecte no vlid" +msgstr "El nom del fitxer del projecte no s vlid" #: lazarusidestrconsts:lisinvalidselection msgid "Invalid selection" -msgstr "Selecci no vlida" +msgstr "La selecci no s vlida" #: lazarusidestrconsts:lissvuoinvalidvariablename msgid "Invalid variable name" -msgstr "Nom de variable no vlid" +msgstr "El nom de la variable no s vlid" #: lazarusidestrconsts:lisprojaddinvalidversion msgid "Invalid version" -msgstr "Versi no vlida" +msgstr "la versi no s vlida" #: lazarusidestrconsts:ueminvertassignment msgid "Invert Assignment" -msgstr "Invertir assignaci" +msgstr "Inverteix l'assignaci" #: lazarusidestrconsts:srkmecinvertassignment msgid "Invert assignment" -msgstr "Invertir assignaci" +msgstr "Inverteix l'assignaci" #: lazarusidestrconsts:srvk_irregular msgid "Irregular " @@ -3360,23 +3364,23 @@ msgstr "Al #: lazarusidestrconsts:lismenujumpback msgid "Jump back" -msgstr "Saltar enrera" +msgstr "Salta enrera" #: lazarusidestrconsts:lismenujumpforward msgid "Jump forward" -msgstr "Saltar endavant" +msgstr "Salta endavant" #: lazarusidestrconsts:lismenujumptonexterror msgid "Jump to next error" -msgstr "Saltar al segent error" +msgstr "Salta al segent error" #: lazarusidestrconsts:lismenujumptopreverror msgid "Jump to previous error" -msgstr "Saltar a l'error previ" +msgstr "Salta a l'error previ" #: lazarusidestrconsts:dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" -msgstr "Salt (p.e. Saltant mtodes)" +msgstr "Salt (p.ex. Salta mtodes)" #: lazarusidestrconsts:srvk_junja msgid "Junja" @@ -3388,23 +3392,23 @@ msgstr "Kana" #: lazarusidestrconsts:dlgkeepcaretx msgid "Keep X caret" -msgstr "Mantenir intercalaci X" +msgstr "Mant l'intercalaci X" #: lazarusidestrconsts:liscldirkeepalltextfiles msgid "Keep all text files" -msgstr "Mantenir tots els fitxers de text" +msgstr "Mant tots els fitxers de text" #: lazarusidestrconsts:dlgcokeepvarsreg msgid "Keep certain variables in registers" -msgstr "Mantenir certes variables als registres" +msgstr "Mant certes variables en els registres" #: lazarusidestrconsts:liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" -msgstr "Mantenir els fitxers que coincideixin amb el filtre" +msgstr "Mant els fitxers que coincideixin amb el filtre" #: lazarusidestrconsts:dlgforwardprocskeeporder msgid "Keep order of procedures" -msgstr "Mantenir l'ordre dels procediments" +msgstr "Mant l'ordre dels procediments" #: lazarusidestrconsts:srkmkey msgid "Key" @@ -3420,7 +3424,7 @@ msgstr "Accessos r #: lazarusidestrconsts:dlgkeymappingerrors msgid "Key mapping errors" -msgstr "Errors d'accessos rpids" +msgstr "Errors dels accessos rpids" #: lazarusidestrconsts:liscodetoolsoptskeyword msgid "Keyword" @@ -3444,7 +3448,7 @@ msgstr "Interf #: lazarusidestrconsts:lislclunitpathmissing msgid "LCL unit path missing" -msgstr "Falta trajectria a unitat LCL" +msgstr "Falta la trajectria a la unitat LCL" #: lazarusidestrconsts:lispkgfiletypelfm msgid "LFM - Lazarus form text" @@ -3456,11 +3460,11 @@ msgstr "Fitxer LFM" #: lazarusidestrconsts:lislfmfilecorrupt msgid "LFM file corrupt" -msgstr "Fitxer LFM corrupte" +msgstr "El fitxer LFM est corromput" #: lazarusidestrconsts:lislfmfilenotfound msgid "LFM file not found" -msgstr "No trobo el fitxer LFM" +msgstr "No s'ha trobat el fitxer LFM" #: lazarusidestrconsts:lismenuinsertlgplnotice msgid "LGPL notice" @@ -3484,15 +3488,15 @@ msgstr " #: lazarusidestrconsts:dlglast msgid "Last (i.e. at end of source)" -msgstr "ltim (p.e. al final del codi font)" +msgstr "ltim (p.ex. al final del codi font)" #: lazarusidestrconsts:lislaunchingapplicationinvalid msgid "Launching application invalid" -msgstr "Execuci d'aplicaci no vlida" +msgstr "L'execuci de l'aplicaci no s vlida" #: lazarusidestrconsts:lislaunchingcmdline msgid "Launching target command line" -msgstr "Executant lnia d'ordres destinaci" +msgstr "Executant lnia d'ordres de destinaci" #: lazarusidestrconsts:lispkgmanglazarus msgid "Lazarus" @@ -3500,7 +3504,7 @@ msgstr "Lazarus" #: lazarusidestrconsts:liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" -msgstr "Directori Lazarus" +msgstr "Directori del Lazarus" #: lazarusidestrconsts:lislazaruseditorv msgid "Lazarus Editor v%s" @@ -3524,15 +3528,15 @@ msgstr "Directori Lazarus (predeterminat per a tots els projectes)" #: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." -msgstr "No trobo el directori del Lazarus \"%s\"" +msgstr "No s'ha trobat el directori del Lazarus \"%s\"" #: lazarusidestrconsts:lislazarusdirectorynotfound msgid "Lazarus directory not found" -msgstr "No trobo el directori Lazarus" +msgstr "No s'ha trobat el directori del Lazarus" #: lazarusidestrconsts:lisleaveemptyfo msgid "Leave empty for default .po file" -msgstr "Deixar buit per omissi el fitxer .po" +msgstr "Deixa buit per omissi el fitxer .po" #: lazarusidestrconsts:srvk_left msgid "Left" @@ -3544,7 +3548,7 @@ msgstr "Costats esquerres" #: lazarusidestrconsts:lisleftspaceequally msgid "Left space equally" -msgstr "Igualar espai esquerra" +msgstr "Iguala l'espai esquerra" #: lazarusidestrconsts:dlgleftpos msgid "Left:" @@ -3564,7 +3568,7 @@ msgstr "Nivell 2 (Nivell 1 + Optimitzacions m #: lazarusidestrconsts:dlglevel3opt msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Nivell 3 (Nivell 2 + incert" +msgstr "Nivell 3 (Nivell 2 + incert)" #: lazarusidestrconsts:dlgcolibraries msgid "Libraries (-Fl):" @@ -3588,7 +3592,7 @@ msgstr "L #: lazarusidestrconsts:dlglinesplitting msgid "Line Splitting" -msgstr "Divisi de lnies" +msgstr "Divisi entre lnies" #: lazarusidestrconsts:srkmeclineselect msgid "Line selection mode" @@ -3616,11 +3620,11 @@ msgstr "Enlla #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" -msgstr "Carregar parmetres de l'escriptori del fitxer" +msgstr "Carrega els parmetres de l'escriptori des del fitxer" #: lazarusidestrconsts:dlgcoloadsave msgid "Load/Save" -msgstr "Carregar/Guardar" +msgstr "Carrega/Desa" #: lazarusidestrconsts:lispckexplloadedpackages msgid "Loaded Packages:" @@ -3628,7 +3632,7 @@ msgstr "Paquets carregats:" #: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" -msgstr "Carregar el paquet %s reemplaar el paquet %s%sdel fitxer %s.%sEl paquet vell est modificat.%s%sGuardar el paquet vell %s?" +msgstr "Carrega el paquet %s reemplaar el paquet %s%sdel fitxer %s.%sEl paquet antic est modificat.%s%sVoleu desar el paquet antic %s?" #: lazarusidestrconsts:dlgrunolocal msgid "Local" @@ -3640,7 +3644,7 @@ msgstr "Variables Locals" #: lazarusidestrconsts:lismenulowercaseselection msgid "Lowercase selection" -msgstr "Ficar a minscules la selecci" +msgstr "Fica a minscules la selecci" #: lazarusidestrconsts:dlg1up2low msgid "Lowercase, first letter up" @@ -3664,7 +3668,7 @@ msgstr "La unitat principal t #: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" -msgstr "La unitat principal t secci USES contenint totes les unitats del projecte" +msgstr "La unitat principal t secci USES amb totes les unitats del projecte" #: lazarusidestrconsts:lismainunitispascalsource msgid "Main Unit is Pascal Source" @@ -3676,19 +3680,19 @@ msgstr "Major" #: lazarusidestrconsts:lismakeexe msgid "Make Executable" -msgstr "Fer executable" +msgstr "Fes executable" #: lazarusidestrconsts:lismenumakeresourcestring msgid "Make Resource String" -msgstr "Fer cadena del recurs" +msgstr "Fes cadena del recurs" #: lazarusidestrconsts:lismakeresourcestring msgid "Make ResourceString" -msgstr "Fer cadena del recurs" +msgstr "Fes cadena del recurs" #: lazarusidestrconsts:lismakenotfound msgid "Make not found" -msgstr "No trobo Make" +msgstr "No s'ha trobat Make" #: lazarusidestrconsts:dlgmakepath msgid "Make path" @@ -3696,7 +3700,7 @@ msgstr "Traject #: lazarusidestrconsts:srkmecmakeresourcestring msgid "Make resource string" -msgstr "Fer cadena de recursos" +msgstr "Fes cadena del recurs" #: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" @@ -3716,11 +3720,11 @@ msgstr "Longitud m #: lazarusidestrconsts:dlgmaxrecentfiles msgid "Max recent files" -msgstr "Mxim de fitxers recents" +msgstr "Nm.mx. de fitxers recents" #: lazarusidestrconsts:dlgmaxrecentprojs msgid "Max recent project files" -msgstr "Mxim de fitxers projecte recents" +msgstr "Mx.fitxers projecte recents" #: lazarusidestrconsts:lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" @@ -3736,7 +3740,7 @@ msgstr "N #: lazarusidestrconsts:dlgmaxcntr msgid "Maximum counter" -msgstr "Mxim de comptador" +msgstr "Nmero mxim de comptador" #: lazarusidestrconsts:srvk_menu msgid "Menu" @@ -3744,7 +3748,7 @@ msgstr "Men #: lazarusidestrconsts:lismenueditormenueditor msgid "Menu Editor" -msgstr "Editor de men" +msgstr "Editor del men" #: lazarusidestrconsts:lismenuviewmessages msgid "Messages" @@ -3756,15 +3760,15 @@ msgstr "Pol #: lazarusidestrconsts:dlgminimizeallonminimizemain msgid "Minimize all on minimize main" -msgstr "Minimitzar tot en minimitzar el principal" +msgstr "Minimitza totes les finestes en minimitzar la principal" #: lazarusidestrconsts:lisprojaddminimumversionoptional msgid "Minimum Version (optional):" -msgstr "Nmero mnim de versi (opcional):" +msgstr "Nmero mnim de la versi (opcional):" #: lazarusidestrconsts:lispckeditminimumversion msgid "Minimum Version:" -msgstr "Nmero mnim de versi:" +msgstr "Nmero mnim de la versi:" #: lazarusidestrconsts:lispckoptsminor msgid "Minor" @@ -3784,11 +3788,11 @@ msgstr "Miscel #: lazarusidestrconsts:lismissingpackages msgid "Missing Packages" -msgstr "" +msgstr "Paquets que falten" #: lazarusidestrconsts:dlgmixmethodsandproperties msgid "Mix methods and properties" -msgstr "Barrejar mtodes i propietats" +msgstr "Barreja els mtodes i les propietats" #: lazarusidestrconsts:srvk_modechange msgid "Mode Change" @@ -3824,115 +3828,115 @@ msgstr "Enlla #: lazarusidestrconsts:lisexttoolmovedown msgid "Move Down" -msgstr "Moure aball" +msgstr "Mou avall" #: lazarusidestrconsts:uemmoveeditorleft msgid "Move Editor Left" -msgstr "Moure l'editor a l'esquerra" +msgstr "Mou l'editor a l'esquerra" #: lazarusidestrconsts:uemmoveeditorright msgid "Move Editor Right" -msgstr "Moure l'editor a la dreta" +msgstr "Mou l'editor a la dreta" #: lazarusidestrconsts:lisexttoolmoveup msgid "Move Up" -msgstr "Moure amunt" +msgstr "Mou amunt" #: lazarusidestrconsts:lismenueditormoveup msgid "Move Up(left)" -msgstr "Moure amunt (esquerra)" +msgstr "Mou amunt (esquerra)" #: lazarusidestrconsts:lismenueditormovedown msgid "Move Up(right)" -msgstr "More amunt (dreta)" +msgstr "Mou amunt (dreta)" #: lazarusidestrconsts:srkmecpagedown msgid "Move cursor down one page" -msgstr "Moure el cursor una pgina avall" +msgstr "Mou el cursor una pgina avall" #: lazarusidestrconsts:srkmecpageleft msgid "Move cursor left one page" -msgstr "Moure el cursor una pgina a l'esquerra" +msgstr "Mou el cursor una pgina a l'esquerra" #: lazarusidestrconsts:srkmecpageright msgid "Move cursor right one page" -msgstr "Moure el cursor una pgina a la dreta" +msgstr "Mou el cursor una pgina a la dreta" #: lazarusidestrconsts:srkmeceditortop msgid "Move cursor to absolute beginning" -msgstr "Moure el cursor al principi de tot" +msgstr "Mou el cursor al principi de tot" #: lazarusidestrconsts:srkmeceditorbottom msgid "Move cursor to absolute end" -msgstr "Moure el cursor al final de tot" +msgstr "Mou el cursor al final de tot" #: lazarusidestrconsts:srkmecpagebottom msgid "Move cursor to bottom of page" -msgstr "Moure el cursor al final de la pgina" +msgstr "Mou el cursor al final de la pgina" #: lazarusidestrconsts:srkmeclineend msgid "Move cursor to line end" -msgstr "Moure el cursor al final de la lnia" +msgstr "Mou el cursor al final de la lnia" #: lazarusidestrconsts:srkmeclinestart msgid "Move cursor to line start" -msgstr "Moure el cursor al principi de la lnia" +msgstr "Mou el cursor al principi de la lnia" #: lazarusidestrconsts:srkmecpagetop msgid "Move cursor to top of page" -msgstr "Moure el cursor a l'inici de la pgina" +msgstr "Mou el cursor a l'inici de la pgina" #: lazarusidestrconsts:srkmecpageup msgid "Move cursor up one page" -msgstr "Moure el cursor una pgina amunt" +msgstr "Mou el cursor una pgina amunt" #: lazarusidestrconsts:srkmecwordleft msgid "Move cursor word left" -msgstr "Moure el cursor una paraula a l'esquerra" +msgstr "Mou el cursor una paraula a l'esquerra" #: lazarusidestrconsts:srkmecwordright msgid "Move cursor word right" -msgstr "Moure el cursor una paraula a la dreta" +msgstr "Mou el cursor una paraula a la dreta" #: lazarusidestrconsts:lispckeditmovedependencydown msgid "Move dependency down" -msgstr "Moure la dependnncia aball" +msgstr "Mou la dependnncia avall" #: lazarusidestrconsts:lispckeditmovedependencyup msgid "Move dependency up" -msgstr "Moure la dependncia amunt" +msgstr "Mou la dependncia amunt" #: lazarusidestrconsts:srkmecmoveeditorleft msgid "Move editor left" -msgstr "Moure l'editor a l'esquerra" +msgstr "Mou l'editor a l'esquerra" #: lazarusidestrconsts:srkmecmoveeditorright msgid "Move editor right" -msgstr "Moure l'editor a la dreta" +msgstr "Mou l'editor a la dreta" #: lazarusidestrconsts:liscodetoolsdefsmovenodedown msgid "Move node down" -msgstr "Moure el node avall" +msgstr "Mou el node avall" #: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" -msgstr "Moure el node un nivell avall" +msgstr "Mou el node un nivell avall" #: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" -msgstr "Moure el node un nivell amunt" +msgstr "Mou el node un nivell amunt" #: lazarusidestrconsts:liscodetoolsdefsmovenodeup msgid "Move node up" -msgstr "Moure el node amunt" +msgstr "Mou el node amunt" #: lazarusidestrconsts:lispatheditmovepathdown msgid "Move path down" -msgstr "Moure la trajectria aball" +msgstr "Mou la trajectria avall" #: lazarusidestrconsts:lispatheditmovepathup msgid "Move path up" -msgstr "Moure la trajectria amunt" +msgstr "Mou la trajectria amunt" #: lazarusidestrconsts:dlgmulti msgid "Multi" @@ -3944,23 +3948,23 @@ msgstr "L #: lazarusidestrconsts:fdinvalidmutliselectiontext msgid "Multiselected components must be of a single form." -msgstr "Components multi seleccionats han de ser d'una sola forma" +msgstr "Els components multi seleccionats han de ser d'una sola forma" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "Nota: No es pot crear plantilla definida per les fonts del Free Pascal" +msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Free Pascal" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "Nota: No es pot crear plantilla definida per les fonts del Lazarus" +msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Lazarus" #: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" -msgstr "Nota: fitxer de configuraci de les CodeTools no trobat, utilitzant predeterminats" +msgstr "Nota: No s'ha trobat el fitxer de configuraci de les eines del codi, s'utilitzen els valors predeterminats" #: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " -msgstr "Nota: Carregant fitxer de les opcions de CodeTools vell: " +msgstr "Nota: S'est carregant el fitxer de les opcions de les eines del codi antic: " #: lazarusidestrconsts:lisnameofnewprocedure msgid "Name of new procedure" @@ -3988,7 +3992,7 @@ msgstr "Nou component" #: lazarusidestrconsts:lismenunewform msgid "New Form" -msgstr "Nova Forma" +msgstr "Nova forma" #: lazarusidestrconsts:lismenunewproject msgid "New Project" @@ -4008,7 +4012,7 @@ msgstr "Nova descripci #: lazarusidestrconsts:lismenunewunit msgid "New Unit" -msgstr "Nova Unitat" +msgstr "Nova unitat" #: lazarusidestrconsts:lisa2pnewclassname msgid "New class name:" @@ -4024,7 +4028,7 @@ msgstr "Nova unitat" #: lazarusidestrconsts:lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" -msgstr "Nova unitat no en la trajectria d'unitats" +msgstr "La nova unitat no s a la trajectria de les unitats" #: lazarusidestrconsts:liscodetoolsdefsnewnode msgid "NewNode" @@ -4044,11 +4048,11 @@ msgstr "Seg #: lazarusidestrconsts:lisnoresourcestringsectionfound msgid "No ResourceString Section found" -msgstr "No s'ha trobat secci de la cadena del recurs" +msgstr "No s'ha trobat la secci de la cadena del recurs" #: lazarusidestrconsts:lisnostringconstantfound msgid "No String Constant Found" -msgstr "No trobo constant de cadena" +msgstr "No s'ha trobat la constant de cadena" #: lazarusidestrconsts:lisnochange msgid "No change" @@ -4060,27 +4064,27 @@ msgstr "No hi ha codi seleccionat" #: lazarusidestrconsts:lisnocompileroptionsinherited msgid "No compiler options inherited." -msgstr "No s'han heretat opcions del compilador" +msgstr "No s'han heretat les opcions del compilador" #: lazarusidestrconsts:dlgednoerr msgid "No errors in key mapping found." -msgstr "No trobo errors en els accessos rpids" +msgstr "No s'han trobat errors en els accessos rpids" #: lazarusidestrconsts:lisnewdlgnoitemselected msgid "No item selected" -msgstr "No hi ha element seleccionat" +msgstr "No hi ha cap element seleccionat" #: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." -msgstr "No trobo paquet per dependncia %s%s%s.%sSi us plau, escull un paquet existent." +msgstr "No s'ha trobat cap paquet per la dependncia %s%s%s.%sSi us plau, escolliu un paquet existent." #: lazarusidestrconsts:lisoipnopackageselected msgid "No package selected" -msgstr "Cap paquet seleccionat" +msgstr "No hi ha cap paquet seleccionat" #: lazarusidestrconsts:lisnoprogramfilesfound msgid "No program file %s%s%s found." -msgstr "No trobo el fitxer de programa %s%s%s." +msgstr "No s'ha trobat el fitxer del programa %s%s%s." #: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" @@ -4092,7 +4096,7 @@ msgstr "El node #: lazarusidestrconsts:srvk_nonconvert msgid "Nonconvert" -msgstr "No convertir" +msgstr "No converteixis" #: lazarusidestrconsts:dlgenvnone msgid "None" @@ -4116,7 +4120,7 @@ msgstr "No una unitat Delphi" #: lazarusidestrconsts:lisuenotfound msgid "Not found" -msgstr "No trobat" +msgstr "No s'ha trobat" #: lazarusidestrconsts:uenotimplcap msgid "Not implemented yet" @@ -4140,7 +4144,7 @@ msgstr "Fixaci #: lazarusidestrconsts:srvk_numpad msgid "Numpad %d" -msgstr "Numpad %d" +msgstr "Teclat numric %d" #: lazarusidestrconsts:uepovr msgid "OVR" @@ -4152,7 +4156,7 @@ msgstr "Objecte" #: lazarusidestrconsts:lismenuviewobjectinspector msgid "Object Inspector" -msgstr "Inspector d'objectes" +msgstr "Inspector dels objectes" #: lazarusidestrconsts:lislazbuildok msgid "Ok" @@ -4164,11 +4168,11 @@ msgstr "Ajuda en l #: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" -msgstr "L'ajuda en lnia no est implementada encara" +msgstr "L'ajuda en lnia encara no est implementada" #: lazarusidestrconsts:lisonlysearchforwholewords msgid "Only search for whole words" -msgstr "Noms buscar paraules senceres" +msgstr "Cerca noms paraules senceres" #: lazarusidestrconsts:lisdiffdlgonlyselection msgid "Only selection" @@ -4180,91 +4184,91 @@ msgstr "Nom #: lazarusidestrconsts:lismenuopen msgid "Open" -msgstr "Obrir" +msgstr "Obre" #: lazarusidestrconsts:lisdiffdlgopendiffineditor msgid "Open Diff in editor" -msgstr "Obrir diferncies a l'editor" +msgstr "Obre les diferncies a l'editor" #: lazarusidestrconsts:lisopenpackagefile msgid "Open Package File" -msgstr "Obir fitxer de paquet" +msgstr "Obre fitxer del paquet" #: lazarusidestrconsts:lisopenpackage msgid "Open Package?" -msgstr "Obrir paquet?" +msgstr "Voleu obrir el paquet?" #: lazarusidestrconsts:lisctdefsopenpreview msgid "Open Preview" -msgstr "Obrir vista prvia" +msgstr "Obre la vista prvia" #: lazarusidestrconsts:lismenuopenproject msgid "Open Project" -msgstr "Obrir projecte" +msgstr "Obre el projecte" #: lazarusidestrconsts:lisopenprojectfile msgid "Open Project File" -msgstr "Obrir fitxer de projecte" +msgstr "Obre el fitxer de projecte" #: lazarusidestrconsts:lisopenproject msgid "Open Project?" -msgstr "Obrir projecte?" +msgstr "Voleu obrir el projecte?" #: lazarusidestrconsts:lismenuopenrecent msgid "Open Recent" -msgstr "Obrir recent" +msgstr "Obre recent" #: lazarusidestrconsts:lismenuopenrecentproject msgid "Open Recent Project" -msgstr "Obrir projecte recent" +msgstr "Obre el projecte recent" #: lazarusidestrconsts:lisopenfile msgid "Open file" -msgstr "Obrir fitxer" +msgstr "Obre el fitxer" #: lazarusidestrconsts:srkmecopenfileatcursor msgid "Open file at cursor" -msgstr "Obrir el fitxer al cursor" +msgstr "Obre el fitxer al cursor" #: lazarusidestrconsts:lismenuopenfilenameatcursor msgid "Open filename at cursor" -msgstr "Obrir nom del fitxer al cursor" +msgstr "Obre nom del fitxer al cursor" #: lazarusidestrconsts:dlgqopenlastprj msgid "Open last project at start" -msgstr "Obrir l'ltim projecte a l'iniciar" +msgstr "Obre l'ltim projecte a l'iniciar" #: lazarusidestrconsts:lismenuopenpackage msgid "Open loaded package" -msgstr "Obrir paquet carregat" +msgstr "Obre el paquet carregat" #: lazarusidestrconsts:liscomppalopenpackage msgid "Open package" -msgstr "Obrir paquet" +msgstr "Obre el paquet" #: lazarusidestrconsts:lismenuopenpackagefile msgid "Open package file (.lpk)" -msgstr "Obrir fitxer de paquet (.lpk)" +msgstr "Obre el fitxer de paquet (.lpk)" #: lazarusidestrconsts:lismenuopenpackageofcurunit msgid "Open package of current unit" -msgstr "Obrir el paquet de la unitat actual" +msgstr "Obre el paquet de la unitat actual" #: lazarusidestrconsts:lismenuopenrecentpkg msgid "Open recent package" -msgstr "Obrir paquet recent" +msgstr "Obre el paquet recent" #: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile msgid "Open the package %s?%sAnswer No to load it as xml file." -msgstr "Obrir el paquet %s?%sRespon No per carregar-lo com a fitxer xml." +msgstr "Voleu obrir el paquet %s?%sResponeu No per carregar-lo com a fitxer xml." #: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile msgid "Open the project %s?%sAnswer No to load it as xml file." -msgstr "Obrir el projecte %s?%sRespon No per carregar-lo com a fitxer xml." +msgstr "Voleu obrir el projecte %s?%sResponeu No per carregar-lo com a fitxer xml." #: lazarusidestrconsts:liscomppalopenunit msgid "Open unit" -msgstr "Obrir unitat" +msgstr "Obre la unitat" #: lazarusidestrconsts:dlgoptimiz msgid "Optimizations:" @@ -4272,11 +4276,11 @@ msgstr "Optimitzacions:" #: lazarusidestrconsts:fdmsnaptogridoption msgid "Option: Snap to grid" -msgstr "Opci: Desplaar a graella" +msgstr "Opci: Desplaa a graella" #: lazarusidestrconsts:fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" -msgstr "Opci: desplaar a lnies de guia" +msgstr "Opci: Desplaa a lnies de la guia" #: lazarusidestrconsts:dlgfropts msgid "Options" @@ -4316,7 +4320,7 @@ msgstr "Par #: lazarusidestrconsts:lispkgdefsoutputdirectory msgid "Output directory" -msgstr "Directori de sortida" +msgstr "Directori de la sortida" #: lazarusidestrconsts:dlgcooverflow msgid "Overflow" @@ -4324,7 +4328,7 @@ msgstr "Sobreeiximent" #: lazarusidestrconsts:lissvuooverridesystemvariable msgid "Override system variable" -msgstr "Substituir variable del sistema" +msgstr "Substitueix la variable del sistema" #: lazarusidestrconsts:srkmecoverwritemode msgid "Overwrite Mode" @@ -4332,7 +4336,7 @@ msgstr "Mode substituir" #: lazarusidestrconsts:lisoverwritefile msgid "Overwrite file?" -msgstr "Sobrescriure el fitxer?" +msgstr "Voleu sobrescriure el fitxer?" #: lazarusidestrconsts:lispckeditpackage msgid "Package %s" @@ -4340,15 +4344,15 @@ msgstr "Paquet %s" #: lazarusidestrconsts:lispckexplpackagenotfound msgid "Package %s not found" -msgstr "No trobo el paquet %s" +msgstr "No s'ha trobat el paquet %s" #: lazarusidestrconsts:lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" -msgstr "El paquet %s%s%s ha canviat. El guardo?" +msgstr "El paquet %s%s%s ha canviat. El voleu desar?" #: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" -msgstr "El paquet %s%s%s ha canviat.%sEl guardo?" +msgstr "El paquet %s%s%s ha canviat.%sEl voleu desar?" #: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" @@ -4356,19 +4360,19 @@ msgstr "El paquet %s%s%s no t #: lazarusidestrconsts:lisaf2ppackagenotfound msgid "Package %s%s%s not found." -msgstr "No trobo el paquet %s%s%s." +msgstr "No s'ha trobat el paquet %s%s%s." #: lazarusidestrconsts:lismenupackagegraph msgid "Package Graph" -msgstr "Grfica de paquets" +msgstr "Grfica dels paquets" #: lazarusidestrconsts:lisoippackagename msgid "Package Name" -msgstr "Nom de paquet" +msgstr "Nom del paquet" #: lazarusidestrconsts:lisprojaddpackagename msgid "Package Name:" -msgstr "Nom de paquet:" +msgstr "Nom del paquet:" #: lazarusidestrconsts:lispckoptspackageoptions msgid "Package Options" @@ -4376,7 +4380,7 @@ msgstr "Opcions del paquet" #: lazarusidestrconsts:lispkgdefssrcdirmark msgid "Package Source Directory Mark" -msgstr "Marca del Directori Font del Paquet" +msgstr "Marca del directori font del paquet" #: lazarusidestrconsts:lispkgmangpackageconflicts msgid "Package conflicts" @@ -4384,7 +4388,7 @@ msgstr "Conflicte de paquets" #: lazarusidestrconsts:lispkgsyspackagefilenotfound msgid "Package file not found" -msgstr "No trobo el fitxer del paquet" +msgstr "No s'ha trobat el fitxer del paquet" #: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" @@ -4392,7 +4396,7 @@ msgstr "El paquet no #: lazarusidestrconsts:lisaf2ppackageisreadonly msgid "Package is read only" -msgstr "El paquet s de noms lectura" +msgstr "El paquet noms s de lectura" #: lazarusidestrconsts:lispkgmangpackageisrequired msgid "Package is required" @@ -4400,15 +4404,15 @@ msgstr "Es requereix el paquet" #: lazarusidestrconsts:lispkgmangpackagenamealreadyexists msgid "Package name already exists" -msgstr "El nom de paquet ja existeix" +msgstr "Ja existeix el nom del paquet" #: lazarusidestrconsts:lispackageneedsinstallation msgid "Package needs installation" -msgstr "El paquet necessita intallaci" +msgstr "S'ha d'installar el paquet" #: lazarusidestrconsts:lisprojaddpackagenotfound msgid "Package not found" -msgstr "No trobo el paquet" +msgstr "No s'ha trobat el paquet" #: lazarusidestrconsts:lispkgmangpackage msgid "Package: %s" @@ -4428,11 +4432,11 @@ msgstr "Paquets per instal #: lazarusidestrconsts:lisa2ppagenametoolong msgid "Page Name too long" -msgstr "Nom de paquet massa llarg" +msgstr "El nom del paquet s massa llarg" #: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" -msgstr "Pintar els elements dissenyats noms a l'ide (redueix sobrecrrega a ordinadors lents)" +msgstr "Pinta els elements dissenyats noms a l'ide (redueix sobrecrrega a ordinadors lents)" #: lazarusidestrconsts:lisa2ppalettepage msgid "Palette Page:" @@ -4460,23 +4464,23 @@ msgstr "Les unitats pascal han de tenir l'extensi #: lazarusidestrconsts:dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" -msgstr "Passar opcions a l'enllaador (el delimitador s l'espai)" +msgstr "Passa les opcions a l'enllaador (el delimitador s l'espai)" #: lazarusidestrconsts:lismenupaste msgid "Paste" -msgstr "Enganxar" +msgstr "Enganxa" #: lazarusidestrconsts:srkmecpaste msgid "Paste clipboard to current position" -msgstr "Enganxar el porta-retalls a la posici actual" +msgstr "Enganxa el porta-retalls a la posici actual" #: lazarusidestrconsts:lisdsgpastecomponents msgid "Paste selected components from clipboard" -msgstr "Enganxar els components seleccionats des del porta-retalls" +msgstr "Enganxa els components seleccionats des del porta-retalls" #: lazarusidestrconsts:lispatheditpathtemplates msgid "Path templates" -msgstr "Plantilles de trajectria" +msgstr "Plantilles de la trajectria" #: lazarusidestrconsts:listofpcpath msgid "Path:" @@ -4492,7 +4496,7 @@ msgstr "Traject #: lazarusidestrconsts:lismenupause msgid "Pause" -msgstr "Pausar" +msgstr "Pausa" #: lazarusidestrconsts:srvk_pause msgid "Pause key" @@ -4504,43 +4508,43 @@ msgstr "Intercalaci #: lazarusidestrconsts:lisplzcheckthecompilername msgid "Please check the compiler name" -msgstr "Si us plau, comprova el nom del compilador" +msgstr "Si us plau, comproveu el nom del compilador" #: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory msgid "Please check the freepascal source directory" -msgstr "Si us plau, comprova el directori del codi font de FreePascal" +msgstr "Si us plau, comproveu el directori del codi font de FreePascal" #: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring msgid "Please choose a resourstring section from the list." -msgstr "Si us plau, elegeix una secci de cadena de recursos de la llista" +msgstr "Si us plau, escolliu una secci de cadena del recurs de la llista" #: lazarusidestrconsts:lispleaseopenaunitbeforerun msgid "Please open a unit before run." -msgstr "Si us plau, obre una unitat abans d'executar." +msgstr "Si us plau, obriu una unitat abans d'executar." #: lazarusidestrconsts:srkmpresskey msgid "Please press a key ..." -msgstr "Prem una tecla ..." +msgstr "Premeu una tecla ..." #: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." -msgstr "Si us plau, guarda el fitxer abans d'afegir-lo a un paquet." +msgstr "Si us plau, deseu el fitxer abans d'afegir-lo a un paquet." #: lazarusidestrconsts:lisoippleaseselectapackage msgid "Please select a package" -msgstr "Si us plau, selecciona un paquet" +msgstr "Si us plau, seleccioneu un paquet" #: lazarusidestrconsts:lisoippleaseselectapackagetoopen msgid "Please select a package to open" -msgstr "Si us plau, selecciona un paquet per obrir" +msgstr "Si us plau, seleccioneu un paquet per obrir" #: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." -msgstr "Si us plau, primer selecciona un element." +msgstr "Si us plau, primer seleccioneu un element." #: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." -msgstr "Si us plau, selecciona codi per extraure un nou procediment/mtode." +msgstr "Si us plau, seleccioneu el codi per extraure'n un nou procediment/mtode." #: lazarusidestrconsts:liscodetoolsoptspoint msgid "Point" @@ -4572,15 +4576,15 @@ msgstr "El node anterior no pot contenir nodes fill" #: lazarusidestrconsts:srvk_print msgid "Print" -msgstr "Imprimir" +msgstr "Imprimeix" #: lazarusidestrconsts:listodolistprintlist msgid "Print todo items" -msgstr "Imprimir elements ToDo" +msgstr "Imprimeix elements ToDo" #: lazarusidestrconsts:srvk_prior msgid "Prior" -msgstr "Prioritat" +msgstr "Anterior" #: lazarusidestrconsts:lisprivatemethod msgid "Private Method" @@ -4588,7 +4592,7 @@ msgstr "M #: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "Probablement necessites installar alguns paquets abans de continuar.%s%sAvs:%sEl projecte depn d'alguns paquets, el quals contenen unitats amb el procediment de registre. El procediment de registre s'utilitza normalment per installar components a l'IDE. Per les segents unitats pertanyen a paquets que encara no estan installats a l'IDE. Si intentes obrir una forma a l'IDE, aix utilitza aquests components, obtindrs errors de falta de components i la crrega de la forma segurament et donar resultats indesitjats.%s%sAix no cause impacte en obrir el projecte o les seves fonts.%s%sNoms vol dir: s una mala idea obrir les formes per dissenyar, abans installa els paquets que falten.%s%s" +msgstr "Probablement necessiteu installar alguns paquets abans de continuar.%s%sAvs:%sEl projecte depn d'alguns paquets, el quals contenen unitats amb el procediment del registre. El procediment del registre s'utilitza normalment per installar components a l'IDE. Per les segents unitats pertanyen a paquets que encara no estan installats a l'IDE. Si intenteu obrir una forma a l'IDE, aix utilitza aquests components, obtindreu errors de falta de components i la crrega de la forma segurament us donar resultats indesitjats.%s%sAix no causa impacte en obrir el projecte o les seves fonts.%s%sNoms vol dir: s una mala idea obrir les formes per dissenyar, abans installeu els paquets que falten.%s%s" #: lazarusidestrconsts:lisprocedure msgid "Procedure" @@ -4608,15 +4612,15 @@ msgstr "programa" #: lazarusidestrconsts:lisprogramdetected msgid "Program detected" -msgstr "Programa detectat" +msgstr "S'ha detectat el programa" #: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "El codi font del programa han de tenir una extensi pascal com .pas, .pp o .lpr" +msgstr "El codi font del programa ha de tenir una extensi pascal com .pas, .pp o .lpr" #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "Programa%sUn programa FreePascal. El fitxer del programa s mantingut automaticament pel Lazarus." +msgstr "Programa%sUn programa FreePascal. El Lazarus mant automticament el fitxer del programa." #: lazarusidestrconsts:lisedtexttoolprogramfilename msgid "Programfilename:" @@ -4628,7 +4632,7 @@ msgstr "Projecte" #: lazarusidestrconsts:lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built. :)" -msgstr "El projecte %s%s%s ha estat muntat amb xit. :)" +msgstr "S'ha muntat amb xit el projecte %s%s%s. :)" #: lazarusidestrconsts:lisedtdefprojectincpath msgid "Project IncPath" @@ -4672,7 +4676,7 @@ msgstr "Traject #: lazarusidestrconsts:lisprojectchanged msgid "Project changed" -msgstr "Projecte canviat" +msgstr "El projecte ha canviat" #: lazarusidestrconsts:lisprojectdirectory msgid "Project directory" @@ -4704,11 +4708,11 @@ msgstr "Projecte: %s" #: lazarusidestrconsts:dlgpromptonreplace msgid "Prompt On Replace" -msgstr "Demanar al reemplaar" +msgstr "Demana al reemplaar" #: lazarusidestrconsts:lispromptforvalue msgid "Prompt for value" -msgstr "Demanar valor" +msgstr "Demana el valor" #: lazarusidestrconsts:lishlpoptsproperties msgid "Properties:" @@ -4716,7 +4720,11 @@ msgstr "Propietats:" #: lazarusidestrconsts:dlgpropertycompletion msgid "Property completion" -msgstr "Omplir propietats" +msgstr "Ompleix les propietats" + +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" @@ -4728,15 +4736,15 @@ msgstr "M #: lazarusidestrconsts:lispkgeditpublishpackage msgid "Publish Package" -msgstr "Publicar paquet" +msgstr "Publica el paquet" #: lazarusidestrconsts:lismenupublishproject msgid "Publish Project" -msgstr "Publicar projecte" +msgstr "Publica el projecte" #: lazarusidestrconsts:lispublishprojdir msgid "Publish project directory" -msgstr "Publicaci del directori del projecte" +msgstr "Publica el directori del projecte" #: lazarusidestrconsts:lispublishedmethod msgid "Published Method" @@ -4744,11 +4752,11 @@ msgstr "M #: lazarusidestrconsts:lismenuquicksyntaxcheck msgid "Quick syntax check" -msgstr "Comprovar la sintaxi rpidament" +msgstr "Comprova la sintaxi rpidament" #: lazarusidestrconsts:lismenuquit msgid "Quit" -msgstr "Sortir" +msgstr "Surt" #: lazarusidestrconsts:dlgcorange msgid "Range" @@ -4756,19 +4764,19 @@ msgstr "Abast" #: lazarusidestrconsts:lispckeditreadddependency msgid "Re-Add dependency" -msgstr "Afegir de nou la dependncia" +msgstr "Torna a afegir la dependncia" #: lazarusidestrconsts:lispckeditreaddfile msgid "Re-Add file" -msgstr "Afegir de nou el fitxer" +msgstr "Torna a afegir el fitxer" #: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" -msgstr "Tornar a compilar aquest i tots el paquets requerits?" +msgstr "Voleu tornar a compilar aquest i tots el paquets requerits?" #: lazarusidestrconsts:lisreaderror msgid "Read Error" -msgstr "Error de lectura" +msgstr "S'ha produt un error de lectura" #: lazarusidestrconsts:uemreadonly msgid "Read Only" @@ -4780,7 +4788,7 @@ msgstr "Nom #: lazarusidestrconsts:liscodetoolsdefsreaderror msgid "Read error" -msgstr "Error de lectura" +msgstr "S'ha produt un error de lectura" #: lazarusidestrconsts:dlgcdtreadprefix msgid "Read prefix" @@ -4792,35 +4800,39 @@ msgstr "Nom #: lazarusidestrconsts:lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" -msgstr "Muntar de nou el Lazarus?" +msgstr "Voleu tornar a muntar el Lazarus?" #: lazarusidestrconsts:lispckeditrecompileallrequired msgid "Recompile all required" -msgstr "Es requereix recompilar tot" +msgstr "S'ha de tornar a compilar tot" #: lazarusidestrconsts:lispckeditrecompileclean msgid "Recompile clean" -msgstr "Recompilar en net" +msgstr "Torna a compilar en net" #: lazarusidestrconsts:lismenuredo msgid "Redo" -msgstr "Refer" +msgstr "Torna a fer" #: lazarusidestrconsts:lisfepaintdesigneritemsonidle msgid "Reduce designer painting" -msgstr "Reduir pintura del disseny" +msgstr "Redueix la pintura del disseny" #: lazarusidestrconsts:uemrefactor msgid "Refactoring" -msgstr "Tornar a factoritzar" +msgstr "Torna a factoritzar" + +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" -msgstr "Refrescar" +msgstr "Refresca" #: lazarusidestrconsts:listodolistrefresh msgid "Refresh todo items" -msgstr "Refrescar elements ToDo" +msgstr "Refresca els elements ToDo" #: lazarusidestrconsts:lispkgsysregisterprocedureisnil msgid "Register procedure is nil" @@ -4828,7 +4840,7 @@ msgstr "El procediment del registre #: lazarusidestrconsts:lispckeditregisterunit msgid "Register unit" -msgstr "Registrar unitat" +msgstr "Registra la unitat" #: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." @@ -4840,7 +4852,7 @@ msgstr "Connectors registrats" #: lazarusidestrconsts:lispkgsysregistrationerror msgid "Registration Error" -msgstr "Error de registraci" +msgstr "S'ha produt un error de registre" #: lazarusidestrconsts:dlgregularexpressions msgid "Regular Expressions" @@ -4852,91 +4864,91 @@ msgstr "Expressions regulars" #: lazarusidestrconsts:lispckoptsrelease msgid "Release" -msgstr "Llenar" +msgstr "Llena" #: lazarusidestrconsts:lisdiskdiffrevertall msgid "Reload from disk" -msgstr "Tornar a carregar del disc" +msgstr "Torna a carregar del disc" #: lazarusidestrconsts:lisexttoolremove msgid "Remove" -msgstr "Esborrar" +msgstr "Elimina" #: lazarusidestrconsts:lispckeditremovedependency2 msgid "Remove Dependency?" -msgstr "Esborrar dependncia?" +msgstr "Voleu eliminar la dependncia?" #: lazarusidestrconsts:lisremoveallinvalidproperties msgid "Remove all invalid properties" -msgstr "Esborrar totes les propietats no vlides" +msgstr "Elimina totes les propietats no vlides" #: lazarusidestrconsts:lispckeditremovedependency msgid "Remove dependency" -msgstr "Esborrar dependncia" +msgstr "Elimina la dependncia" #: lazarusidestrconsts:lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" -msgstr "Esborrar dependncia %s%s%s%s del paquet %s%s%s?" +msgstr "Voleu eliminar la dependncia %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts:lispckeditremovefile msgid "Remove file" -msgstr "Esborrar fitxer" +msgstr "Elimina el fitxer" #: lazarusidestrconsts:lisprojinspremovefilefromproject msgid "Remove file %s from project?" -msgstr "Esborrar el fitxer %s del projecte?" +msgstr "Voleu eliminar el fitxer %s del projecte?" #: lazarusidestrconsts:lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "Esborrar el fitxer %s%s%s%s del paquet %s%s%s?" +msgstr "Voleu eliminar el fitxer %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts:lispckeditremovefile2 msgid "Remove file?" -msgstr "Esborrar el fitxer?" +msgstr "Voleu eliminar el fitxer?" #: lazarusidestrconsts:liscldirremovefilesmatchingfilter msgid "Remove files matching filter" -msgstr "Esborrar els fitxers que concordin amb el filtre" +msgstr "Elimina els fitxers que concordin amb el filtre" #: lazarusidestrconsts:lismenuremovefromproject msgid "Remove from Project" -msgstr "Esborrar del projecte" +msgstr "Elimina del projecte" #: lazarusidestrconsts:lisremovefromproject msgid "Remove from project" -msgstr "Esborrar del projecte" +msgstr "Elimina del projecte" #: lazarusidestrconsts:lispckeditremoveselecteditem msgid "Remove selected item" -msgstr "Esborrar element seleccionat" +msgstr "Elimina l'element seleccionat" #: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" -msgstr "Fitxers esborrats (aquestes entrades no estan guardades en el fitxer lpk)" +msgstr "Fitxers eliminats (aquestes entrades no estan desades en el fitxer lpk)" #: lazarusidestrconsts:lisprojinspremovedrequiredpackages msgid "Removed required packages" -msgstr "Paquets requerits esborrats" +msgstr "S'han eliminat els paquets requerits" #: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" -msgstr "Paquets requerits esborrats (aquestes entrades no estan guardades en el fitxer lpk" +msgstr "S'han eliminat els paquets requerits (aquestes entrades no estan desades en el fitxer lpk" #: lazarusidestrconsts:lisfrirename msgid "Rename" -msgstr "Canviar el nom" +msgstr "Canvia el nom" #: lazarusidestrconsts:lispkgmangrenamefilelowercase msgid "Rename File lowercase?" -msgstr "Canviar el nom del fitxer a minscules?" +msgstr "Voleu canviar el nom del fitxer a minscules?" #: lazarusidestrconsts:lismenurenameidentifier msgid "Rename Identifier" -msgstr "Canviar el nom de l'identificador" +msgstr "Canvia el nom de l'identificador" #: lazarusidestrconsts:lisfrirenameallreferences msgid "Rename all References" -msgstr "Canviar el nom de totes les referncies" +msgstr "Canvia el nom de totes les referncies" #: lazarusidestrconsts:lisrenamefilefailed msgid "Rename file failed" @@ -4944,47 +4956,47 @@ msgstr "Ha fallat el canvi de nom del fitxer" #: lazarusidestrconsts:lispkgmangrenamefileinpackage msgid "Rename file in package?" -msgstr "Canviar el nom del fitxer en el paquet?" +msgstr "Voleu canviar el nom del fitxer en el paquet?" #: lazarusidestrconsts:lisrenamefile msgid "Rename file?" -msgstr "Canviar el nom del fitxer?" +msgstr "Voleu canviar el nom del fitxer?" #: lazarusidestrconsts:srkmecrenameidentifier msgid "Rename identifier" -msgstr "Canviar el nom de l'identificador" +msgstr "Canvia el nom de l'identificador" #: lazarusidestrconsts:lisfrirenameto msgid "Rename to" -msgstr "Canviar el nom a" +msgstr "Canvia el nom a" #: lazarusidestrconsts:lismenureplace msgid "Replace" -msgstr "Substituir" +msgstr "Substitueix" #: lazarusidestrconsts:dlgreplaceall msgid "Replace All" -msgstr "Substituir-ho tot" +msgstr "Substitueix-ho tot" #: lazarusidestrconsts:lispkgmangreplacefile msgid "Replace File" -msgstr "Substituir el fitxer" +msgstr "Substitueix el fitxer" #: lazarusidestrconsts:lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" -msgstr "Substituir el fitxer existent %s%s%s?" +msgstr "Voleu substituir el fitxer existent %s%s%s?" #: lazarusidestrconsts:srkmecreplace msgid "Replace text" -msgstr "Substituir text" +msgstr "Substitueix el text" #: lazarusidestrconsts:lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "Substituir aquesta ocurrncia de %s%s%s%s amb %s%s%s?" +msgstr "Voleu substituir aquesta ocurrncia de %s%s%s%s amb %s%s%s?" #: lazarusidestrconsts:dlgreport msgid "Report" -msgstr "Informar" +msgstr "Informa" #: lazarusidestrconsts:lispckeditrequiredpackages msgid "Required Packages" @@ -4992,19 +5004,19 @@ msgstr "Paquets requerits" #: lazarusidestrconsts:lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" -msgstr "Escanejar de nou el directori del codi font FPC" +msgstr "Torna a escanejar el directori del codi font del FPC" #: lazarusidestrconsts:lismenuresetdebugger msgid "Reset debugger" -msgstr "Reiniciar depurador" +msgstr "Reinicia el depurador" #: lazarusidestrconsts:lisresourceloaderror msgid "Resource load error" -msgstr "Error carregant recurs" +msgstr "S'ha produt un error mentre es carregava el recurs" #: lazarusidestrconsts:lisresourcesaveerror msgid "Resource save error" -msgstr "Error guardant recurs" +msgstr "S'ha produt un error mentre es desava el recurs" #: lazarusidestrconsts:lismakeresstrresourcestringsection msgid "Resourcestring Section:" @@ -5016,27 +5028,27 @@ msgstr "Ja existeix la cadena del recurs" #: lazarusidestrconsts:lismenurestart msgid "Restart" -msgstr "Reiniciar" +msgstr "Reinicia" #: lazarusidestrconsts:lislazbuildrestartafterbuild msgid "Restart After Successfull Build" -msgstr "Reiniciar desprs de muntar amb xit" +msgstr "Reinicia desprs de muntar amb xit" #: lazarusidestrconsts:rsiwprestorewindowgeometry msgid "Restore window geometry" -msgstr "Restaurar geometria de la finestra" +msgstr "Restaura la geometria de la finestra" #: lazarusidestrconsts:rsiwprestorewindowsize msgid "Restore window size" -msgstr "Restaurar tamany de la finestra" +msgstr "Restaura el tamany de la finestra" #: lazarusidestrconsts:srvk_return msgid "Return" -msgstr "Retornar" +msgstr "Retorn" #: lazarusidestrconsts:lismenurevert msgid "Revert" -msgstr "Revertir" +msgstr "Reverteix" #: lazarusidestrconsts:lisrevertfailed msgid "Revert failed" @@ -5044,7 +5056,7 @@ msgstr "Ha fallat la reversi #: lazarusidestrconsts:lispkgeditrevertpackage msgid "Revert package?" -msgstr "Revertir paquet?" +msgstr "Voleu revertir el paquet?" #: lazarusidestrconsts:srvk_right msgid "Right" @@ -5056,7 +5068,7 @@ msgstr "Clic dret selecciona" #: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "Fes un clic amb el bot dret a l'arbre d'elements per obtenir el men emergent amb totes les funcions disponibles del paquet." +msgstr "Feu un clic amb el bot dret a l'arbre d'elements per obtenir el men emergent amb totes les funcions disponibles del paquet." #: lazarusidestrconsts:dlgrightmargin msgid "Right margin" @@ -5068,7 +5080,7 @@ msgstr "Color del marge dret" #: lazarusidestrconsts:dlgrightmousemovescursor msgid "Right mouse moves caret" -msgstr "El bot dret del ratol mou intercalaci" +msgstr "El bot dret del ratol mou l'intercalaci" #: lazarusidestrconsts:lisrightsides msgid "Right sides" @@ -5076,7 +5088,7 @@ msgstr "Costats drets" #: lazarusidestrconsts:lisrightspaceequally msgid "Right space equally" -msgstr "Igualar espai dret" +msgstr "Iguala l'espai dret" #: lazarusidestrconsts:dlgrubberbandgroup msgid "Rubber band" @@ -5084,15 +5096,15 @@ msgstr "Banda de goma" #: lazarusidestrconsts:lismenuprojectrun msgid "Run" -msgstr "Executar" +msgstr "Executa" #: lazarusidestrconsts:lismenurunfile msgid "Run File" -msgstr "Executar fitxer" +msgstr "Executa el fitxer" #: lazarusidestrconsts:lismenurunparameters msgid "Run Parameters ..." -msgstr "Parmetres d'execuci ..." +msgstr "Parmetres de l'execuci ..." #: lazarusidestrconsts:srkmcatrunmenu msgid "Run menu commands" @@ -5100,11 +5112,11 @@ msgstr "Ordres del men #: lazarusidestrconsts:dlgrunparameters msgid "Run parameters" -msgstr "Executar parmetres" +msgstr "Executa els parmetres" #: lazarusidestrconsts:lismenuruntocursor msgid "Run to cursor" -msgstr "Executar al cursor" +msgstr "Executa al cursor" #: lazarusidestrconsts:lisruntofailed msgid "Run-to failed" @@ -5128,115 +5140,115 @@ msgstr "Rus(UTF8)" #: lazarusidestrconsts:dlgbckupsubdir msgid "Same name (in subdirectory)" -msgstr "Mateix nom (a un subdirectori)" +msgstr "El mateix nom (a un subdirectori)" #: lazarusidestrconsts:lismenusave msgid "Save" -msgstr "Guardar" +msgstr "Desa" #: lazarusidestrconsts:lissavespace msgid "Save " -msgstr "Guardar" +msgstr "Desa " #: lazarusidestrconsts:lismenusaveall msgid "Save All" -msgstr "Guardar Tot" +msgstr "Desa-ho Tot" #: lazarusidestrconsts:lismenusaveas msgid "Save As" -msgstr "Guardar com a ..." +msgstr "Anomena i desa" #: lazarusidestrconsts:dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" -msgstr "" +msgstr "Anomena i desa - fica el nom dels fitxers Pascal en minscules" #: lazarusidestrconsts:lismenueditorsaveastemplate msgid "Save As Template..." -msgstr "Guardar com a plantilla..." +msgstr "Desa com a plantilla..." #: lazarusidestrconsts:lispckeditsavechanges msgid "Save Changes?" -msgstr "Guardar els canvis?" +msgstr "Voleu desar els canvis?" #: lazarusidestrconsts:lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" -msgstr "Guardar el paquet %s (*.lpk)" +msgstr "Desa el paquet %s (*.lpk)" #: lazarusidestrconsts:lispkgmangsavepackage msgid "Save Package?" -msgstr "Guardar el paquet?" +msgstr "Voleu desar el paquet?" #: lazarusidestrconsts:lismenusaveproject msgid "Save Project" -msgstr "Guardar el projecte" +msgstr "Desa el projecte" #: lazarusidestrconsts:lissaveprojectlpi msgid "Save Project %s (*.lpi)" -msgstr "Guardar el projecte %s (*.pli)" +msgstr "Desa el projecte %s (*.pli)" #: lazarusidestrconsts:lismenusaveprojectas msgid "Save Project As..." -msgstr "Guardar projecte com a ..." +msgstr "Anomena i desa el projecte" #: lazarusidestrconsts:lishintsaveall msgid "Save all" -msgstr "Guardar-ho tot" +msgstr "Desa-ho tot" #: lazarusidestrconsts:lissaveallmessagestofile msgid "Save all messages to file" -msgstr "Guardar tots els missatges al fitxer" +msgstr "Desa tots els missatges al fitxer" #: lazarusidestrconsts:liscodetoolsdefssaveandexit msgid "Save and Exit" -msgstr "Guardar i sortir" +msgstr "Desa i surt" #: lazarusidestrconsts:lissaveandexitdialog msgid "Save and exit dialog" -msgstr "Dileg Guardar i sortir" +msgstr "Dileg desa i surt" #: lazarusidestrconsts:lissaveandrebuildide msgid "Save and rebuild IDE" -msgstr "Guardar i remuntar IDE" +msgstr "Desa i remunta l'IDE" #: lazarusidestrconsts:srkmecsaveas msgid "Save as" -msgstr "Guardar com a" +msgstr "Anomena i desa" #: lazarusidestrconsts:lissavechangestoproject msgid "Save changes to project %s?" -msgstr "Guardar els canvis al projecte %s?" +msgstr "Voleu desar els canvis del projecte %s?" #: lazarusidestrconsts:lissavechanges msgid "Save changes?" -msgstr "Guardar els canvis?" +msgstr "Voleu desar els canvis?" #: lazarusidestrconsts:dlgsavedfile msgid "Save desktop settings to file" -msgstr "Guardar parmetres de l'escriptori al fitxer" +msgstr "Desa els parmetres de l'escriptori al fitxer" #: lazarusidestrconsts:dlgsaveeditorinfo msgid "Save editor info for closed files" -msgstr "Guardar informaci de l'editor pels fitxers tancats" +msgstr "Desa l'informaci de l'editor pels fitxers tancats" #: lazarusidestrconsts:dlgsaveeditorinfoproject msgid "Save editor info only for project files" -msgstr "Guardar informaci de l'editor noms per fitxers de projecte" +msgstr "Desa l'informaci de l'editor noms per fitxers del projecte" #: lazarusidestrconsts:lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "Guardar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" +msgstr "Voleu desar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" #: lazarusidestrconsts:lispckeditsavepackage msgid "Save package" -msgstr "Guardar el paquet" +msgstr "Desa el paquet" #: lazarusidestrconsts:lispkgmangsavepackage2 msgid "Save package?" -msgstr "Guardar el paquet?" +msgstr "Voleu desar el paquet?" #: lazarusidestrconsts:fdmscaleword msgid "Scale" -msgstr "Escalar" +msgstr "Escala" #: lazarusidestrconsts:lisscalingfactor msgid "Scaling factor:" @@ -5244,23 +5256,23 @@ msgstr "Factor d'escalat:" #: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" -msgstr "Explorar unitat per nom d'unitat i procediment de registre" +msgstr "Explora la unitat per nom d'unitat i procediment de registre" #: lazarusidestrconsts:liscoscanforfpcmessages msgid "Scan for FPC messages" -msgstr "Explorar missatges FPC" +msgstr "Explora els missatges del FPC" #: lazarusidestrconsts:liscoscanformakemessages msgid "Scan for Make messages" -msgstr "Explorar missatges de Make" +msgstr "Explora els missatges de Make" #: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" -msgstr "Explorar a la sortida els missatges del compilador Free Pascal" +msgstr "Explora a la sortida els missatges del compilador Free Pascal" #: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" -msgstr "Explorar a la sortida els missatges de Make" +msgstr "Explora a la sortida els missatges de Make" #: lazarusidestrconsts:dlgscope msgid "Scope" @@ -5268,51 +5280,51 @@ msgstr "Abast" #: lazarusidestrconsts:srvk_scroll msgid "Scroll" -msgstr "Desplaador" +msgstr "Desplaa" #: lazarusidestrconsts:dlgscrollbyoneless msgid "Scroll by one less" -msgstr "Desplaar un menys" +msgstr "Desplaa un menys" #: lazarusidestrconsts:srkmecscrolldown msgid "Scroll down one line" -msgstr "Desplaar una lnia avall" +msgstr "Desplaa una lnia avall" #: lazarusidestrconsts:srkmecscrollleft msgid "Scroll left one char" -msgstr "Desplaar un carcter a l'esquerra" +msgstr "Desplaa un carcter a l'esquerra" #: lazarusidestrconsts:dlgscrollpastendfile msgid "Scroll past end of file" -msgstr "Desplaar fins el final del fitxer" +msgstr "Desplaa fins el final del fitxer" #: lazarusidestrconsts:dlgscrollpastendline msgid "Scroll past end of line" -msgstr "Desplaar fins el final de la lnia" +msgstr "Desplaa fins el final de la lnia" #: lazarusidestrconsts:srkmecscrollright msgid "Scroll right one char" -msgstr "Desplaar un carcter a la dreta" +msgstr "Desplaa un carcter a la dreta" #: lazarusidestrconsts:srkmecscrollup msgid "Scroll up one line" -msgstr "Desplaar una lnia amunt" +msgstr "Desplaa una lnia amunt" #: lazarusidestrconsts:lissearchfor msgid "Search For " -msgstr "" +msgstr "Cerca" #: lazarusidestrconsts:lismenuviewsearchresults msgid "Search Results" -msgstr "Buscar resultats" +msgstr "Cerca els resultats" #: lazarusidestrconsts:lissearchagain msgid "Search again" -msgstr "" +msgstr "Torna a cercar" #: lazarusidestrconsts:lisfrisearchincommentstoo msgid "Search in comments too" -msgstr "Buscar tamb als comentaris" +msgstr "Cerca tamb en els comentaris" #: lazarusidestrconsts:lispatheditsearchpaths msgid "Search paths:" @@ -5320,159 +5332,159 @@ msgstr "Traject #: lazarusidestrconsts:lisuesearchstringnotfound msgid "Search string '%s' not found!" -msgstr "No trobo la cadena '%s'" +msgstr "No s'ha trobat la cadena '%s'" #: lazarusidestrconsts:dlgsearchabort msgid "Search terminated by user." -msgstr "Recerca finalitzada per l'usuari." +msgstr "L'usuari ha finalitzat la recerca." #: lazarusidestrconsts:lisfrisearchwhere msgid "Search where" -msgstr "On buscar" +msgstr "On cercar" #: lazarusidestrconsts:dlgsearchcaption msgid "Searching..." -msgstr "Buscant..." +msgstr "Cercant..." #: lazarusidestrconsts:lisuesearching msgid "Searching: %s" -msgstr "Buscant: %s" +msgstr "Cercant: %s" #: lazarusidestrconsts:lisseemessages msgid "See messages." -msgstr "Veure missatges." +msgstr "Visualitza els missatges." #: lazarusidestrconsts:srkmecselleft msgid "SelLeft" -msgstr "Alinear a l'esquerra" +msgstr "Alinea a l'esquerra" #: lazarusidestrconsts:srkmecselright msgid "SelRight" -msgstr "Alinear a la dreta" +msgstr "Alinea a la dreta" #: lazarusidestrconsts:lismenuselect msgid "Select" -msgstr "Seleccionar" +msgstr "Selecciona" #: lazarusidestrconsts:srkmecselectall msgid "Select All" -msgstr "Seleccionar-ho tot" +msgstr "Selecciona-ho tot" #: lazarusidestrconsts:lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" -msgstr "Seleccionar fitxers de formes Delphi (*.dfm)" +msgstr "Selecciona els fitxers de formes Delphi (*.dfm)" #: lazarusidestrconsts:srkmecseldown msgid "Select Down" -msgstr "Seleccionar avall" +msgstr "Selecciona avall" #: lazarusidestrconsts:srkmecselgotoxy msgid "Select Goto XY" -msgstr "Seleccionar anar a XY" +msgstr "Selecciona anar a XY" #: lazarusidestrconsts:srkmecsellineend msgid "Select Line End" -msgstr "Seleccionar al final de la lnia" +msgstr "Selecciona al final de la lnia" #: lazarusidestrconsts:srkmecsellinestart msgid "Select Line Start" -msgstr "Seleccionar al comenament de la lnia" +msgstr "Selecciona al comenament de la lnia" #: lazarusidestrconsts:lismenueditorselectmenu msgid "Select Menu:" -msgstr "Seleccionar men:" +msgstr "Selecciona men:" #: lazarusidestrconsts:srkmecselpagebottom msgid "Select Page Bottom" -msgstr "Seleccionar pgina inferior" +msgstr "Selecciona la pgina inferior" #: lazarusidestrconsts:srkmecselpagedown msgid "Select Page Down" -msgstr "Seleccionar pgina avall" +msgstr "Selecciona la pgina de sota" #: lazarusidestrconsts:srkmecselpageleft msgid "Select Page Left" -msgstr "Seleccionar pgina a l'esquerra" +msgstr "Selecciona la pgina de l'esquerra" #: lazarusidestrconsts:srkmecselpageright msgid "Select Page Right" -msgstr "Seleccionar pgina a la dreta" +msgstr "Selecciona la pgina de la dreta" #: lazarusidestrconsts:srkmecselpagetop msgid "Select Page Top" -msgstr "Seleccionar pgina superior" +msgstr "Selecciona la pgina superior" #: lazarusidestrconsts:srkmecselpageup msgid "Select Page Up" -msgstr "Seleccionar pgina amunt" +msgstr "Selecciona la pgina d'amunt" #: lazarusidestrconsts:lismenueditorselecttemplate msgid "Select Template:" -msgstr "Seleccionar plantilla:" +msgstr "Selecciona la plantilla:" #: lazarusidestrconsts:srkmecselup msgid "Select Up" -msgstr "Seleccionar amunt" +msgstr "Selecciona amunt" #: lazarusidestrconsts:srkmecselwordleft msgid "Select Word Left" -msgstr "Seleccionar una paraula a l'esquerra" +msgstr "Selecciona una paraula a l'esquerra" #: lazarusidestrconsts:srkmecselwordright msgid "Select Word Right" -msgstr "Seleccionar una paraula a la dreta" +msgstr "Selecciona una paraula a la dreta" #: lazarusidestrconsts:lisselectahelpitem msgid "Select a help item:" -msgstr "Seleccionar un element d'ajuda:" +msgstr "Selecciona un element de l'ajuda:" #: lazarusidestrconsts:lisselectanode msgid "Select a node" -msgstr "Seleccionar un node" +msgstr "Selecciona un node" #: lazarusidestrconsts:lisnpselectaprojecttype msgid "Select a project type" -msgstr "Seleccionar un tipus de projecte" +msgstr "Selecciona un tipus de projecte" #: lazarusidestrconsts:lismenuselectall msgid "Select all" -msgstr "Seleccionar-ho Tot" +msgstr "Selecciona-ho Tot" #: lazarusidestrconsts:lismenuselectcodeblock msgid "Select code block" -msgstr "Seleccionar bloc de codi" +msgstr "Selecciona el bloc del codi" #: lazarusidestrconsts:lispatheditselectdirectory msgid "Select directory" -msgstr "Seleccionar directori" +msgstr "Selecciona el directori" #: lazarusidestrconsts:dlgrubberbandselectsgrandchilds msgid "Select grand childs" -msgstr "Seleccionar nts" +msgstr "Selecciona els nts" #: lazarusidestrconsts:lismenuselectline msgid "Select line" -msgstr "Seleccionar lnia" +msgstr "Selecciona la lnia" #: lazarusidestrconsts:lismenuselectparagraph msgid "Select paragraph" -msgstr "Seleccionar pargraf" +msgstr "Selecciona el pargraf" #: lazarusidestrconsts:lisdsgselectparentcomponent msgid "Select parent component" -msgstr "Seleccionar component pare" +msgstr "Selecciona el component pare" #: lazarusidestrconsts:srkmecseleditortop msgid "Select to absolute beginning" -msgstr "Seleccionar fins al comenament" +msgstr "Selecciona fins al comenament" #: lazarusidestrconsts:srkmecseleditorbottom msgid "Select to absolute end" -msgstr "Seleccionar fins al final" +msgstr "Selecciona fins al final" #: lazarusidestrconsts:lismenuselecttobrace msgid "Select to brace" -msgstr "Seleccionar la tira" +msgstr "Selecciona la tira" #: lazarusidestrconsts:liscodetoolsdefsselectednode msgid "Selected Node:" @@ -5484,7 +5496,7 @@ msgstr "Text seleccionat" #: lazarusidestrconsts:lispckexplisrequiredby msgid "Selected package is required by:" -msgstr "El paquet seleccionat s requerit per:" +msgstr "El paquet seleccionat el requereix:" #: lazarusidestrconsts:dlgruberbandselectioncolor msgid "Selection" @@ -5492,7 +5504,7 @@ msgstr "Selecci #: lazarusidestrconsts:lisselectionexceedsstringconstant msgid "Selection exceeds string constant" -msgstr "La selecci excedeix la constant de cadena" +msgstr "La selecci excedeix la constant de la cadena" #: lazarusidestrconsts:lisselectiontool msgid "Selection tool" @@ -5504,19 +5516,19 @@ msgstr "Punt i coma" #: lazarusidestrconsts:fdmsendtoback msgid "Send to back" -msgstr "Enviar al darrera" +msgstr "Envia al darrera" #: lazarusidestrconsts:srkmecsetmarker msgid "Set Marker %d" -msgstr "Posicionar el marcador %d" +msgstr "Posiciona el marcador %d" #: lazarusidestrconsts:dlgsetallelementdefault msgid "Set all elements to default" -msgstr "Seleccionar tots els elements per defecte" +msgstr "Predetermina tots els elements" #: lazarusidestrconsts:dlgsetelementdefault msgid "Set element to default" -msgstr "Seleccionar element per defecte" +msgstr "Predetermina l'element" #: lazarusidestrconsts:dlgsetpropertyvariable msgid "Set property Variable" @@ -5524,7 +5536,7 @@ msgstr "Variable de propietat" #: lazarusidestrconsts:lislazbuildsettobuildall msgid "Set to %sBuild All%s" -msgstr "Definir %sMuntar-ho tot%s" +msgstr "Defineix %sMunta-ho tot%s" #: lazarusidestrconsts:srvk_shift msgid "Shift" @@ -5536,135 +5548,135 @@ msgstr "Shift Tab" #: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" -msgstr "S'ha de canviar a minscules el nom del fitxer a%s%s%s%s?" +msgstr "Voleu canviar a minscules el nom del fitxer a%s%s%s%s?" #: lazarusidestrconsts:lisaf2pshowall msgid "Show All" -msgstr "Mostar-ho tot" +msgstr "Mostra-ho tot" #: lazarusidestrconsts:lisuishowcodetoolsvalues msgid "Show CodeTools Values" -msgstr "Mostrar Valors CodeTools" +msgstr "Mostra els valors" #: lazarusidestrconsts:dlgcoshowerr msgid "Show Errors" -msgstr "Mostrar els errors" +msgstr "Mostra els errors" #: lazarusidestrconsts:dlgguidelines msgid "Show Guide Lines" -msgstr "Mostrar les lnies de guia" +msgstr "Mostra les lnies de la guia" #: lazarusidestrconsts:dlgshowhint msgid "Show Hints" -msgstr "Mostrar indicacions" +msgstr "Mostra les indicacions" #: lazarusidestrconsts:dlghintsunused msgid "Show Hints for unused units in main source" -msgstr "Mostrar suggeriments per unitats no utilitzades en la font principal" +msgstr "Mostra els suggeriments per les unitats no utilitzades en la font principal" #: lazarusidestrconsts:dlgshownotes msgid "Show Notes" -msgstr "Mostrar notes" +msgstr "Mostra les notes" #: lazarusidestrconsts:dlgcoshowoptions msgid "Show Options" -msgstr "Mostrar opcions" +msgstr "Mostra les opcions" #: lazarusidestrconsts:fdmshowoptions msgid "Show Options for form editing" -msgstr "Mostrar les opcions per editar la forma" +msgstr "Mostra les opcions per editar la forma" #: lazarusidestrconsts:dlgshowwarnings msgid "Show Warnings" -msgstr "Mostrar avisos" +msgstr "Mostra els avisos" #: lazarusidestrconsts:lisa2pshowall msgid "Show all" -msgstr "Mostrar-ho tot" +msgstr "Mostra-ho tot" #: lazarusidestrconsts:liscoshowallmessages msgid "Show all messages" -msgstr "Mostrar tots els missatges" +msgstr "Mostra tots els missatges" #: lazarusidestrconsts:dlgshowprocserror msgid "Show all procs on error" -msgstr "Mostrar tots els processos en trobar un error" +msgstr "Mostra tots els processos quan es trobi un error" #: lazarusidestrconsts:dlgclosebuttonsnotebook msgid "Show close buttons in notebook" -msgstr "Mostrar els botons de tancar en el llibre de notes" +msgstr "Mostra els botons de tancar en el llibre de notes" #: lazarusidestrconsts:dlgshowcompiledprocedures msgid "Show compiled procedures" -msgstr "Mostrar procediments compilats" +msgstr "Mostra els procediments compilats" #: lazarusidestrconsts:dlgshowcompileroptions msgid "Show compiler options" -msgstr "Mostrar les opcions del compilador" +msgstr "Mostra les opcions del compilador" #: lazarusidestrconsts:dlgshowcaps msgid "Show component captions" -msgstr "Mostrar els rtols dels components" +msgstr "Mostra els rtols dels components" #: lazarusidestrconsts:dlgshowconditionals msgid "Show conditionals" -msgstr "Mostrar els condicionals" +msgstr "Mostra els condicionals" #: lazarusidestrconsts:dlgshowdebuginfo msgid "Show debug info" -msgstr "Mostrar informaci de depuraci" +msgstr "Mostra l'informaci de la depuraci" #: lazarusidestrconsts:dlgshowdefinedmacros msgid "Show defined macros" -msgstr "Mostrar macroinstruccions definides" +msgstr "Mostra les macroinstruccions definides" #: lazarusidestrconsts:dlgshowedrhints msgid "Show editor hints" -msgstr "Mostrar els suggeriments de l'editor" +msgstr "Mostra els suggeriments de l'editor" #: lazarusidestrconsts:dlgshoweverything msgid "Show everything" -msgstr "Mostrar-ho tot" +msgstr "Mostra-ho tot" #: lazarusidestrconsts:dlgshowgeneralinfo msgid "Show general info" -msgstr "Mostrar informaci general" +msgstr "Mostra l'informaci general" #: lazarusidestrconsts:dlgqshowgrid msgid "Show grid" -msgstr "Mostrar graella" +msgstr "Mostra la graella" #: lazarusidestrconsts:dlgshowgutterhints msgid "Show gutter hints" -msgstr "Mostrar suggeriments sense importncia" +msgstr "Mostra els suggeriments sense importncia" #: lazarusidestrconsts:dlgshowlinenumbers msgid "Show line numbers" -msgstr "Mostrar els nmeros de lnia" +msgstr "Mostra els nmeros de lnia" #: lazarusidestrconsts:dlgshownothing msgid "Show nothing (only errors)" -msgstr "No mostrar rs (noms errors)" +msgstr "No mostris res (noms els errors)" #: lazarusidestrconsts:dlgshowscrollhint msgid "Show scroll hint" -msgstr "Mostrar suggeriment deplaat" +msgstr "Mostra el suggeriment deplaat" #: lazarusidestrconsts:dlgshowsummary msgid "Show summary" -msgstr "Mostrar reportatge" +msgstr "Mostra el reportatge" #: lazarusidestrconsts:dlgshowtriedfiles msgid "Show tried files" -msgstr "Mostrar els fitxers triats" +msgstr "Mostra els fitxers escollits" #: lazarusidestrconsts:dlgshowusedfiles msgid "Show used files" -msgstr "Mostrar els fitxers utilitzats" +msgstr "Mostra els fitxers utilitzats" #: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" -msgstr "Sintaxi simple (p.e. * en lloc de .*)" +msgstr "Sintaxi simple (p.ex. * en lloc de .*)" #: lazarusidestrconsts:fdmsizeword msgid "Size" @@ -5672,7 +5684,7 @@ msgstr "Tamany" #: lazarusidestrconsts:liscoskipcallingcompiler msgid "Skip calling Compiler" -msgstr "No cridar el compilador" +msgstr "No cridis el compilador" #: lazarusidestrconsts:dlgcosmaller msgid "Smaller Code" @@ -5688,11 +5700,11 @@ msgstr "Tabuladors intel #: lazarusidestrconsts:dlgsnapguidelines msgid "Snap to Guide Lines" -msgstr "Ajustar a les lnies de guia" +msgstr "Ajusta a les lnies de la guia" #: lazarusidestrconsts:dlgqsnaptogrid msgid "Snap to grid" -msgstr "Ajustar a graella" +msgstr "Ajusta a la graella" #: lazarusidestrconsts:srvk_snapshot msgid "Snapshot" @@ -5712,11 +5724,11 @@ msgstr "Ho sento, aquest tipus encara no est #: lazarusidestrconsts:lismenusortselection msgid "Sort selection" -msgstr "Ordenar selecci" +msgstr "Ordena la selecci" #: lazarusidestrconsts:lismenuviewsourceeditor msgid "Source Editor" -msgstr "Editor de codi font" +msgstr "Editor del codi font" #: lazarusidestrconsts:srkmcatsrcnotebook msgid "Source Notebook commands" @@ -5728,19 +5740,19 @@ msgstr "Font i destinaci #: lazarusidestrconsts:lismenuaddbpsource msgid "Source breakpoint" -msgstr "Punt de trencament de la Font" +msgstr "Punt de ruptura de les fonts" #: lazarusidestrconsts:lissourcedirectorydoesnotexists msgid "Source directory %s%s%s does not exists." -msgstr "El directori del codi font %s%s%s no existeix." +msgstr "No existeix el directori del codi font %s%s%s." #: lazarusidestrconsts:lissourcemodified msgid "Source modified" -msgstr "Codi font modificat" +msgstr "S'ha modificat el codi font" #: lazarusidestrconsts:lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" -msgstr "El codi font de la pgina %s%s%s ha canviat. La guardo?" +msgstr "El codi font de la pgina %s%s%s ha canviat. Voleu desar-lo?" #: lazarusidestrconsts:lismakeresstrsourcepreview msgid "Source preview" @@ -5748,11 +5760,11 @@ msgstr "Visualitzaci #: lazarusidestrconsts:dlgspacenotcosmos msgid "Space" -msgstr "Espai" +msgstr "Espaiat" #: lazarusidestrconsts:lisspaceequally msgid "Space equally" -msgstr "Igualar espais" +msgstr "Iguala els espais" #: lazarusidestrconsts:srvk_space msgid "Space key" @@ -5776,11 +5788,11 @@ msgstr "Pila" #: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" -msgstr "Edici de men normalitzat" +msgstr "Men d'edici normalitzat" #: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" -msgstr "Edici de fitxer normalitzat" +msgstr "Men del fitxer normalitzat" #: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" @@ -5792,7 +5804,7 @@ msgstr "Estat" #: lazarusidestrconsts:dlgstatickeyword msgid "Static Keyword in Objects" -msgstr "Paraula clau Static en objectes" +msgstr "Paraula clau Static en els objectes" #: lazarusidestrconsts:lishintstepinto msgid "Step Into" @@ -5812,31 +5824,31 @@ msgstr "Pas a pas per funcions" #: lazarusidestrconsts:lismenustop msgid "Stop" -msgstr "Aturar" +msgstr "Atura" #: lazarusidestrconsts:lisstopdebugging msgid "Stop Debugging?" -msgstr "Aturar la depuraci?" +msgstr "Voleu aturar la depuraci?" #: lazarusidestrconsts:dlgstopafternrerr msgid "Stop after number of errors:" -msgstr "Aturar desprs del nombre d'errors:" +msgstr "Atura desprs del nombre d'errors:" #: lazarusidestrconsts:lisstopthedebugging msgid "Stop the debugging?" -msgstr "Aturar la depuraci?" +msgstr "Voleu aturar la depuraci?" #: lazarusidestrconsts:dlgcdtstoredpostfix msgid "Stored postfix" -msgstr "Postfix Guardat" +msgstr "Postfix de desat" #: lazarusidestrconsts:lisstreamingerror msgid "Streaming error" -msgstr "Error d'afluent" +msgstr "S'ha produt un error d'afluent" #: lazarusidestrconsts:lismakeresstrstringconstantinsource msgid "String Constant in source" -msgstr "Constant de cadena al codi font" +msgstr "Constant de cadena en el codi font" #: lazarusidestrconsts:liscodetoolsoptsstringconst msgid "String constant" @@ -5848,7 +5860,7 @@ msgstr "Cadenes amb el mateix valor:" #: lazarusidestrconsts:dlgcostrip msgid "Strip Symbols From Executable" -msgstr "Eliminar smbols de l'executable" +msgstr "Elimina els smbols de l'executable" #: lazarusidestrconsts:dlgcostyle msgid "Style:" @@ -5866,6 +5878,10 @@ msgstr "Subprocediment en el mateix nivell" msgid "Sub directory" msgstr "Subdirectori" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Commutar trajectries" @@ -5892,11 +5908,11 @@ msgstr "SynEdit - el component editor utilitzat pel Lazarus. http://sourceforge. #: lazarusidestrconsts:srkmecsyntaxcheck msgid "Syntax check" -msgstr "Comprovar la sintaxi" +msgstr "Comprova la sintaxi" #: lazarusidestrconsts:dlgsyntaxoptions msgid "Syntax options" -msgstr "" +msgstr "Opcions de la sintaxi" #: lazarusidestrconsts:dlgrunosystemvariables msgid "System variables" @@ -5916,7 +5932,7 @@ msgstr "El tabulador sagna blocs" #: lazarusidestrconsts:dlgtabwidths msgid "Tab widths:" -msgstr "Amplada Tab:" +msgstr "Amplades del tabulador:" #: lazarusidestrconsts:dlgtabstospaces msgid "Tabs to spaces" @@ -5932,15 +5948,15 @@ msgstr "CPU destinaci #: lazarusidestrconsts:lislazbuildtargetdirectory msgid "Target Directory:" -msgstr "Directori destinaci:" +msgstr "Directori dest.:" #: lazarusidestrconsts:listargetos msgid "Target OS" -msgstr "SO destinaci" +msgstr "SO de destinaci" #: lazarusidestrconsts:liscotargetosspecificoptions msgid "Target OS specific options" -msgstr "Opcions especifiques del SO destinaci" +msgstr "Opcions especifiques del SO de destinaci" #: lazarusidestrconsts:lislazbuildtargetos msgid "Target OS:" @@ -5980,7 +5996,7 @@ msgstr "Directori de proves" #: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." -msgstr "No trobo el directori de proves \"%s\"." +msgstr "No s'ha trobat el directori de les proves \"%s\"." #: lazarusidestrconsts:lispkgfiletypetext msgid "Text" @@ -5992,23 +6008,23 @@ msgstr "Atributs del text" #: lazarusidestrconsts:srkmcatediting msgid "Text editing commands" -msgstr "Ordres d'edici de text" +msgstr "Ordres d'edici del text" #: lazarusidestrconsts:srkmcatmarker msgid "Text marker commands" -msgstr "Ordres de marcadors de text" +msgstr "Ordres de marcadors del text" #: lazarusidestrconsts:srkmcatsearchreplace msgid "Text search and replace commands" -msgstr "Ordres de recerca i reemplaament de text" +msgstr "Ordres de recerca i reemplaament del text" #: lazarusidestrconsts:srkmcatselection msgid "Text selection commands" -msgstr "Ordres de selecci de text" +msgstr "Ordres de selecci del text" #: lazarusidestrconsts:lisfindfiletexttofind msgid "Text to find:" -msgstr "Text a trobar:" +msgstr "Text a cercar:" #: lazarusidestrconsts:lisdiffdlgtext1 msgid "Text1" @@ -6020,11 +6036,11 @@ msgstr "Text2" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" -msgstr "El directori principal %s,%son Borland ha installat totes les fonts %s,%sles quals son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" +msgstr "El directori principal %s,%son Borland ha installat totes les fonts %s,%si que son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "El directori principal %s, on Borland ha installat totes les fonts %s les quals son utilitzades per aquest projecte.%s Per exemple: C:/Programme/Borland/Delphi%s" +msgstr "El directori principal %s, on Borland ha installat totes les fonts %s i que son utilitzades per aquest projecte.%s Per exemple: C:/Programme/Borland/Delphi%s" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" @@ -6052,11 +6068,11 @@ msgstr "El directori CVS del codi font del Free Pascal" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal CVS source directory. Not required. This will improve find declarationand debugging." -msgstr "El directori font CVS del Free Pascal. No es requereix. Aix millorar el trobar depuraci a les declaracions." +msgstr "El directori font CVS del Free Pascal. No es requereix. Aix millora la recerca de depuraci a les declaracions." #: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "El compilador Free Pascal (nom de fitxer: %s) no ha estat trobat.%sRecomano que installis fpc." +msgstr "No s'ha trobat el compilador Free Pascal (nom de fitxer: %s).%sUs recomano que installeu el fpc." #: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." @@ -6064,7 +6080,7 @@ msgstr "El directori del projecte Free Pascal" #: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "No trobo el directori del codi font del Free Pascal.%sAlgunes funcions codificades no funcionaran.%sRecomano que les installis i posis la trajectria%SEntorn -> Opcions de l'entorn -> Fitxers" +msgstr "No s'ha trobat el directori del codi font del Free Pascal.%sAlgunes funcions codificades no funcionaran.%sUs recomano que les installeu i poseu la trajectria%SEntorn -> Opcions de l'entorn -> Fitxers" #: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." @@ -6072,11 +6088,11 @@ msgstr "La LCL - Lazarus Component Library cont #: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "El fitxer LFM (Lazarus Form) cont propietats no vlides. Aix vol dir, per exemple, que cont algunes propietats/classes les quals no existeixen en la LCL actual. La manera normar de corregir aix s esborrar aquestes propietats de la LFM i corregir manualment el codi pascal." +msgstr "El fitxer LFM (Lazarus Form) cont propietats no vlides. Aix vol dir, per exemple, que cont algunes propietats/classes les quals no existeixen en la LCL actual. La manera normal de corregir aix s eliminar aquestes propietats de la LFM i corregir manualment el codi pascal." #: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "El directori Lazarus no ha estat trobat.%sNo prodrs crear aplicacions LCL.%sSi us plau, comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "No s'ha trobat el directori Lazarus.%sNo prodreu crear aplicacions LCL.%sSi us plau, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." @@ -6084,7 +6100,7 @@ msgstr "El directori principal del Lazarus" #: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "La versi mxima %s%s%s no s vlida.%sSi us plau, utilitza el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" +msgstr "La versi mxima %s%s%s no s vlida.%sSi us plau, utilitzeu el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." @@ -6092,11 +6108,11 @@ msgstr "La versi #: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "La versi mnima %s%s%s no s vlida.%sSi us plau, utilitza el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" +msgstr "La versi mnima %s%s%s no s vlida.%sSi us plau, utilitzeu el format major.menor.llanament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "No trobo el directori de proves:%s%s%s%s%s(mira les opcions de l'entorn" +msgstr "No s'ha pogut trobar el directori de les proves:%s%s%s%s%s(mireu les opcions de l'entorn)" #: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." @@ -6108,7 +6124,7 @@ msgstr "El tipus avantpassat %s%s%s no #: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "La classe %s%s%s s un TControl i no pot ser enganxat dins un no-control%sNo es pot enganxar." +msgstr "La classe %s%s%s s un TControl i no pot ser enganxat dins un no-control%sNo s'ha pogut enganxar." #: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." @@ -6132,7 +6148,7 @@ msgstr "L'ordre de despr #: lazarusidestrconsts:listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "L'ordre desprs de publicar s invlida:%s%s%s%s" +msgstr "L'ordre desprs de publicar no s vlida:%s%s%s%s" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." @@ -6152,35 +6168,35 @@ msgstr "L'editor de component de classe %s%s%s ha generat l'error:%s%s%s%s" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte.%sComprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte.%sComproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podrs crear aplicacions LCL.%s Comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podreu crear aplicacions LCL.%s Comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podrs crear aplicacions LCL.%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podreu crear aplicacions LCL.%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "El nom del compilador actual %s%s%s%s no s un executable vlid.%sEscull D'ACORD per escollir el predeterminat %s%s%s.%sSi no, comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El nom del compilador actual %s%s%s%s no s un executable vlid.%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "El nom del compilador actual %s%s%s%sno s un executable vlid.%s Si us plau, comprova Entorn -> Opcions de l'Entorn -> Fitxers" +msgstr "El nom del compilador actual %s%s%s%sno s un executable vlid.%s Si us plau, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "La trajectria d'unitat actual pel fitxer%s%s%s%s s %s%s%s%s.%s%sFalta la trajectria a les unitats LCL %s%s%s.%s%sSuggeriment per aprenents:%sCrear una aplicaci Lazarus i posar el fitxer dins del directori del projecte." +msgstr "La trajectria de la unitat actual pel fitxer%s%s%s%s s %s%s%s%s.%s%sFalta la trajectria a les unitats LCL %s%s%s.%s%sSuggeriment per aprenents:%sCreeu una aplicaci Lazarus i poseu el fitxer dins del directori del projecte." #: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exists or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "El depurador %s%s%s%sno existeix o no s executable.%s%sComprova Entorn -> Opcions del Depurador" +msgstr "El depurador %s%s%s%sno existeix o no s executable.%s%sComproveu Entorn -> Opcions del Depurador" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." @@ -6188,11 +6204,11 @@ msgstr "El fitxer del depurador \"%s\" no #: lazarusidestrconsts:lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "No he trobat la dependncia %s%s%s.%sSi us plau, escull un paquet existent" +msgstr "No s'ha trobat la dependncia %s%s%s.%sSi us plau, escolliu un paquet que existeixi" #: lazarusidestrconsts:listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." -msgstr "El directori destinaci%s%s%s%s no existeix." +msgstr "No existeix el directori de destinaci%s%s%s%s." #: lazarusidestrconsts:dlgthedirectory msgid "The directory \"" @@ -6228,27 +6244,27 @@ msgstr "El fitxer %s%s%s%sja #: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "El fitxer %s%s%s%sja no est en la trajectria d'unitats del paquet.%s%sAfegir %s%s%s a la trajectria d'unitats? " +msgstr "El fitxer %s%s%s%sja no s a la trajectria d'unitats del paquet.%s%sVoleu afegir %s%s%s a la trajectria de les unitats? " #: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "El fitxer %s%s%s%ssembla ser un programa. Tanco el projecte actual i creo un nou projecte Lazarus per aquest programa?%s\"No\" carregar el fitxer com un codi font normal." +msgstr "El fitxer %s%s%s%ssembla ser un programa. voleu tancar el projecte actual i crear un nou projecte Lazarus per aquest programa?%s\"No\" carregar el fitxer com un codi font normal." #: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source." -msgstr "El fitxer %s%s%s%ssembla ser un fitxer de programa d'un projecte Lazarus existent.%sObrir el projecte?%sCancellar carregar el fitxer com un codi font normal." +msgstr "El fitxer %s%s%s%ssembla ser un fitxer de programa d'un projecte Lazarus que ja existeix.%sVoleu obrir el projecte?%sCancella carregar el fitxer com un codi font normal." #: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "He trobat el fitxer %s%s%s%s en un dels directoris font del paquet %s i sembla una unitat compilada. Les unitats compilades han d'estar en el directori sortida del paquet, si no, altres paquets poden tenir problemes utilitzant aquest paquet.%s%sEsborrar el fitxer ambigu?" +msgstr "" #: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "No he trobat el fitxer %s%s%s%s.%sEl vols buscar tu mateix ?%s" +msgstr "No s'ha trobat el fitxer %s%s%s%s.%sEl voleu localitzar manualment ?%s" #: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "No he trobat el fitxer %s%s%s%s.Ignorar, carregar el projecte.%sAvortar aturar la crrega." +msgstr "No s'ha trobat el fitxer %s%s%s%s.Ignora, carregar el projecte.%sAvorta n'aturar la crrega." #: lazarusidestrconsts:uefilerotext1 msgid "The file \"" @@ -6256,7 +6272,7 @@ msgstr "El fitxer \"" #: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." -msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no haurien de compartir fitxers." +msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no han de compartir fitxers." #: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." @@ -6264,19 +6280,19 @@ msgstr "El nom de fitxer %s%s%s est #: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" -msgstr "El nom de fitxer %s%s%s no correspon al nom de paquet %s%s%s en el fitxer. %sCanviar nom de paquet a %s%s%s?" +msgstr "El nom de fitxer %s%s%s no correspon al nom del paquet %s%s%s en el fitxer. %sVoleu canviar nom del paquet a %s%s%s?" #: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous.%sPlease specifiy a filename with full path." -msgstr "El nom de fitxer %s%s%s s ambigu.%sSi us plau especifica un nom de fitxer amb la trajectria completa." +msgstr "" #: lazarusidestrconsts:listhefollowingpackagesfailedtoload msgid "The following package(s) failed to load:%s%s" -msgstr "" +msgstr "S'ha fallat en carregar el(s) paquet(s):%s%s" #: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" -msgstr "Les segents unitats no han estat trobades:%s%s%s%s1)O b, aquestes unitats no estan en la trajectria corresponent, en aquest cas pots avortar ara mateix, corregir la trajectria d'unitats i provar de nou.%s2) O les unitats venent d'un sistema de fitxers no sensible a majs/mins (windows/Delphi) i ara estan a un sistema sensible (linux, bsd, macosx). En aquest cas hauries d'avortar, canviar el nom de totes les unitats a minscules i tornar a provar.%s3) O pots ignorar les unitats que falten i continuar.%s%sComentar les unitats que falten?" +msgstr "No s'han pogut trobar Les segents unitats:%s%s%s%s1)O b, aquestes unitats no estan en la trajectria corresponent, en aquest cas podeu avortar ara mateix, corregir la trajectria d'unitats i tornar a provar.%s2) O les unitats venent d'un sistema de fitxers no sensible a majs/mins (windows/Delphi) i ara estan a un sistema sensible (linux, bsd, macosx). En aquest cas heu d'avortar, canviar el nom de totes les unitats a minscules i tornar a provar.%s3) O podeu ignorar les unitats que falten i continuar.%s%sVoleu comentar les unitats que falten?" #: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." @@ -6284,7 +6300,7 @@ msgstr "L'aplicaci #: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exists or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "L'aplicaci llenadora %s%s%s%ssembla no existir o no s executable.%s%sMira Executar -> Parmetres d'Execuci -> Local" +msgstr "L'aplicaci %s%s%s%s no existeix o no s executable.%s%sMireu Executa -> Parmetres d'Execuci -> Local" #: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." @@ -6320,11 +6336,11 @@ msgstr "El paquet %s #: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "El paquet %s s requerit per %s, el qual est marcat per la installaci.%sMira la grfica del paquet." +msgstr "El paquet %s el requereix %s, el qual est marcat per installar.%sMireu la grfica del paquet." #: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "El paquet %s s propietari del fitxer%s%s%s%s.%sS'ha de canviar el nom del fitxer en el paquet tamb?" +msgstr "El paquet %s s propietari del fitxer%s%s%s%s.%sVoleu canviar el nom del fitxer en el paquet tamb?" #: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." @@ -6336,15 +6352,15 @@ msgstr "El paquet %s%s%s est #: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "S'ha marcat el paquet %s%s%s per installar, per no s'ha trobat.%sEsborrar dependncia de la llista de paquets de la installaci?" +msgstr "No s'ha pogut trobar el paquet marcat per installar %s%s%s.%sVoleu eliminar la dependncia de la llista de paquets de la installaci?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "El paquet %s%s%s ha estat marcat per installar.%sActualment el Lazarus noms suporta paquets enllaats estticament. La installaci real necessita el remuntatge i reinici del Lazarus.%s%sVols remuntar el Lazarus ara?" +msgstr "S'ha marcat per installar el paquet %s%s%s.%sActualment el Lazarus noms en permet en paquets enllaats estticament. La installaci real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "El paquet %s%s%s est marcat.%sActualment el Lazarus noms suporta paquets enllaats estticament. La des-installaci real necessita el remuntatge i reinici del Lazarus.%s%sVols remuntar el Lazarus ara?" +msgstr "S'ha marcat el paquet %s%s%s.%sActualment el Lazarus noms en permet en paquets enllaats estticament. La des-installaci real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." @@ -6356,15 +6372,15 @@ msgstr "El paquet ja t #: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escull un paquet existent." +msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escolliu un paquet que existeixi." #: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." -msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escull un paquet existent." +msgstr "El nom de paquet %s%s%s no s vlid.%sSi us plau, escolliu un paquet existent." #: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "El nom de paquet %s%s%s no s un nom de paquet vlid%sSi us plau, escull-ne un altre (p.e. paquet1.lpk)" +msgstr "El nom de paquet %s%s%s no s un nom de paquet vlid%sSi us plau, escolliu-ne un altre (p.ex. paquet1.lpk)" #: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." @@ -6376,7 +6392,7 @@ msgstr "El nom de p #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC CVS source below. Used to autocreate macros." -msgstr "La trajectria del Free Pascal per aquest projecte. Noms es requereix si has definit el codi font del FPC CVS. Utilitzat per auto-crear macrosinstruccions." +msgstr "La trajectria del Free Pascal per aquest projecte. Es requereix noms si heu definit el codi font del FPC CVS. Utilitzat per auto-crear macrosinstruccions." #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." @@ -6396,31 +6412,31 @@ msgstr "El fitxer d'informaci #: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "S'ha de guardar el projecte abans de muntar de nou%sSi fiques el directori de proves en les opcions de l'entorn,%spots crear projectes nous i muntar-los al mateix temps.%sGuardar el projecte?" +msgstr "S'ha de desar el projecte abans de muntar de nou%sSi fiqueu el directori de les proves en les opcions de l'entorn,%spodeu crear projectes nous i muntar-los al mateix temps.%sVoleu desar el projecte?" #: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "El projecte requereix el paquet %s%s%s.%sPer no ha estat trobat. Mira Projecte -> Inspector del Projecte." +msgstr "El projecte requereix el paquet %s%s%s.%sPer no s'ha trobat. Mireu Projecte -> Inspector del Projecte." #: lazarusidestrconsts:lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escull un altre nom. %s Fes servir Ignorar per afegir-la de tota manera" +msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escolliu-ne un altre nom. %s Escolliu - Ignora - per afegir-la de tota manera" #: lazarusidestrconsts:listherootcomponentcannotbedeleted msgid "The root component can not be deleted." -msgstr "No es pot esborrar el component arrel." +msgstr "No es pot eliminar el component arrel." #: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "Ja existeix la unitat %s%s%s.%sIgnorar forar el canvi de nom,%sCancellar no guardar el codi font i%sAvortar no guardar cap cnvi." +msgstr "Ja existeix la unitat %s%s%s.%sIgnora forar el canvi de nom,%sCancella no desar el codi font i%sAvorta no desar cap cnvi." #: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" -msgstr "La unitat %s%s%s no est en minscules.%sEl compilador FreePascal 1.0.x necessita noms de fitxer en minscules. Si no utilitzes aquest compilador, pots ignorar el missatge.%s%sCanviar el nom del fitxer?" +msgstr "La unitat %s%s%s no est en minscules.%sEl compilador FreePascal 1.0.x necessita noms de fitxer en minscules. Si no utilitzeu aquest compilador, podeu ignorar el missatge.%s%sVoleu canviar el nom del fitxer?" #: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "La mateixa unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser nics." +msgstr "La unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser nics." #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." @@ -6460,7 +6476,7 @@ msgstr "Hi ha m #: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no ms son diferents en la capitalitzaci:%s%s%sEsborrar-los?" +msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no ms son diferents en la capitalitzaci:%s%s%sVoleu eliminar-los?" #: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" @@ -6476,11 +6492,11 @@ msgstr "Hi ha una unitat FPC amb el mateix nom que:%s%s%s%s%s de %s%s%s" #: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." -msgstr "Hi ha un cercle en els paquets requerits. Mira la grfica de paquets." +msgstr "Hi ha un cercle en els paquets requerits. Mireu la grfica de paquets." #: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "Hi ha un fitxer amb el mateix nom i extensi similar en el disc%sFitxer: %s%sFitxer ambigu: %s%s%sEsborrar fitxer ambigu?" +msgstr "" #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." @@ -6488,7 +6504,7 @@ msgstr "Hi ha un m #: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" -msgstr "Hi ha una unitat amb el nom %s%s%s en el projecte.%sSi us plau, escull un nom diferent." +msgstr "En el projecte hi ha una unitat amb el nom %s%s%s.%sSi us plau, escolliu un nom diferent." #: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" @@ -6500,7 +6516,7 @@ msgstr "Ja hi ha una forma amb el nom %s%s%s" #: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMira Components -> Grfica dels paquets.%sReemplaar s impossible." +msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMireu Components -> Grfica dels paquets.%sNo es pot reemplaar." #: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." @@ -6512,19 +6528,19 @@ msgstr "Ja hi ha un altre paquet amb el nom %s%s%s.%sPaquet amb conficte: %s%s%s #: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." -msgstr "Hi ha un paquet no guardat en els paquets requerits. Mira grfica de paquets." +msgstr "Hi ha un paquet no desat en els paquets requerits. Mireu la grfica dels paquets." #: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "Hi ha un error escrivint el component seleccionat %s:%s:%s%s" +msgstr "S'ha produt un error mentre s'escrivia el component seleccionat %s:%s:%s%s" #: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "Hi ha hagut un error convertint l'afluent binari del component seleccionat %s:%s:%s%s" +msgstr "S'ha produt un error mentre es convertia l'afluent binari del component seleccionat %s:%s:%s%s" #: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "Hi ha hagut un error convertint l'afluent del component al porta-retalls:%s%s" +msgstr "S'ha produt un error mentre es copiava l'afluent del component al porta-retalls:%s%s" #: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." @@ -6532,7 +6548,7 @@ msgstr "Aquest fitxer no #: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" -msgstr "" +msgstr "Aquest fitxer l'ha creat automticament el Lazarus. No l'editeu!" #: lazarusidestrconsts:lisresourcefilecomment msgid "This is an automatically generated lazarus resource file" @@ -6540,23 +6556,23 @@ msgstr "Aquest #: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "Aquest s el paquet predeterminat. Utilitzat noms per components sense paquet. Aquests components estan desfasats." +msgstr "Aquest s el paquet predeterminat. S'utilitza noms per components sense paquet. Aquests components estan desfasats." #: lazarusidestrconsts:listhislookslikeapascalfilefpc10xexpectspascalfiles msgid "This looks like a pascal file.%sfpc 1.0.x expects pascal files lowercase.%sRename it to lowercase?" -msgstr "Aix sembla un fitxer pascal.%sfpc 1.0.x espera fitxers pascal en minscules.%sCanviar el nom a minscules?" +msgstr "Aix sembla un fitxer pascal.%sfpc 1.0.x espera fitxers pascal en minscules.%sVoleu canviar el nom a minscules?" #: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found.All its components are deactivated. Please fix this." -msgstr "Aquest paquet est installat, per no s'ha trobat el fitxer lpk. Tots els seus components estan desactivats. Si us plau, corregeix aix." +msgstr "Aquest paquet est installat, per no s'ha trobat el fitxer lpk. Tots els seus components estan desactivats. Si us plau, corregiu aix." #: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." -msgstr "" +msgstr "Aquesta font noms s'utilitza per compilar i installar el paquet." #: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "No es pot extraure aquesta declaraci.%sSi us plau, selecciona codi per extreure'n un nou procediment/mtode." +msgstr "No s'ha pogut extraure aquesta declaraci.%sSi us plau, seleccioneu codi per extreure'n un nou procediment/mtode." #: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" @@ -6568,7 +6584,7 @@ msgstr "T #: lazarusidestrconsts:listodolistcaption msgid "ToDo List" -msgstr "Llistar ToDo" +msgstr "Llista ToDo" #: lazarusidestrconsts:listodolistoptions msgid "ToDo options..." @@ -6576,15 +6592,15 @@ msgstr "Opcions ToDo" #: lazarusidestrconsts:lishinttoggleformunit msgid "Toggle Form/Unit" -msgstr "Canviar forma/unitat" +msgstr "Canvia forma/unitat" #: lazarusidestrconsts:srkmectogglemode msgid "Toggle Mode" -msgstr "Mode de commutaci" +msgstr "Canvia el mode" #: lazarusidestrconsts:lismenuviewtoggleformunit msgid "Toggle form/unit view" -msgstr "Canviar visi forma/unitat" +msgstr "Canvia visi forma/unitat" #: lazarusidestrconsts:liscodetempltoken msgid "Token:" @@ -6608,7 +6624,7 @@ msgstr "Eines del s #: lazarusidestrconsts:listopspaceequally msgid "Top space equally" -msgstr "Igualar espai superior" +msgstr "Iguala l'espai superior" #: lazarusidestrconsts:dlgtoppos msgid "Top:" @@ -6620,7 +6636,7 @@ msgstr "L #: lazarusidestrconsts:dlgtrimtrailingspaces msgid "Trim trailing spaces" -msgstr "" +msgstr "Suprimeix els espais finals" #: lazarusidestrconsts:lismenutemplatetutorial msgid "Tutorial" @@ -6664,11 +6680,11 @@ msgstr "No es pot fer copia de seguretat del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." -msgstr "No es pot canviar la llista de les formes creades automticament en el codi font del programa. %s Si us plau, corregeix els errors primer." +msgstr "No es pot canviar la llista de les formes creades automticament en el codi font del programa. %s Si us plau, corregiu primer els errors." #: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." -msgstr "No es pot netejar %s%s%s.%sSi us plau, comprova els permisos." +msgstr "No es pot netejar %s%s%s.%sSi us plau, comproveu els permisos." #: lazarusidestrconsts:lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" @@ -6688,7 +6704,7 @@ msgstr "No es pot convertir lfm a lrs i escriure fitxer lrs." #: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" -msgstr "No es pot convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" +msgstr "No es poden convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" #: lazarusidestrconsts:lisunabletocopyfile msgid "Unable to copy file" @@ -6736,7 +6752,7 @@ msgstr "No es pot crear el fitxer%s%s%s%s" #: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin msgid "Unable to create new method. Plz fix the error shown in the message window." -msgstr "No es pot crear nou mtode. Si us plau, corregeix l'error de la finestra de missatges." +msgstr "No es pot crear el nou mtode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." @@ -6748,23 +6764,23 @@ msgstr "No es pot crear el directori sortida font %s%s%s%s pel paquet %s." #: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." -msgstr "No es pot crear directori destinaci lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els teus paquets personalitzats." +msgstr "No es pot crear el directori destinaci del Lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els vostres paquets personalitzats." #: lazarusidestrconsts:lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" -msgstr "No es pot esborrar fitxer ambigu %s%s%s" +msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeletefilename msgid "Unable to delete file" -msgstr "No es pot esborrar el fitxer" +msgstr "No es pot eliminar el fitxer" #: lazarusidestrconsts:lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." -msgstr "No es pot esborrar el fitxer %s%s%s." +msgstr "No es pot eliminar el fitxer %s%s%s." #: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." -msgstr "No pus esborrar fitxer vell %s%s%s%spel paquet %s." +msgstr "No es pot eliminar el fitxer antic %s%s%s%spel paquet %s." #: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." @@ -6780,11 +6796,11 @@ msgstr "No es pot trobar el fitxer %s%s%s." #: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" -msgstr "No es pot trobar el fitxer %s%s%s.%sComprova trajectria a%sProjecte->Opcions del Compilador...->Trajectries de Recerca->Altres Fitxers d'unitats" +msgstr "No es pot trobar el fitxer %s%s%s.%sComproveu la trajectria a%sProjecte->Opcions del Compilador...->Trajectries de Recerca->Altres Fitxers d'unitats" #: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage msgid "Unable to find method. Plz fix the error shown in the message window." -msgstr "No es pot trobar mtode. Si us plau, comprova l'error mostrat a la finestra de missatges." +msgstr "No es pot trobar el mtode. Si us plau, comproveu l'error mostrat a la finestra de missatges." #: lazarusidestrconsts:lisdebugunabletoloadfile msgid "Unable to load file" @@ -6796,7 +6812,7 @@ msgstr "No es pot carregar el fitxer %s%s%s." #: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "No es pot carregar fitxer del recurs vell.%sEl fitxer del recurs s el primer fitxer incls en la%ssecci d'inicialitzaci.%sPer exemple {$I %s.lrs}.%sProblable error de sintaxi. " +msgstr "No es pot carregar fitxer del recurs antic.%sEl fitxer del recurs s el primer fitxer incls en la%ssecci d'inicialitzaci.%sPer exemple {$I %s.lrs}.%sProblable error de sintaxi. " #: lazarusidestrconsts:lispkgmangunabletoloadpackage msgid "Unable to load package" @@ -6804,7 +6820,7 @@ msgstr "No es pot carregar el paquet" #: lazarusidestrconsts:lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for for installation." -msgstr "No es pot carregar el paquet %s%s%s.%sAquest paquet est marcat per installar." +msgstr "No es pot carregar el paquet %s%s%s.%sAquest paquet est marcat per a ser installat." #: lazarusidestrconsts:lisunabletoreadfile msgid "Unable to read file" @@ -6832,11 +6848,11 @@ msgstr "No es pot llegir fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts:lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" -msgstr "No es pot esborrar el fitxer de resguard vell %s%s%s!" +msgstr "No es pot eliminar el fitxer de resguard antic %s%s%s!" #: lazarusidestrconsts:lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" -msgstr "No es pot canviar el nom del fitxer ambigu %s%s%s%sa %s%s%s" +msgstr "" #: lazarusidestrconsts:lisunabletorenamefile msgid "Unable to rename file" @@ -6856,11 +6872,11 @@ msgstr "No es pot canviar el nom de la forma en el codi font" #: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag msgid "Unable to rename method. Plz fix the error shown in the message window." -msgstr "No es pot canviar el nom del mtode. Si us plau, corregeix l'error de la finestra de missatges." +msgstr "No es pot canviar el nom del mtode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts:lisunabletorenamevariableinsource msgid "Unable to rename variable in source." -msgstr "No es pot canviar el nom de variable en el codi font." +msgstr "No es pot canviar el nom de la variable en el codi font." #: lazarusidestrconsts:lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" @@ -6868,11 +6884,11 @@ msgstr "No es pot executar l'eina %s%s%s:%s%s" #: lazarusidestrconsts:lisunabletosavefile msgid "Unable to save file %s%s%s" -msgstr "No es pot guardar el fitxer %s%s%s" +msgstr "No es pot desar el fitxer %s%s%s" #: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage msgid "Unable to show method. Plz fix the error shown in the message window." -msgstr "No es pot mostrar mtode. Si us plau, corregeix l'error de la finestra de missatges." +msgstr "No es pot mostrar el mtode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts:lisunabletostreamt msgid "Unable to stream %s:T%s." @@ -6880,7 +6896,7 @@ msgstr "No es pot afluir %s:T%s." #: lazarusidestrconsts:lisunabletostreamselectedcomponents msgid "Unable to stream selected components" -msgstr "No es pot afluir els components seleccionats" +msgstr "No es poden afluir els components seleccionats" #: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." @@ -6888,7 +6904,7 @@ msgstr "No es pot transformar afluent de component binari de %s:T%s a text." #: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" -msgstr "No es pot actualitzar declaraci CreateForm en el codi font del projecte" +msgstr "No es pot actualitzar la declaraci CreateForm en el codi font del projecte" #: lazarusidestrconsts:lisunabletowrite msgid "Unable to write %s%s%s%s%s." @@ -6920,11 +6936,11 @@ msgstr "No es pot escriure el fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts:lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" -msgstr "No es pot escriure al fitxer %s%s%s" +msgstr "No es pot escriure en el fitxer %s%s%s" #: lazarusidestrconsts:lisunabletowritetofile msgid "Unable to write to file %s%s%s!" -msgstr "No es pot escriure al fitxer %s%s%s!" +msgstr "No es pot escriure en el fitxer %s%s%s!" #: lazarusidestrconsts:dlguncertopt msgid "Uncertain Optimizations" @@ -6932,19 +6948,19 @@ msgstr "Optimitzacions incertes" #: lazarusidestrconsts:lismenuuncommentselection msgid "Uncomment selection" -msgstr "Treure comentari de la selecci" +msgstr "Treu comentari de la selecci" #: lazarusidestrconsts:liscodetoolsdefsundefine msgid "Undefine" -msgstr "Indefinir" +msgstr "Indefineix" #: lazarusidestrconsts:liscodetoolsdefsundefineall msgid "Undefine All" -msgstr "Indefinir-ho tot" +msgstr "Indefineix-ho tot" #: lazarusidestrconsts:liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" -msgstr "Indefinir el recurs" +msgstr "Indefineix el recurs" #: lazarusidestrconsts:dlgedunder msgid "Underline" @@ -6952,43 +6968,43 @@ msgstr "Subratllat" #: lazarusidestrconsts:lismenuundo msgid "Undo" -msgstr "Desfer" +msgstr "Desfs" #: lazarusidestrconsts:dlgundoaftersave msgid "Undo after save" -msgstr "Desfer desprs de guardar" +msgstr "Desfs desprs de desar" #: lazarusidestrconsts:dlgundolimit msgid "Undo limit:" -msgstr "Desfer:" +msgstr "Max.desfer:" #: lazarusidestrconsts:srkmecblockunindent msgid "Unindent block" -msgstr "Dessagnar bloc" +msgstr "Dessagna el bloc" #: lazarusidestrconsts:lismenuunindentselection msgid "Unindent selection" -msgstr "Dessagnar selecci" +msgstr "Dessagna la selecci" #: lazarusidestrconsts:lispckedituninstall msgid "Uninstall" -msgstr "Desinstallar" +msgstr "Desinstalla" #: lazarusidestrconsts:lispckexpluninstallonnextstart msgid "Uninstall on next start" -msgstr "Desinstallar en el proper inici" +msgstr "Desinstalla en el proper inici" #: lazarusidestrconsts:lispkgmanguninstallpackage2 msgid "Uninstall package %s?" -msgstr "Desinstallar el paquet %s?" +msgstr "Voleu desinstallar el paquet %s?" #: lazarusidestrconsts:lispkgmanguninstallpackage msgid "Uninstall package?" -msgstr "Desinstallar el paquet?" +msgstr "Voleu desinstallar el paquet?" #: lazarusidestrconsts:lisuninstallselection msgid "Uninstall selection" -msgstr "desinstallar la selecci" +msgstr "Desinstalla la selecci" #: lazarusidestrconsts:lispkgfiletypeunit msgid "Unit" @@ -6996,43 +7012,43 @@ msgstr "Unitat" #: lazarusidestrconsts:lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" -msgstr "La unitat %s%s%s ha canviat. Guardar-la?" +msgstr "La unitat %s%s%s ha canviat. Voleu desar-la?" #: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" -msgstr "La unitat %s%s%s ha estat esborrada del paquet" +msgstr "S'ha eliminat la unitat %s%s%s del paquet" #: lazarusidestrconsts:lisa2punitfilename2 msgid "Unit File Name:" -msgstr "Nom de fitxer d'unitat:" +msgstr "Nom de fitxer de la unitat:" #: lazarusidestrconsts:uemunitinfo msgid "Unit Info" -msgstr "Informaci d'unitat" +msgstr "Informaci de la unitat" #: lazarusidestrconsts:lisa2punitnameinvalid msgid "Unit Name Invalid" -msgstr "Nom d'unitat no vlid" +msgstr "El nom de la unitat no s vlid" #: lazarusidestrconsts:lisa2punitname msgid "Unit Name:" -msgstr "Nom d'unitat:" +msgstr "Nom de la unitat:" #: lazarusidestrconsts:lisaf2punitname msgid "Unit Name: " -msgstr "Nom d'unitat: " +msgstr "Nom de la unitat: " #: lazarusidestrconsts:lisunitoutputdirectory msgid "Unit Output directory" -msgstr "Directori sortida d'unitat" +msgstr "Directori sortida de la unitat" #: lazarusidestrconsts:lispkgdefsunitpath msgid "Unit Path" -msgstr "Trajectria d'unitat" +msgstr "Trajectria de la unitat" #: lazarusidestrconsts:dlgcounitstyle msgid "Unit Style:" -msgstr "Estil d'unitat:" +msgstr "Estil de la unitat:" #: lazarusidestrconsts:dlgunitdepcaption msgid "Unit dependencies" @@ -7040,27 +7056,27 @@ msgstr "Depend #: lazarusidestrconsts:lisa2punitfilename msgid "Unit file name:" -msgstr "Nom de fitxer d'unitat:" +msgstr "Nom de fitxer de la unitat:" #: lazarusidestrconsts:lisunitidentifierexists msgid "Unit identifier exists" -msgstr "Ja existeix identificador d'unitat" +msgstr "Ja existeix l'identificador de la unitat" #: lazarusidestrconsts:lisprojaddunitnamealreadyexists msgid "Unit name already exists" -msgstr "Ja existeix el nom d'unitat" +msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts:lispkgsysunitnotfound msgid "Unit not found: %s%s%s" -msgstr "Unitat no trobada: %s%s%s" +msgstr "No s'ha trobat la unitat: %s%s%s" #: lazarusidestrconsts:dlgunitoutp msgid "Unit output directory (-FE):" -msgstr "Directori sortida d'unitat (-FE):" +msgstr "Directori sortida de la unitat (-FE):" #: lazarusidestrconsts:lisunitsnotfound msgid "Unit(s) not found" -msgstr "Unitat(s) no trobada(es)" +msgstr "No s'ha(n) trobat la(es) unitat(s)" #: lazarusidestrconsts:lisunitlfmfile msgid "Unit: %s%sLFM file: %s" @@ -7068,11 +7084,11 @@ msgstr "Unitat: %s%sfitxer LFM: %s" #: lazarusidestrconsts:lisa2punitnamealreadyexists msgid "Unitname already exists" -msgstr "Ja existeix el nom d'unitat" +msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts:lisunitnamealreadyexistscap msgid "Unitname already in project" -msgstr "El nom d'unitat ja s al projecte" +msgstr "El nom de la unitat ja s al projecte" #: lazarusidestrconsts:lismenuviewunits msgid "Units..." @@ -7084,11 +7100,11 @@ msgstr "Desconegut" #: lazarusidestrconsts:lisunknownerrorpleasereportthisbug msgid "Unknown Error, please report this bug" -msgstr "Error desconegut, si us plau comunica'l" +msgstr "S'ha produt un error desconegut, si us plau informeu-nos" #: lazarusidestrconsts:lispkgmangunsavedpackage msgid "Unsaved package" -msgstr "Paquet no guardat" +msgstr "No s'ha desat el paquet" #: lazarusidestrconsts:dlgupword msgid "Up" @@ -7096,11 +7112,11 @@ msgstr "Amunt" #: lazarusidestrconsts:lispckoptsupdaterebuild msgid "Update/Rebuild" -msgstr "Actualitzar/Muntar de nou" +msgstr "Actualitza/Munta de nou" #: lazarusidestrconsts:lismenuuppercaseselection msgid "Uppercase selection" -msgstr "Ficar a majscules la selecci" +msgstr "Fica a majscules la selecci" #: lazarusidestrconsts:lispckoptsusage msgid "Usage" @@ -7108,39 +7124,39 @@ msgstr "Utilitzaci #: lazarusidestrconsts:dlgcoansistr msgid "Use Ansi Strings" -msgstr "Utilitzar Ansi Strings" +msgstr "Utilitza Ansi Strings" #: lazarusidestrconsts:dlgcoheaptrc msgid "Use Heaptrc Unit" -msgstr "Utilitzar unitat Heaptrc" +msgstr "Utilitza unitat Heaptrc" #: lazarusidestrconsts:dlgusecustomconfig msgid "Use addional Compiler Config File" -msgstr "Utilitzar fitxer de configuraci addicional del compilador" +msgstr "Utilitza el fitxer de configuraci addicional del compilador" #: lazarusidestrconsts:dlgedusedefcolor msgid "Use default color" -msgstr "Utilitzar color per omissi" +msgstr "Utilitza el color per omissi" #: lazarusidestrconsts:dlgrunousedisplay msgid "Use display" -msgstr "Utilitzar pantalla" +msgstr "Utilitza la pantalla" #: lazarusidestrconsts:dlguselaunchingapp msgid "Use launching application" -msgstr "Utilitzar aplicaci llanadora" +msgstr "Utilitza l'aplicaci llanadora" #: lazarusidestrconsts:dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" -msgstr "Utilitzar fitxer de configuraci normalitzat (fpc.cfg)" +msgstr "Utilitza el fitxer de configuraci normalitzat (fpc.cfg)" #: lazarusidestrconsts:dlgusesyntaxhighlight msgid "Use syntax highlight" -msgstr "Utilitzar ressaltat de sintaxi" +msgstr "Utilitza el ressaltat de sintaxi" #: lazarusidestrconsts:rsiwpusewindowmanagersetting msgid "Use windowmanager setting" -msgstr "Utilitzar parmetres del gestor de finestres" +msgstr "Utilitza els parmetres del gestor de finestres" #: lazarusidestrconsts:srkmecuserfirst msgid "User First" @@ -7158,13 +7174,13 @@ msgstr "Extensions definides per l'usuari (.pp.xxx)" msgid "User overrides" msgstr "L'usuari substitueix" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valor" #: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" -msgstr "Valor com a trajectria de fitxers" +msgstr "Valor com a trajectria dels fitxers" #: lazarusidestrconsts:liscodetoolsdefsvalueastext msgid "Value as Text" @@ -7176,11 +7192,11 @@ msgstr "Variable" #: lazarusidestrconsts:lisctdefvariablename msgid "Variable Name" -msgstr "Nom de variable" +msgstr "Nom de la variable" #: lazarusidestrconsts:dlgcdtvariableprefix msgid "Variable prefix" -msgstr "Prefix variable" +msgstr "Prefix de la variable" #: lazarusidestrconsts:liscodetoolsdefsvariable msgid "Variable:" @@ -7192,7 +7208,7 @@ msgstr "Variable: %s" #: lazarusidestrconsts:dlgverbosity msgid "Verbosity during compilation:" -msgstr "Verbositat durant la compilaci:" +msgstr "Detall durant la compilaci:" #: lazarusidestrconsts:lisversion msgid "Version" @@ -7204,123 +7220,123 @@ msgstr "Vertical" #: lazarusidestrconsts:dlggridyhint msgid "Vertical grid step size" -msgstr "Tamany vertical de pas de graella" +msgstr "Tamany vertical del pas de la graella" #: lazarusidestrconsts:lismenuviewanchoreditor msgid "View Anchor Editor" -msgstr "Mostrar editor d'ncores" +msgstr "Mostra l'editor de les ncores" #: lazarusidestrconsts:uemviewcallstackcursor msgid "View Call Stack" -msgstr "Mostrar la pila de les crides" +msgstr "Mostra la pila de les crides" #: lazarusidestrconsts:srkmectogglecodeexpl msgid "View Code Explorer" -msgstr "Mostrar explorador de codi" +msgstr "Mostra l'explorador del codi" #: lazarusidestrconsts:lishintviewforms msgid "View Forms" -msgstr "Mostrar formes" +msgstr "Mostra les formes" #: lazarusidestrconsts:lismenuviewjumphistory msgid "View Jump-History" -msgstr "Mostrar histria de salts" +msgstr "Mostra la histria dels salts" #: lazarusidestrconsts:srkmectoggleobjectinsp msgid "View Object Inspector" -msgstr "Mostrar l'inspector d'objectes" +msgstr "Mostra l'inspector dels objectes" #: lazarusidestrconsts:lispckeditviewpackgesource msgid "View Package Source" -msgstr "Mostrar fonts dels paquets" +msgstr "Mostra les fonts dels paquets" #: lazarusidestrconsts:lisviewprojectunits msgid "View Project Units" -msgstr "Mostrar unitats del projecte" +msgstr "Mostra les unitats del projecte" #: lazarusidestrconsts:srkmectogglesearchresults msgid "View Search Results" -msgstr "Mostrar resultats de recerca" +msgstr "Mostra els resultats de recerca" #: lazarusidestrconsts:lismenuviewsource msgid "View Source" -msgstr "Mostrar font" +msgstr "Mostra les font" #: lazarusidestrconsts:srkmectogglesourceeditor msgid "View Source Editor" -msgstr "Mostrar editor del codi font" +msgstr "Mostra l'editor del codi font" #: lazarusidestrconsts:lismenuviewprojecttodos msgid "View ToDo List" -msgstr "Mostrar llista ToDo" +msgstr "Mostra la llista ToDo" #: lazarusidestrconsts:lismenuviewunitdependencies msgid "View Unit Dependencies" -msgstr "Mostrar dependncies de les unitats" +msgstr "Mostra les dependncies de les unitats" #: lazarusidestrconsts:lismenuviewunitinfo msgid "View Unit Information" -msgstr "Mostrar informaci d'unitats" +msgstr "Mostra la informaci de les unitats" #: lazarusidestrconsts:lishintviewunits msgid "View Units" -msgstr "Mostrar unitats" +msgstr "Mostra les unitats" #: lazarusidestrconsts:srkmecviewanchoreditor msgid "View anchor editor" -msgstr "Mostrar editor d'ncores" +msgstr "Mostra l'editor de les ncores" #: lazarusidestrconsts:srkmectogglebreakpoints msgid "View breakpoints" -msgstr "Mostrar punts de control" +msgstr "Mostra els punts de ruptura" #: lazarusidestrconsts:srkmectogglecallstack msgid "View call stack" -msgstr "Mostrar la pila de les crides" +msgstr "Mostra la pila de les crides" #: lazarusidestrconsts:srkmectoggledebuggerout msgid "View debugger output" -msgstr "Mostrar la sortida del depurador" +msgstr "Mostra la sortida del depurador" #: lazarusidestrconsts:srkmecviewforms msgid "View forms" -msgstr "Mostrar formes" +msgstr "Mostra les formes" #: lazarusidestrconsts:srkmectogglelocals msgid "View local variables" -msgstr "Mostrar les variables locals" +msgstr "Mostra les variables locals" #: lazarusidestrconsts:srkmcatviewmenu msgid "View menu commands" -msgstr "Mostrar ordres de men" +msgstr "Mostra les ordres del men" #: lazarusidestrconsts:srkmectogglemessages msgid "View messages" -msgstr "Mostrar missatges" +msgstr "Mostra els missatges" #: lazarusidestrconsts:dlgmainviewforms msgid "View project forms" -msgstr "Mostrar les formes del projecte" +msgstr "Mostra les formes del projecte" #: lazarusidestrconsts:dlgmainviewunits msgid "View project units" -msgstr "Mostrar les unitats del projecte" +msgstr "Mostra les unitats del projecte" #: lazarusidestrconsts:srkmecviewunitdependencies msgid "View unit dependencies" -msgstr "Mostrar dependncies de les unitats" +msgstr "Mostra les dependncies de les unitats" #: lazarusidestrconsts:srkmecviewunitinfo msgid "View unit information" -msgstr "Mostrar informaci d'unitat" +msgstr "Mostra l'informaci de la unitat" #: lazarusidestrconsts:srkmecviewunits msgid "View units" -msgstr "Mostrar unitats" +msgstr "Mostra les unitats" #: lazarusidestrconsts:srkmectogglewatches msgid "View watches" -msgstr "Mostrar vigilants" +msgstr "Mostra els controls" #: lazarusidestrconsts:lishlpoptsviewers msgid "Viewers" @@ -7344,7 +7360,7 @@ msgstr "Marge dret visible" #: lazarusidestrconsts:dlgambigwarn msgid "Warn on compile" -msgstr "Avisar al compilar" +msgstr "Avisa al compilar" #: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." @@ -7356,15 +7372,15 @@ msgstr "Av #: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" -msgstr "Avs: s'ha trobat el fitxer ambigu: %s%s%s. El fitxer font s: %s%s%s" +msgstr "" #: lazarusidestrconsts:lismenuviewwatches msgid "Watches" -msgstr "Vigilants" +msgstr "Controls" #: lazarusidestrconsts:dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" -msgstr "En crear noves formes, afegir-les a les formes creades automticament" +msgstr "Quan es creen noves formes, afegeix-les a les formes creades automticament" #: lazarusidestrconsts:lisfindfilewhere msgid "Where" @@ -7400,7 +7416,7 @@ msgstr "Paraula del cursor en l'editor actual" #: lazarusidestrconsts:srkmecwordcompletion msgid "Word completion" -msgstr "Completar la paraula" +msgstr "Completa la paraula" #: lazarusidestrconsts:dlgwordspolicies msgid "Words" @@ -7416,15 +7432,15 @@ msgstr "Directori de treball" #: lazarusidestrconsts:liswriteerror msgid "Write Error" -msgstr "Error d'escriptura" +msgstr "S'ha produt un error d'escriptura" #: lazarusidestrconsts:dlgwritefpclogo msgid "Write an FPC logo" -msgstr "Escriure un logotipus FPC" +msgstr "Escriu un logotipus FPC" #: lazarusidestrconsts:liscodetoolsdefswriteerror msgid "Write error" -msgstr "Error d'escriptura" +msgstr "S'ha produt un error d'escriptura" #: lazarusidestrconsts:dlgcdtwriteprefix msgid "Write prefix" @@ -7432,7 +7448,7 @@ msgstr "Prefix d'escriure" #: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." -msgstr "No pots muntar el lazarus mentre s'est depurant o compilant." +msgstr "No podeu muntar el lazarus mentre s'est depurant o compilant." #: lazarusidestrconsts:dlgdoesnotexist msgid "\" does not exist." @@ -7444,15 +7460,15 @@ msgstr "\" no es pot escriure" #: lazarusidestrconsts:srkmecabortbuild msgid "abort build" -msgstr "avortar el muntatje" +msgstr "avorta el muntatje" #: lazarusidestrconsts:srkmecaddbreakpoint msgid "add break point" -msgstr "afegir punt de ruptura" +msgstr "afegeix un punt de ruptura" #: lazarusidestrconsts:srkmecaddwatch msgid "add watch" -msgstr "afegir vigilant" +msgstr "afegeix un control" #: lazarusidestrconsts:srvk_apps msgid "application key" @@ -7460,23 +7476,23 @@ msgstr "tecla d'aplicaci #: lazarusidestrconsts:lisoipautoinstalldynamic msgid "auto install dynamic" -msgstr "auto intallar dinmicament" +msgstr "auto intalla dinmicament" #: lazarusidestrconsts:lisoipautoinstallstatic msgid "auto install static" -msgstr "auto intallar estticament" +msgstr "auto intalla estticament" #: lazarusidestrconsts:srkmecbuildall msgid "build all files of program/project" -msgstr "muntar tot els fitxers del programa/projecte" +msgstr "munta tots els fitxers del programa/projecte" #: lazarusidestrconsts:srkmecbuildfile msgid "build file" -msgstr "muntar fitxer" +msgstr "munta el fitxer" #: lazarusidestrconsts:srkmecbuild msgid "build program/project" -msgstr "muntar el programa/projecte" +msgstr "munta el programa/projecte" #: lazarusidestrconsts:dlglefttopclr msgid "color for left, top" @@ -7496,7 +7512,7 @@ msgstr "traject #: lazarusidestrconsts:srkmecconfigbuildfile msgid "config build file" -msgstr "fitxer de configuraci de muntatje" +msgstr "fitxer de configuraci del muntatje" #: lazarusidestrconsts:liscustomoptions msgid "custom options" @@ -7508,11 +7524,11 @@ msgstr "pred. (%s)" #: lazarusidestrconsts:srkmecevaluate msgid "evaluate/modify" -msgstr "avaluar/modificar" +msgstr "avalua/modifica" #: lazarusidestrconsts:lisuidinproject msgid "in Project:" -msgstr "en projecte:" +msgstr "en el projecte:" #: lazarusidestrconsts:lisfriinallopenpackagesandprojects msgid "in all open packages and projects" @@ -7532,7 +7548,7 @@ msgstr "en el projecte/paquet que es propietari de la unitat actual" #: lazarusidestrconsts:lisincludepath msgid "include path" -msgstr "trajectria d'inclosos" +msgstr "trajectria dels fitxers inclosos" #: lazarusidestrconsts:srkmecinspect msgid "inspect" @@ -7540,15 +7556,15 @@ msgstr "inspeccionar" #: lazarusidestrconsts:lisoipinstalleddynamic msgid "installed dynamic" -msgstr "dinmicament installat" +msgstr "installat dinmicament" #: lazarusidestrconsts:lisoipinstalledstatic msgid "installed static" -msgstr "estticament installat" +msgstr "installat estticament" #: lazarusidestrconsts:lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" -msgstr "nom de fitxer de compilador no vlid" +msgstr "el nom del fitxer del compilador no s vlid" #: lazarusidestrconsts:lislazarusoptionsprojectfilename msgid "lazarus [options] " @@ -7560,7 +7576,7 @@ msgstr "tecla de finestres esquerres" #: lazarusidestrconsts:lislibrarypath msgid "library path" -msgstr "trajectria de biblioteques" +msgstr "trajectria de les biblioteques" #: lazarusidestrconsts:lislinkeroptions msgid "linker options" @@ -7584,7 +7600,7 @@ msgstr "no" #: lazarusidestrconsts:dlgnoautomaticrenaming msgid "no automatic renaming" -msgstr "" +msgstr "no canvis el nom automticament" #: lazarusidestrconsts:lisnoname msgid "noname" @@ -7596,19 +7612,19 @@ msgstr "cap de seleccionat" #: lazarusidestrconsts:lisobjectpath msgid "object path" -msgstr "trajectria d'objectes" +msgstr "trajectria dels objectes" #: lazarusidestrconsts:lispckeditpackagenotsaved msgid "package %s not saved" -msgstr "paquet %s no guardat" +msgstr "no s'ha desat el paquet %s" #: lazarusidestrconsts:lispkgmangpackagemainsourcefile msgid "package main source file" -msgstr "fitxer de codi font principal del paquet" +msgstr "fitxer del codi font principal del paquet" #: lazarusidestrconsts:srkmecpause msgid "pause program" -msgstr "pausar el programa" +msgstr "pausa el programa" #: lazarusidestrconsts:lisoipreadonly msgid "readonly" @@ -7616,11 +7632,11 @@ msgstr "nom #: lazarusidestrconsts:srkmecremovebreakpoint msgid "remove break point" -msgstr "esborrar punt de ruptura" +msgstr "elimina el punt de ruptura" #: lazarusidestrconsts:srkmecresetdebugger msgid "reset debugger" -msgstr "reiniciar depurador" +msgstr "reinicia el depurador" #: lazarusidestrconsts:srvk_rwin msgid "right windows key" @@ -7628,35 +7644,35 @@ msgstr "tecla de finestres dretes" #: lazarusidestrconsts:srkmecrunfile msgid "run file" -msgstr "executar fitxer" +msgstr "executa el fitxer" #: lazarusidestrconsts:srkmecrunparameters msgid "run parameters" -msgstr "executar parmetres" +msgstr "executa els parmetres" #: lazarusidestrconsts:srkmecrun msgid "run program" -msgstr "executar el programa" +msgstr "executa el programa" #: lazarusidestrconsts:lissaveallmodified msgid "save all modified files" -msgstr "guardar tots els fitxers modificats" +msgstr "desa tots els fitxers modificats" #: lazarusidestrconsts:lissavecurrenteditorfile msgid "save current editor file" -msgstr "guardar fitxer editor actual" +msgstr "desa el fitxer editor actual" #: lazarusidestrconsts:lisfindfilesearchallfilesinproject msgid "search all files in project" -msgstr "buscar tots els fitxers en el projecte" +msgstr "cerca en tots els fitxers del projecte" #: lazarusidestrconsts:lisfindfilesearchallopenfiles msgid "search all open files" -msgstr "buscar tots els fitxers oberts" +msgstr "cerca en tots els fitxers oberts" #: lazarusidestrconsts:lisfindfilesearchindirectories msgid "search in directories" -msgstr "buscar en directoris" +msgstr "cerca en els directoris" #: lazarusidestrconsts:dlgtimesecondunit msgid "sec" @@ -7664,27 +7680,27 @@ msgstr "segons" #: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" -msgstr "ficar mode FPC a DELPHI" +msgstr "fica mode FPC a DELPHI" #: lazarusidestrconsts:lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" -msgstr "ficar mode FPC a GPC" +msgstr "fica mode FPC a GPC" #: lazarusidestrconsts:lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" -msgstr "ficar mode FPC aTP" +msgstr "fica mode FPC aTP" #: lazarusidestrconsts:lisedtdefsetiocheckson msgid "set IOCHECKS on" -msgstr "activar IOCHECKS" +msgstr "activa IOCHECKS" #: lazarusidestrconsts:lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" -msgstr "activar OVERFLOWCHECKS" +msgstr "activa OVERFLOWCHECKS" #: lazarusidestrconsts:lisedtdefsetrangecheckson msgid "set RANGECHECKS on" -msgstr "activar RANGECHECKS" +msgstr "activa RANGECHECKS" #: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile msgid "static packages config file" @@ -7692,7 +7708,7 @@ msgstr "fitxer de configuraci #: lazarusidestrconsts:srkmecstopprogram msgid "stop program" -msgstr "aturar el programa" +msgstr "atura el programa" #: lazarusidestrconsts:listhishelpmessage msgid "this help message" @@ -7700,7 +7716,7 @@ msgstr "aquest missatge d'ajuda" #: lazarusidestrconsts:lisunitpath msgid "unit path" -msgstr "trajectria d'unitats" +msgstr "trajectria de les unitats" #: lazarusidestrconsts:srkmecunknown msgid "unknown editor command" @@ -7708,11 +7724,11 @@ msgstr "ordre de l'editor desconeguda" #: lazarusidestrconsts:lisedtdefuseheaptrcunit msgid "use HeapTrc unit" -msgstr "utilitzar unitat HeapTrc" +msgstr "utilitza la unitat HeapTrc" #: lazarusidestrconsts:lisedtdefuselineinfounit msgid "use LineInfo unit" -msgstr "utilitzar unitat LineInfo" +msgstr "utilitza la unitat LineInfo" #: lazarusidestrconsts:lisuidyes msgid "yes" diff --git a/languages/lazaruside.de.po b/languages/lazaruside.de.po index a2b8c98848..efc3431448 100644 --- a/languages/lazaruside.de.po +++ b/languages/lazaruside.de.po @@ -621,8 +621,8 @@ msgid "Back" msgstr "Zurck" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Hintergrundfarbe" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1628,6 +1628,10 @@ msgstr "Voreingestellte Editorschrift" msgid "Default pascal extension" msgstr "Voreingestellte Pascal-Dateiendung" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Definition" @@ -4732,6 +4736,10 @@ msgstr "Eigenschaften" msgid "Property completion" msgstr "Eigenschaftenvervollstndigung" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Protected-Methode" @@ -4828,6 +4836,10 @@ msgstr "Aktualisieren des Designer verringern" msgid "Refactoring" msgstr "Refactoring" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Erneuern" @@ -5880,6 +5892,10 @@ msgstr "Unterprozedur derselben Stufe" msgid "Sub directory" msgstr "Unterverzeichnis" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Pfade vertauschen" @@ -7172,7 +7188,7 @@ msgstr "Benutzerdefinierte Erweiterung (.pp.xxx)" msgid "User overrides" msgstr "Benutzervorgaben" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Wert" diff --git a/languages/lazaruside.es.po b/languages/lazaruside.es.po index b14efb026d..29e58d5aa0 100644 --- a/languages/lazaruside.es.po +++ b/languages/lazaruside.es.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "Atrs" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Color de fondo" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "Fuente por defecto del editor" msgid "Default pascal extension" msgstr "Extensin Pascal por defecto" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Definir" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "Completado de Propiedad" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Refrescar" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "Subdirectorio" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Escoger Rutas" @@ -7169,7 +7185,7 @@ msgstr "Extensi msgid "User overrides" msgstr "Usar reemplazos" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valor" diff --git a/languages/lazaruside.esutf.po b/languages/lazaruside.esutf.po index 1e6a2aa1e2..deae05999c 100644 --- a/languages/lazaruside.esutf.po +++ b/languages/lazaruside.esutf.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "Atrás" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Color de fondo" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "Fuente por defecto del editor" msgid "Default pascal extension" msgstr "Extensión Pascal por defecto" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Definir" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "Completado de Propiedad" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Refrescar" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "Subdirectorio" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Escoger Rutas" @@ -7169,7 +7185,7 @@ msgstr "Extensión definida por usuario (.pp.xxx)" msgid "User overrides" msgstr "Usar reemplazos" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valor" diff --git a/languages/lazaruside.fi.po b/languages/lazaruside.fi.po index cb18156261..ce6820b016 100644 --- a/languages/lazaruside.fi.po +++ b/languages/lazaruside.fi.po @@ -607,8 +607,8 @@ msgid "Back" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Taustaväri" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1614,6 +1614,10 @@ msgstr "" msgid "Default pascal extension" msgstr "Oletuksena käytettävä Pascal-kielen tiedostopääte" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4718,6 +4722,10 @@ msgstr "" msgid "Property completion" msgstr "" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Protected - metodi" @@ -4814,6 +4822,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5866,6 +5878,10 @@ msgstr "" msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" @@ -7158,7 +7174,7 @@ msgstr "" msgid "User overrides" msgstr "" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/lazaruside.fiwin.po b/languages/lazaruside.fiwin.po index 9ca6811685..a1982f1806 100644 --- a/languages/lazaruside.fiwin.po +++ b/languages/lazaruside.fiwin.po @@ -607,8 +607,8 @@ msgid "Back" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Taustavri" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1614,6 +1614,10 @@ msgstr "" msgid "Default pascal extension" msgstr "" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4718,6 +4722,10 @@ msgstr "" msgid "Property completion" msgstr "" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Protected - metodi" @@ -4814,6 +4822,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5866,6 +5878,10 @@ msgstr "" msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" @@ -7158,7 +7174,7 @@ msgstr "" msgid "User overrides" msgstr "" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/lazaruside.fr.po b/languages/lazaruside.fr.po index ae0302e538..e86e543a10 100644 --- a/languages/lazaruside.fr.po +++ b/languages/lazaruside.fr.po @@ -617,8 +617,8 @@ msgid "Back" msgstr "Retour" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Couleur de fond" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1624,6 +1624,10 @@ msgstr "Fonte par d msgid "Default pascal extension" msgstr "Extension Pascal par dfaut" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Dfinir" @@ -4728,6 +4732,10 @@ msgstr "Propri msgid "Property completion" msgstr "Achvement de proprit" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Mthode protge" @@ -4824,6 +4832,10 @@ msgstr "R msgid "Refactoring" msgstr "Retravailler" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Rafrachir" @@ -5876,6 +5888,10 @@ msgstr "Sous-proc msgid "Sub directory" msgstr "Sous-rpertoire" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "changer les chemins" @@ -7168,7 +7184,7 @@ msgstr "Extension utilisateur (.pp.xxx)" msgid "User overrides" msgstr "Surcharge utilisateur" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valeur" diff --git a/languages/lazaruside.he.po b/languages/lazaruside.he.po index 85268c8af6..9eea0224d8 100644 --- a/languages/lazaruside.he.po +++ b/languages/lazaruside.he.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "חזור" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "צבע רקע" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "" msgid "Default pascal extension" msgstr "" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" @@ -7169,7 +7185,7 @@ msgstr "" msgid "User overrides" msgstr "" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/lazaruside.it.po b/languages/lazaruside.it.po index 9ae8518e7b..3f31e45783 100644 --- a/languages/lazaruside.it.po +++ b/languages/lazaruside.it.po @@ -617,8 +617,8 @@ msgid "Back" msgstr "Indietro" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Colore sfondo" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1624,6 +1624,10 @@ msgstr "Carattere dell'editor predefinito" msgid "Default pascal extension" msgstr "Estensione Pascal predefinita" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Define" @@ -4728,6 +4732,10 @@ msgstr "" msgid "Property completion" msgstr "Completamento della proprietà" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4824,6 +4832,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Aggiorna" @@ -5876,6 +5888,10 @@ msgstr "" msgid "Sub directory" msgstr "Sotto directory" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Scambia percorsi" @@ -7168,7 +7184,7 @@ msgstr "Estensione definita dall'utente (.pp.xxx)" msgid "User overrides" msgstr "Le impostazioni utente vincono" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valore" diff --git a/languages/lazaruside.itiso.po b/languages/lazaruside.itiso.po index 09546abcac..8bd1ddd49c 100644 --- a/languages/lazaruside.itiso.po +++ b/languages/lazaruside.itiso.po @@ -617,8 +617,8 @@ msgid "Back" msgstr "Indietro" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Colore sfondo" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1624,6 +1624,10 @@ msgstr "Carattere dell'editor predefinito" msgid "Default pascal extension" msgstr "Estensione Pascal predefinita" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Define" @@ -4728,6 +4732,10 @@ msgstr "" msgid "Property completion" msgstr "Completamento della propriet" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4824,6 +4832,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Aggiorna" @@ -5876,6 +5888,10 @@ msgstr "" msgid "Sub directory" msgstr "Sotto directory" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Scambia percorsi" @@ -7168,7 +7184,7 @@ msgstr "Estensione definita dall'utente (.pp.xxx)" msgid "User overrides" msgstr "Le impostazioni utente vincono" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Valore" diff --git a/languages/lazaruside.nl.po b/languages/lazaruside.nl.po new file mode 100644 index 0000000000..28749f926e --- /dev/null +++ b/languages/lazaruside.nl.po @@ -0,0 +1,7748 @@ +msgid "" +msgstr "" +"" +"Last-Translator: Marmin \n" +"PO-Revision-Date: 2005-03-9 14:02+0200\n" +"Content-Type: text/plain; charset=iso-8859-1\n" +"Language-Team: Nederlands \n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 0.9.6\n" +"Project-Id-Version: lazaruside\n" +"MIME-Version: 1" + +#: lazarusidestrconsts:lisdonotshowsplashscreen +msgid " Do not show splash screen" +msgstr " Laat het Splash screen niet zien" + +#: lazarusidestrconsts:lisskiploadinglastproject +msgid " Skip loading last project" +msgstr " Sla het laden van het laatst geopende project over" + +#: lazarusidestrconsts:lisfilewheredebugoutputiswritten +msgid " file, where debug output is written to. If it is not specified, debug output is written to the console." +msgstr " Bestand, waar de debug output naar toe wordt geschreven. Als dit niet is gespecificeerd, wordt de data naar de console geschreven." + +#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig +msgid " primary config directory, where Lazarus stores its config files. Default is " +msgstr " Primaire config directory, waar Lazarus zijn configuratie bestanden opslaat. Standaard: " + +#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor +msgid " secondary config directory, where Lazarus searches for config template files. Default is " +msgstr " Secundaire config directory, waar Lazarus zoekt naar config 'template' bestanden. Standaard: " + +#: lazarusidestrconsts:srkmcommand1 +msgid " command1 \"" +msgstr "" + +#: lazarusidestrconsts:srkmcommand2 +msgid " command2 \"" +msgstr "" + +#: lazarusidestrconsts:liscodetemplatokenalreadyexists +msgid " A token %s%s%s already exists! " +msgstr " Het teken %s%s%s bestaat al !" + +#: lazarusidestrconsts:srkmalreadyconnected +msgid " The key \"%s\" is already connected to \"%s\"." +msgstr "Het teken \"%s\" is al gekoppeld aan \"%s\"." + +#: lazarusidestrconsts:srkmconflicw +msgid " conflicts with " +msgstr " is in conflict met " + +#: lazarusidestrconsts:liscompiling +msgid "%s (compiling ...)" +msgstr "" + +#: lazarusidestrconsts:lisdebugging +msgid "%s (debugging ...)" +msgstr "%s (aan het debuggen ...)" + +#: lazarusidestrconsts:lisnewproject +msgid "%s - (new project)" +msgstr "%s - (nieuw project)" + +#: lazarusidestrconsts:lisuidbytes +msgid "%s bytes" +msgstr "%s bytes" + +#: lazarusidestrconsts:liscodetoolsdefsdirectory +msgid "%s directory" +msgstr "%s directory" + +#: lazarusidestrconsts:lisisalreadypartoftheproject +msgid "%s is already part of the Project." +msgstr "%s is al deel van het project." + +#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 +msgid "%s project directory" +msgstr "%s project directory" + +#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject +msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" +msgstr "%s%s%s is geen geldige projectnaam.%s(Geldig is bijvoorbeeld: project1.lpi)" + +#: lazarusidestrconsts:lissvuoisnotavalididentifier +msgid "%s%s%s is not a valid identifier." +msgstr "%s%s%s is geen geldige identifier." + +#: lazarusidestrconsts:lisa2pisnotavalidunitname +msgid "%s%s%s is not a valid unit name." +msgstr "%s%s%s is geen geldige unit naam." + +#: lazarusidestrconsts:liscoclickokifaresuretodothat +msgid "%s%sClick OK if are sure to do that." +msgstr "%s%sKlik op OK als u zeker bent." + +#: lazarusidestrconsts:lispkgsysfilename +msgid "%s%sFile Name: %s%s%s" +msgstr "%s%sbestandsnaam: %s%s%s" + +#: lazarusidestrconsts:lispkgsysunitname +msgid "%s%sUnit Name: %s%s%s" +msgstr "%s%sUnit naam: %s%s%s" + +#: lazarusidestrconsts:lispckeditpage +msgid "%s, Page: %s" +msgstr "%s, Pagina: %s" + +#: lazarusidestrconsts:liscodetoolsdefsautogenerated +msgid "%s, auto generated" +msgstr "%s, automatisch gegenereerd" + +#: lazarusidestrconsts:liscodetoolsdefsprojectspecific +msgid "%s, project specific" +msgstr "%s, project specifiek" + +#: lazarusidestrconsts:lisuereadonly +msgid "%s/ReadOnly" +msgstr "%s/uitsluitend leesbaar" + +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage +msgid "%sAdding new Dependency for package %s: package %s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage +msgid "%sAdding new Dependency for project %s: package %s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu +msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." +msgstr "" + +#: lazarusidestrconsts:lisoipdescriptiondescription +msgid "%sDescription: %s" +msgstr "%sBeschrijving: %s" + +#: lazarusidestrconsts:lisa2pexistingfile +msgid "%sExisting file: %s%s%s" +msgstr "%sBestaand bestand: %s%s%s" + +#: lazarusidestrconsts:lisseeprojectprojectinspector +msgid "%sSee Project -> Project Inspector" +msgstr "%sZie project -> Project Inspector" + +#: lazarusidestrconsts:lispckexplstate +msgid "%sState: " +msgstr "%sStatus: " + +#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof +msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" +msgstr "%sDe volgende units zullen aan de uses sectie van %s%s:%s%s%s worden toegevoegd" + +#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound +msgid "%sThis package is installed, but the lpk file was not found" +msgstr "" + +#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated +msgid "%sThis package was automatically created" +msgstr "" + +#: lazarusidestrconsts:uemaddbreakpoint +msgid "&Add Breakpoint" +msgstr "&Voeg Breekpunt toe" + +#: lazarusidestrconsts:uemclosepage +msgid "&Close Page" +msgstr "&Sluit Pagina" + +#: lazarusidestrconsts:lismenucomponents +msgid "&Components" +msgstr "&Componenten" + +#: lazarusidestrconsts:lismenuedit +msgid "&Edit" +msgstr "&Bewerken" + +#: lazarusidestrconsts:lismenufile +msgid "&File" +msgstr "&Bestand" + +#: lazarusidestrconsts:uemfinddeclaration +msgid "&Find Declaration" +msgstr "&Zoek Declaratie" + +#: lazarusidestrconsts:uemgotobookmark +msgid "&Goto Bookmark" +msgstr "&Ga naar Bookmark" + +#: lazarusidestrconsts:lismenuhelp +msgid "&Help" +msgstr "&Help" + +#: lazarusidestrconsts:uemopenfileatcursor +msgid "&Open file at cursor" +msgstr "&Open bestand op positie van cursor" + +#: lazarusidestrconsts:lismenuproject +msgid "&Project" +msgstr "&Project" + +#: lazarusidestrconsts:dlgreplacewith +msgid "&Replace With" +msgstr "&Vervang Door" + +#: lazarusidestrconsts:lismenurun +msgid "&Run" +msgstr "&Starten" + +#: lazarusidestrconsts:uemruntocursor +msgid "&Run to Cursor" +msgstr "&Start tot Cursor" + +#: lazarusidestrconsts:lismenusearch +msgid "&Search" +msgstr "&Zoeken" + +#: lazarusidestrconsts:uemsetbookmark +msgid "&Set Bookmark" +msgstr "&Zet Bookmark" + +#: lazarusidestrconsts:dlgtexttofing +msgid "&Text to Find" +msgstr "&Zoek Tekst" + +#: lazarusidestrconsts:lismenutools +msgid "&Tools" +msgstr "&Hulpmiddelen" + +#: lazarusidestrconsts:lismenuview +msgid "&View" +msgstr "&Tonen" + +#: lazarusidestrconsts:lismenuwindows +msgid "&Windows" +msgstr "&Vensters" + +#: lazarusidestrconsts:dlgbakdirectory +msgid "(no subdirectoy)" +msgstr "(geen subdirectory)" + +#: lazarusidestrconsts:listmunknownmacro +msgid "(unknown macro: %s)" +msgstr "(onbekende macro: %s)" + +#: lazarusidestrconsts:lislazarusversionstring +msgid "0.9.7 beta" +msgstr "" + +#: lazarusidestrconsts:lisa2pchooseanexistingfile +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisctdefnovariableselected +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "" + +#: lazarusidestrconsts:lisafilealreadyexistsreplaceit +msgid "A file %s%s%s already exists.%sReplace it?" +msgstr "Een bestand %s%s%s bestaat al.%sOverschrijven?" + +#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas +msgid "A pascal unit must have the extension .pp or .pas" +msgstr "Een Pascal unit dient op .pp of .pas te eindigen." + +#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound +msgid "A required packages was not found. See package graph." +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename +msgid "A valid tool needs at least a title and a filename." +msgstr "Een geldige Tool heeft tenminste een titel en een bestandsnaam nodig." + +#: lazarusidestrconsts:lismenuabortbuild +msgid "Abort Build" +msgstr "Bouwen Afbreken" + +#: lazarusidestrconsts:lismenutemplateabout +msgid "About" +msgstr "Informatie" + +#: lazarusidestrconsts:lismenuaboutlazarus +msgid "About Lazarus" +msgstr "Informatie over Lazarus" + +#: lazarusidestrconsts:srvk_accept +msgid "Accept" +msgstr "Accepteer" + +#: lazarusidestrconsts:liscodetoolsdefsaction +msgid "Action: %s" +msgstr "Actie: %s" + +#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme +msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" +msgstr "Activeer reguliere expressie syntax voor tekst en vervanging" + +#: lazarusidestrconsts:liscodetempladd +msgid "Add" +msgstr "Toevoegen" + +#: lazarusidestrconsts:lisaddtoproject +msgid "Add %s to project?" +msgstr "%s aan het project toevoegen?" + +#: lazarusidestrconsts:uemaddwatchatcursor +msgid "Add &Watch At Cursor" +msgstr "&Kijk op positie Cursor toevoegen" + +#: lazarusidestrconsts:lisa2paddfile +msgid "Add File" +msgstr "Bestand Toevoegen" + +#: lazarusidestrconsts:lisa2paddfiles +msgid "Add Files" +msgstr "Bestanden toevoegen" + +#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist +msgid "Add LFM, LRS files, if they exist" +msgstr "Voeg .lfm of .lrs bestanden toe, indien ze bestaan" + +#: lazarusidestrconsts:lisa2paddunit +msgid "Add Unit" +msgstr "Unit Toevoegen" + +#: lazarusidestrconsts:lismenuaddcurunittopkg +msgid "Add active unit to a package" +msgstr "Een actieve unit toevoegen aan een Package" + +#: lazarusidestrconsts:lispckeditaddanitem +msgid "Add an item" +msgstr "Item toevoegen" + +#: lazarusidestrconsts:lismenuaddbreakpoint +msgid "Add breakpoint" +msgstr "Breekpunt toevoegen" + +#: lazarusidestrconsts:liscodetempladdcodetemplate +msgid "Add code template" +msgstr "Code 'template' toevoegen" + +#: lazarusidestrconsts:lismenuaddtoproject +msgid "Add editor file to Project" +msgstr "Editor bestand aan Project toevoegen" + +#: lazarusidestrconsts:lisprojaddeditorfile +msgid "Add editor files" +msgstr "Editor bestanden toevoegen" + +#: lazarusidestrconsts:lisaf2paddfiletoapackage +msgid "Add file to a package" +msgstr "" + +#: lazarusidestrconsts:lisprojaddaddfiletoproject +msgid "Add file to project:" +msgstr "Bestand aan project toevoegen:" + +#: lazarusidestrconsts:lisprojaddfiles +msgid "Add files" +msgstr "Bestanden toevoegen" + +#: lazarusidestrconsts:lisa2paddfilestopackage +msgid "Add files to package" +msgstr "" + +#: lazarusidestrconsts:srkmecaddjumppoint +msgid "Add jump point" +msgstr "Springpunt toevoegen" + +#: lazarusidestrconsts:lismenuaddjumppointtohistory +msgid "Add jump point to history" +msgstr "Springpunt aan geschiedenis toevoegen" + +#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects +msgid "Add options to dependent packages and projects" +msgstr "Opties aan packages en projecten toevoegen" + +#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects +msgid "Add paths to dependent packages/projects" +msgstr "Paden aan packages en projecten toevoegen" + +#: lazarusidestrconsts:lisa2paddtopackage +msgid "Add to package" +msgstr "" + +#: lazarusidestrconsts:lisprojaddtoproject +msgid "Add to project" +msgstr "Voeg toe aan het project" + +#: lazarusidestrconsts:lismenuaddwatch +msgid "Add watch ..." +msgstr "Watch toevoegen ..." + +#: lazarusidestrconsts:dlgedadd +msgid "Add..." +msgstr "Toevoegen ..." + +#: lazarusidestrconsts:dlgadditionalsrcpath +msgid "Additional Source search path for all projects (.pp;.pas)" +msgstr "Additionele bron zoek pad voor alle projecten (.pp, .pas)" + +#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages +msgid "Additional compiler options inherited from packages" +msgstr "Additionele compiler opties gelijk aan die van packages" + +#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp +msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" +msgstr "Additionele bestanden om te zoeken (d.w.z. /pad/*.pas, /pad2/*.pp)" + +#: lazarusidestrconsts:dlgadjusttopline +msgid "Adjust top line due to comment in front" +msgstr "Bewerk bovenste lijn" + +#: lazarusidestrconsts:fdmalignword +msgid "Align" +msgstr "Lijn uit" + +#: lazarusidestrconsts:lisalignment +msgid "Alignment" +msgstr "Uitlijning" + +#: lazarusidestrconsts:dlgallfiles +msgid "All files" +msgstr "Alle bestanden" + +#: lazarusidestrconsts:lisedtdefallpackages +msgid "All packages" +msgstr "Alle packages" + +#: lazarusidestrconsts:dlglabelgoto +msgid "Allow LABEL and GOTO" +msgstr "Laat LABEL en GOTO toe" + +#: lazarusidestrconsts:lisallowsearchingformultiplelines +msgid "Allow searching for multiple lines" +msgstr "Laat het zoeken naar meerdere lijnen toe" + +#: lazarusidestrconsts:dlgalphabetically +msgid "Alphabetically" +msgstr "Alfabetisch" + +#: lazarusidestrconsts:lisedtexttoolalt +msgid "Alt" +msgstr "Alt" + +#: lazarusidestrconsts:dlgaltsetclmode +msgid "Alt-Key sets column mode" +msgstr "Alt-toets stelt Kolom modus in" + +#: lazarusidestrconsts:srkmalternkey +msgid "Alternative Key" +msgstr "Alternatieve toets" + +#: lazarusidestrconsts:lisa2pambiguousancestortype +msgid "Ambiguous Ancestor Type" +msgstr "" + +#: lazarusidestrconsts:lisa2pambiguousclassname +msgid "Ambiguous Class Name" +msgstr "" + +#: lazarusidestrconsts:lisa2pambiguousunitname +msgid "Ambiguous Unit Name" +msgstr "" + +#: lazarusidestrconsts:lisambiguousunitfound +msgid "Ambiguous Unit found" +msgstr "" + +#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile +msgid "Ambiguous additional compiler config file" +msgstr "" + +#: lazarusidestrconsts:dlgambigfileact +msgid "Ambiguous file action:" +msgstr "" + +#: lazarusidestrconsts:lisambiguousfilefound +msgid "Ambiguous file found" +msgstr "" + +#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete +msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" +msgstr "" + +#: lazarusidestrconsts:lisambiguousfilesfound +msgid "Ambiguous files found" +msgstr "" + +#: lazarusidestrconsts:lispkgmangambiguousunitsfound +msgid "Ambiguous units found" +msgstr "" + +#: lazarusidestrconsts:lisa2pancestortype +msgid "Ancestor Type" +msgstr "Ancestor Type" + +#: lazarusidestrconsts:lismakeresstrappendtosection +msgid "Append to section" +msgstr "Voeg aan einde van sectie toe" + +#: lazarusidestrconsts:dlgpoapplication +msgid "Application" +msgstr "Applicatie" + +#: lazarusidestrconsts:dlgapplicationsettings +msgid "Application Settings" +msgstr "Applicatie Instellingen" + +#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra +msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." +msgstr "Applicatie%sEen grafisch lcl/freepascal programma. Het bestand wordt automatisch door Lazarus bijgehouden." + +#: lazarusidestrconsts:dlgbutapply +msgid "Apply" +msgstr "Toepassen" + +#: lazarusidestrconsts:lispckeditapplychanges +msgid "Apply changes" +msgstr "Veranderingen toepassen" + +#: lazarusidestrconsts:rslanguagearabic +msgid "Arabic" +msgstr "Arabisch" + +#: lazarusidestrconsts:dlgcoasis +msgid "As-Is" +msgstr "As-Is" + +#: lazarusidestrconsts:lissortselascending +msgid "Ascending" +msgstr "Neerwaarts" + +#: lazarusidestrconsts:dlgenvask +msgid "Ask" +msgstr "Vraag" + +#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext +msgid "Ask before replacing each found text" +msgstr "Vraag voor het vervangen van gevonden tekst" + +#: lazarusidestrconsts:liscodetoolsoptsat +msgid "At" +msgstr "Bij" + +#: lazarusidestrconsts:lispckoptsauthor +msgid "Author:" +msgstr "Auteur:" + +#: lazarusidestrconsts:dlgautoform +msgid "Auto create form when opening unit" +msgstr "Maak automatisch een Form bij openen unit" + +#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly +msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." +msgstr "Automatisch gemaakte nodes kunnen niet bewerkt worden,%tevens kunnen ze geen automatisch gemaakte Child nodes bevatten." + +#: lazarusidestrconsts:dlgautodel +msgid "Auto delete file" +msgstr "Verwijder bestand automatisch" + +#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited +msgid "Auto generated nodes can not be edited." +msgstr "Automatisch gegenereerde nodes kunnen niet bewerkt worden" + +#: lazarusidestrconsts:dlgautoident +msgid "Auto indent" +msgstr "Auto indent" + +#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall +msgid "Auto rebuild when rebuilding all" +msgstr "Automatisch herbouwen wanneer allen herbouwd worden" + +#: lazarusidestrconsts:dlgautoren +msgid "Auto rename file lowercase" +msgstr "" + +#: lazarusidestrconsts:dlgautosave +msgid "Auto save" +msgstr "Automatisch saven" + +#: lazarusidestrconsts:dlgautocreateforms +msgid "Auto-create forms:" +msgstr "Automatisch maken van Forms" + +#: lazarusidestrconsts:lispckexplautocreated +msgid "AutoCreated" +msgstr "AutoCreated" + +#: lazarusidestrconsts:rslanguageautomatic +msgid "Automatic (or english)" +msgstr "Automatisch (of Engels)" + +#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild +msgid "Automatically increment version on build" +msgstr "Automatisch incrementeren van versie bij bouwen" + +#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages +msgid "Automatically installed packages" +msgstr "Automatisch geinstalleerde packages" + +#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded +msgid "Automatically rebuild as needed" +msgstr "Automatisch herbouwen wanneer nodig" + +#: lazarusidestrconsts:dlgavailableforms +msgid "Available forms:" +msgstr "Beschikbare Forms:" + +#: lazarusidestrconsts:lisavailablepackages +msgid "Available packages" +msgstr "Beschikbare packages" + +#: lazarusidestrconsts:dlgedback +msgid "Back" +msgstr "Terug" + +#: lazarusidestrconsts:dlgbackcolor +msgid "Background" +msgstr "" + +#: lazarusidestrconsts:srvk_back +msgid "Backspace" +msgstr "Backspace" + +#: lazarusidestrconsts:dlgenvbckup +msgid "Backup" +msgstr "Backup" + +#: lazarusidestrconsts:lisbackupfilefailed +msgid "Backup file failed" +msgstr "Backup bestand gefaald" + +#: lazarusidestrconsts:lisfrbackwardsearch +msgid "Backward search" +msgstr "Achterwaarts zoeken" + +#: lazarusidestrconsts:dlgbehindmethods +msgid "Behind methods" +msgstr "Achter methoden" + +#: lazarusidestrconsts:lispkgfiletypebinary +msgid "Binary" +msgstr "Binair" + +#: lazarusidestrconsts:liscodetoolsdefsblock +msgid "Block" +msgstr "Blok" + +#: lazarusidestrconsts:dlgblockindent +msgid "Block indent:" +msgstr "Blok Insprining:" + +#: lazarusidestrconsts:dlgedbold +msgid "Bold" +msgstr "Vet" + +#: lazarusidestrconsts:uembookmarkn +msgid "Bookmark" +msgstr "Bookmark" + +#: lazarusidestrconsts:lisbottomspaceequally +msgid "Bottom space equally" +msgstr "Bodem gelijk gespaceerd" + +#: lazarusidestrconsts:lisbottoms +msgid "Bottoms" +msgstr "Bodems" + +#: lazarusidestrconsts:dlgbrachighlight +msgid "Bracket highlighting" +msgstr "Haakjes verlicht" + +#: lazarusidestrconsts:lismenubeaklinesinselection +msgid "Break Lines in selection" +msgstr "Breek lijnen in selectie" + +#: lazarusidestrconsts:srkmeclinebreak +msgid "Break line and move cursor" +msgstr "Breek lijn, en verplaats cursor" + +#: lazarusidestrconsts:srkmecinsertline +msgid "Break line, leave cursor" +msgstr "Breek lijn, verlaat cursor" + +#: lazarusidestrconsts:lismenuviewbreakpoints +msgid "BreakPoints" +msgstr "Breekpunten" + +#: lazarusidestrconsts:fdmbringtofront +msgid "Bring to front" +msgstr "Breng naar front" + +#: lazarusidestrconsts:lisa2pbrokendependencies +msgid "Broken Dependencies" +msgstr "Gebroken Afhankelijkheden" + +#: lazarusidestrconsts:lispkgmangbrokendependency +msgid "Broken dependency" +msgstr "Gebroken Dependency" + +#: lazarusidestrconsts:lispatheditbrowse +msgid "Browse" +msgstr "Blader" + +#: lazarusidestrconsts:lisbrowseforcompiler +msgid "Browse for Compiler (%s)" +msgstr "Blader voor Compiler (%s)" + +#: lazarusidestrconsts:dlgunitdepbrowse +msgid "Browse..." +msgstr "Blader ..." + +#: lazarusidestrconsts:lismenubuild +msgid "Build" +msgstr "Bouw" + +#: lazarusidestrconsts:lisbuildcodetools +msgid "Build CodeTools" +msgstr "Bouw CodeTools" + +#: lazarusidestrconsts:lisbuildcomponent +msgid "Build Component" +msgstr "Bouw Component" + +#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools +msgid "Build Components (SynEdit, CodeTools)" +msgstr "Bouw Components (SynEdit, CodeTools)" + +#: lazarusidestrconsts:lisbuildexamples +msgid "Build Examples" +msgstr "Bouw Voorbeelden" + +#: lazarusidestrconsts:lismenubuildfile +msgid "Build File" +msgstr "Bouw bestand" + +#: lazarusidestrconsts:lisbuildide +msgid "Build IDE" +msgstr "Bouw IDE" + +#: lazarusidestrconsts:lisbuildideintf +msgid "Build IDE Interface" +msgstr "Bouw IDE Interface" + +#: lazarusidestrconsts:lisbuildjitform +msgid "Build JIT Form" +msgstr "Bouw JIT Form" + +#: lazarusidestrconsts:lislazbuildbuildjitform +msgid "Build JITForm" +msgstr "Bouw JITForm" + +#: lazarusidestrconsts:lisbuildlcl +msgid "Build LCL" +msgstr "Bouw LCL" + +#: lazarusidestrconsts:lismenubuildlazarus +msgid "Build Lazarus" +msgstr "Bouw Lazarus" + +#: lazarusidestrconsts:lisbuildnumber +msgid "Build Number" +msgstr "Bouw Number" + +#: lazarusidestrconsts:lisbuildpkgreg +msgid "Build Package Registration" +msgstr "Bouw Package registratie" + +#: lazarusidestrconsts:lisbuildstarter +msgid "Build Starter" +msgstr "Bouw Starter" + +#: lazarusidestrconsts:lisbuildsynedit +msgid "Build SynEdit" +msgstr "Bouw SynEdit" + +#: lazarusidestrconsts:lismenubuildall +msgid "Build all" +msgstr "Bouw Alles" + +#: lazarusidestrconsts:srkmecbuildlazarus +msgid "Build lazarus" +msgstr "Bouw Lazarus" + +#: lazarusidestrconsts:lisbuildnewproject +msgid "Build new project" +msgstr "Bouw nieuw project" + +#: lazarusidestrconsts:dlgcmacro +msgid "C Style Macros (global)" +msgstr "C -stijl macro's (globaal)" + +#: lazarusidestrconsts:dlgcocops +msgid "C Style Operators (*=, +=, /= and -=)" +msgstr "C -stijl Operators (*=, +=, /= and -=)" + +#: lazarusidestrconsts:dlgcppinline +msgid "C++ Styled INLINE" +msgstr "C++ - stijl INLINE" + +#: lazarusidestrconsts:lismenuinsertcvskeyword +msgid "CVS keyword" +msgstr "CVS keyword" + +#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit +msgid "Call %sRegister%s procedure of selected unit" +msgstr "Call %Register%s procedure van de geselecteerde unit" + +#: lazarusidestrconsts:lismenuviewcallstack +msgid "Call Stack" +msgstr "Call Stack" + +#: lazarusidestrconsts:liscocallon +msgid "Call on:" +msgstr "Call bij:" + +#: lazarusidestrconsts:liscannotcopytoplevelcomponent +msgid "Can not copy top level component." +msgstr "" + +#: lazarusidestrconsts:liscannotcreatefile +msgid "Can not create file %s%s%s" +msgstr "Kan bestand %s%s%s niet maken." + +#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit +msgid "Can not register components without unit" +msgstr "Kan componenten zonder unit niet registreren." + +#: lazarusidestrconsts:dlgcancel +msgid "Cancel" +msgstr "Afbreken" + +#: lazarusidestrconsts:liscannotfindlazarusstarter +msgid "Cannot find lazarus starter:%s%s" +msgstr "Kan Lazarus Starter niet vinden:%s%s" + +#: lazarusidestrconsts:srvk_capital +msgid "Capital" +msgstr "Kapitaal" + +#: lazarusidestrconsts:lisdiffdlgcaseinsensitive +msgid "Case Insensitive" +msgstr "" + +#: lazarusidestrconsts:dlgcasesensitive +msgid "Case Sensitive" +msgstr "" + +#: lazarusidestrconsts:lisfindfilecasesensitive +msgid "Case sensitive" +msgstr "" + +#: lazarusidestrconsts:rslanguagecatalan +msgid "Catalan" +msgstr "Catalaans" + +#: lazarusidestrconsts:dlgcentercursorline +msgid "Center Cursor Line" +msgstr "Centreer Cursor line" + +#: lazarusidestrconsts:liscenterinwindow +msgid "Center in window" +msgstr "Centreer in window" + +#: lazarusidestrconsts:liscenters +msgid "Centers" +msgstr "Middenpunten" + +#: lazarusidestrconsts:liscodetemplchange +msgid "Change" +msgstr "Verander" + +#: lazarusidestrconsts:lischangeclass +msgid "Change Class" +msgstr "Verander Class" + +#: lazarusidestrconsts:lismenuinsertchangelogentry +msgid "ChangeLog entry" +msgstr "" + +#: lazarusidestrconsts:lisdiskdiffchangedfiles +msgid "Changed files:" +msgstr "Veranderde bestanden:" + +#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies +msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." +msgstr "" + +#: lazarusidestrconsts:srkmecchar +msgid "Char" +msgstr "" + +#: lazarusidestrconsts:lischaractermap +msgid "Character Map" +msgstr "" + +#: lazarusidestrconsts:lismenuchecklfm +msgid "Check LFM file in editor" +msgstr "Controleer .lfm file in editor" + +#: lazarusidestrconsts:dlgcheckconsistency +msgid "Check consistency" +msgstr "Controleer consistenciteit" + +#: lazarusidestrconsts:dlgcochecks +msgid "Checks:" +msgstr "" + +#: lazarusidestrconsts:lischoosedelphiproject +msgid "Choose Delphi project (*.dpr)" +msgstr "Kies Delphi project (*.dpr)" + +#: lazarusidestrconsts:lischoosedelphiunit +msgid "Choose Delphi unit (*.pas)" +msgstr "Kies Delphi unit (*.pas)" + +#: lazarusidestrconsts:lisctdefchoosedirectory +msgid "Choose Directory" +msgstr "Kies directory" + +#: lazarusidestrconsts:lischoosefpcsourcedir +msgid "Choose FPC source directory" +msgstr "Kies FPC directory" + +#: lazarusidestrconsts:lischooselazarussourcedirectory +msgid "Choose Lazarus Directory" +msgstr "Kies Lazarus directory" + +#: lazarusidestrconsts:lisedoptschoosescheme +msgid "Choose Scheme" +msgstr "Kies schema" + +#: lazarusidestrconsts:lischooseadifferentname +msgid "Choose a different name" +msgstr "Kies een andere naam" + +#: lazarusidestrconsts:dlgchscodetempl +msgid "Choose code template file (*.dci)" +msgstr "Kies code 'template' bestand (*.dci)" + +#: lazarusidestrconsts:lischoosecompilerpath +msgid "Choose compiler filename (%s)" +msgstr "Kies compiler bestandsnaam (%s)" + +#: lazarusidestrconsts:lischoosedebuggerpath +msgid "Choose debugger filename" +msgstr "Kies debugger bestandsnaam" + +#: lazarusidestrconsts:lischoosedirectory +msgid "Choose directory" +msgstr "Kies directory" + +#: lazarusidestrconsts:lischoosemakepath +msgid "Choose make path" +msgstr "Kies Maak pad" + +#: lazarusidestrconsts:lischooseprogramsourcepppaslpr +msgid "Choose program source (*.pp,*.pas,*.lpr)" +msgstr "Kies programma broncode (*.pp, *.pas, *.lpr)" + +#: lazarusidestrconsts:lischoosestructuretoencloseselection +msgid "Choose structure to enclose selection" +msgstr "Kies structuur om selectie te omsluiten" + +#: lazarusidestrconsts:lischoosetestbuilddir +msgid "Choose the directory for tests" +msgstr "Kies de directory voor testen" + +#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies +msgid "Circle in package dependencies" +msgstr "" + +#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste +msgid "Class %s%s%s is not a registered component class.%sUnable to paste." +msgstr "Class %s%s%s is geen geregistreerde component Class.%sKan niet plakken." + +#: lazarusidestrconsts:lisa2pclassnamealreadyexists +msgid "Class Name already exists" +msgstr "Class naam bestaat reeds." + +#: lazarusidestrconsts:lisclassnotfound +msgid "Class not found" +msgstr "Class niet gevonden" + +#: lazarusidestrconsts:dlgcdtclassorder +msgid "Class order" +msgstr "Class volgorde" + +#: lazarusidestrconsts:dlgclassinsertpolicy +msgid "Class part insert policy" +msgstr "" + +#: lazarusidestrconsts:liscldircleandirectory +msgid "Clean Directory" +msgstr "Maak directory schoon" + +#: lazarusidestrconsts:liscleanlazarussource +msgid "Clean Lazarus Source" +msgstr "Maak Lazarus Broncode schoon" + +#: lazarusidestrconsts:lislazbuildcleanall +msgid "Clean all" +msgstr "Maak alles schoon" + +#: lazarusidestrconsts:lismenucleandirectory +msgid "Clean directory" +msgstr "Maak directory schoon" + +#: lazarusidestrconsts:liscldircleansubdirectories +msgid "Clean sub directories" +msgstr "Maak sub directory schoon" + +#: lazarusidestrconsts:lislazbuildcleanbuild +msgid "Clean+Build" +msgstr "Maak schoon + Bouw" + +#: lazarusidestrconsts:srvk_clear +msgid "Clear" +msgstr "Leeg" + +#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff +msgid "Click on one of the above items to see the diff" +msgstr "Klik op een van de bovenstaande items om het verschil te zien" + +#: lazarusidestrconsts:lismenuclose +msgid "Close" +msgstr "Sluiten" + +#: lazarusidestrconsts:srkmeccloseall +msgid "Close all" +msgstr "Sluit Alles" + +#: lazarusidestrconsts:lismenucloseall +msgid "Close all editor files" +msgstr "Sluit alle editor bestanden" + +#: lazarusidestrconsts:dlgcodegeneration +msgid "Code" +msgstr "" + +#: lazarusidestrconsts:dlgcodecreation +msgid "Code Creation" +msgstr "Code creatie" + +#: lazarusidestrconsts:lismenuviewcodeexplorer +msgid "Code Explorer" +msgstr "Code Verkenner" + +#: lazarusidestrconsts:dlgcodetoolstab +msgid "Code Tools" +msgstr "Code Hulpmiddelen" + +#: lazarusidestrconsts:dlgedcodeparams +msgid "Code parameters" +msgstr "" + +#: lazarusidestrconsts:srkmecautocompletion +msgid "Code template completion" +msgstr "" + +#: lazarusidestrconsts:dlgedcodetempl +msgid "Code templates" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor +msgid "CodeTools Defines Editor" +msgstr "CodeTools definities editor" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview +msgid "CodeTools Defines Preview" +msgstr "" + +#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues +msgid "CodeTools Directory Values" +msgstr "" + +#: lazarusidestrconsts:dlgcodetoolsopts +msgid "CodeTools Options" +msgstr "CodeTools Instellingen" + +#: lazarusidestrconsts:srkmcatcodetools +msgid "CodeTools commands" +msgstr "CodeTools commando's" + +#: lazarusidestrconsts:lismenucodetoolsdefineseditor +msgid "CodeTools defines editor" +msgstr "CodeTools definities editor" + +#: lazarusidestrconsts:lismenucodetoolsoptions +msgid "CodeTools options" +msgstr "CodeTools opties" + +#: lazarusidestrconsts:srkmeccodetoolsdefinesed +msgid "Codetools defines editor" +msgstr "Codetools definities editor" + +#: lazarusidestrconsts:srkmeccodetoolsoptions +msgid "Codetools options" +msgstr "CodeTools Opties" + +#: lazarusidestrconsts:lismenucollectpofil +msgid "Collect .po files" +msgstr "Verzamel .po bestanden" + +#: lazarusidestrconsts:liscodetoolsoptscolon +msgid "Colon" +msgstr "Dubbele punt" + +#: lazarusidestrconsts:dlgedcolor +msgid "Color" +msgstr "Kleur" + +#: lazarusidestrconsts:dlgclrscheme +msgid "Color Scheme:" +msgstr "Kleur schema:" + +#: lazarusidestrconsts:dlgenvcolors +msgid "Colors" +msgstr "Kleuren" + +#: lazarusidestrconsts:srkmeccolumnselect +msgid "Column selection mode" +msgstr "Kolom selectie methode" + +#: lazarusidestrconsts:liscodetoolsoptscomma +msgid "Comma" +msgstr "Komma" + +#: lazarusidestrconsts:srkmcommand +msgid "Command " +msgstr "Commando " + +#: lazarusidestrconsts:liscommandafterinvalid +msgid "Command after invalid" +msgstr "" + +#: lazarusidestrconsts:liscommandafterpublishingmodule +msgid "Command after publishing module" +msgstr "" + +#: lazarusidestrconsts:srkmcatcmdcmd +msgid "Command commands" +msgstr "" + +#: lazarusidestrconsts:dlgcommandlineparams +msgid "Command line parameters (without application name)" +msgstr "Command line parameters (zonder applicatie naam)" + +#: lazarusidestrconsts:liscommandlineparamsofprogram +msgid "Command line parameters of program" +msgstr "Command line parameters van het programma" + +#: lazarusidestrconsts:liscocommand +msgid "Command:" +msgstr "" + +#: lazarusidestrconsts:lismenucommentselection +msgid "Comment selection" +msgstr "Commentaar Selectie" + +#: lazarusidestrconsts:liscodetemplcomment +msgid "Comment:" +msgstr "Commentaar:" + +#: lazarusidestrconsts:dlgcocompilation +msgid "Compilation" +msgstr "Compilatie" + +#: lazarusidestrconsts:liscocalloncompile +msgid "Compile" +msgstr "Compileren" + +#: lazarusidestrconsts:liscompileidewithoutlinking +msgid "Compile IDE (without linking)" +msgstr "Compileer IDE (zonder Linking)" + +#: lazarusidestrconsts:lispckeditcompileeverything +msgid "Compile everything?" +msgstr "Alles compileeren?" + +#: lazarusidestrconsts:lispckeditcompilepackage +msgid "Compile package" +msgstr "" + +#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition +msgid "CompiledSrcPath addition" +msgstr "" + +#: lazarusidestrconsts:liscompiler +msgid "Compiler" +msgstr "" + +#: lazarusidestrconsts:dlgcompileroptions +msgid "Compiler Options" +msgstr "Compiler Opties" + +#: lazarusidestrconsts:lispckeditcompileroptionsforpackage +msgid "Compiler Options for Package %s" +msgstr "Compiler opties voor Package %s" + +#: lazarusidestrconsts:liscompileroptionsforproject +msgid "Compiler Options for Project: %s" +msgstr "Compiler Options voor project: %s" + +#: lazarusidestrconsts:lismenucompileroptions +msgid "Compiler Options..." +msgstr "Compiler Opties ..." + +#: lazarusidestrconsts:liscompilererror +msgid "Compiler error" +msgstr "Compiler fout" + +#: lazarusidestrconsts:liscompilerfilename +msgid "Compiler filename" +msgstr "Compiler bestandsnaam" + +#: lazarusidestrconsts:dlgfpcpath +msgid "Compiler path (%s)" +msgstr "Compiler pad (%s)" + +#: lazarusidestrconsts:lismenucompletecode +msgid "Complete Code" +msgstr "Completeer code" + +#: lazarusidestrconsts:srkmeccompletecode +msgid "Complete code" +msgstr "Completeer code" + +#: lazarusidestrconsts:dlgcompleteproperties +msgid "Complete properties" +msgstr "" + +#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined +msgid "Component Class %s%s%s already defined" +msgstr "Component Class %s%s%s reeds gedefinieerd" + +#: lazarusidestrconsts:liscomponentnameiskeyword +msgid "Component name %s%s%s is keyword" +msgstr "Component Naam %s%s%s is keyword" + +#: lazarusidestrconsts:liscomponentnameisnotavalididentifier +msgid "Component name %s%s%s is not a valid identifier" +msgstr "Component Naam %s%s%s is geen geldige identifier" + +#: lazarusidestrconsts:srkmcatcomponentsmenu +msgid "Components menu commands" +msgstr "Component Menu commando's" + +#: lazarusidestrconsts:dlgconfigfiles +msgid "Config Files:" +msgstr "Configuratie bestanden:" + +#: lazarusidestrconsts:lisconfigurebuildlazarus +msgid "Configure %sBuild Lazarus%s" +msgstr "Configureer %sLazarus Bouwen%s" + +#: lazarusidestrconsts:lismenuconfigbuildfile +msgid "Configure Build+Run File" +msgstr "Configureer Bouwen+Starten bestand" + +#: lazarusidestrconsts:lismenuconfigurehelp +msgid "Configure Help" +msgstr "Configureer Help" + +#: lazarusidestrconsts:lismenuconfigurebuildlazarus +msgid "Configure \"Build Lazarus\"" +msgstr "Configureer \"Lazarus Bouwen\"" + +#: lazarusidestrconsts:lismenuconfigcustomcomps +msgid "Configure custom components" +msgstr "Configureer aanpasbare componenten" + +#: lazarusidestrconsts:lismenusettings +msgid "Configure custom tools ..." +msgstr "Configureer aanpasbare hulpmiddelen" + +#: lazarusidestrconsts:lismenueditinstallpkgs +msgid "Configure installed packages" +msgstr "Configureer geinstalleerde packages" + +#: lazarusidestrconsts:lisconfirmchanges +msgid "Confirm changes" +msgstr "Bevestig veranderingen" + +#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency +msgid "Confirm deleting dependency" +msgstr "Bevestig Afhankelijkheid verwijderen" + +#: lazarusidestrconsts:lisprojinspconfirmremovingfile +msgid "Confirm removing file" +msgstr "Bevestig bestand verwijderen" + +#: lazarusidestrconsts:srkmconflic +msgid "Conflict " +msgstr "" + +#: lazarusidestrconsts:dlginitdoneonly +msgid "Constructor name must be 'init' (destructor must be 'done')" +msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')" + +#: lazarusidestrconsts:lismenutemplatecontents +msgid "Contents" +msgstr "Inhoud" + +#: lazarusidestrconsts:lismenucontexthelp +msgid "Context sensitive Help" +msgstr "Context gevoelige help" + +#: lazarusidestrconsts:srvk_control +msgid "Control" +msgstr "" + +#: lazarusidestrconsts:liscontrolneedsparent +msgid "Control needs parent" +msgstr "Parent vereist voor control" + +#: lazarusidestrconsts:lismakeresstrconversionoptions +msgid "Conversion Options" +msgstr "Conversie Opties" + +#: lazarusidestrconsts:lisconversionerror +msgid "Conversion error" +msgstr "Conversiefout" + +#: lazarusidestrconsts:srvk_convert +msgid "Convert" +msgstr "Converteren" + +#: lazarusidestrconsts:lismenuconvertdfmtolfm +msgid "Convert DFM file to LFM" +msgstr "Converteer .dfm bestand naar .lfm" + +#: lazarusidestrconsts:lismenuconvertdelphiproject +msgid "Convert Delphi Project to Lazarus Project" +msgstr "Converteer Delphi project naar Lazarus project" + +#: lazarusidestrconsts:lismenuconvertdelphiunit +msgid "Convert Delphi unit to Lazarus unit" +msgstr "Converteer Delphi unit naar Lazarus unit" + +#: lazarusidestrconsts:liscodetoolsdefsconvertnode +msgid "Convert node" +msgstr "Converteer node" + +#: lazarusidestrconsts:srkmecselectiontabs2spaces +msgid "Convert tabs to spaces in selection" +msgstr "Converteer tabs naar spaties in selectie" + +#: lazarusidestrconsts:lismenucopy +msgid "Copy" +msgstr "Kopiren" + +#: lazarusidestrconsts:liscopyerror +msgid "Copy Error" +msgstr "Kopierfout" + +#: lazarusidestrconsts:liscopyallmessagestoclipboard +msgid "Copy all messages to clipboard" +msgstr "Kopier alle berichten naar klipbord" + +#: lazarusidestrconsts:liscopyerror2 +msgid "Copy error" +msgstr "Kopierfout" + +#: lazarusidestrconsts:lisdsgcopycomponents +msgid "Copy selected components to clipboard" +msgstr "Kopier geselecteerde componenten naar klipbord" + +#: lazarusidestrconsts:srkmeccopy +msgid "Copy selection to clipboard" +msgstr "Kopier selectie naar klipbord" + +#: lazarusidestrconsts:dlgcopywordatcursoroncopynone +msgid "Copy word on copy none" +msgstr "Kopier woord asl niets geselecteerd" + +#: lazarusidestrconsts:liscopyingawholeformisnotimplemented +msgid "Copying a whole form is not implemented." +msgstr "Een gehele Form kopiren is niet geimplementeerd." + +#: lazarusidestrconsts:lislgplnotice +msgid "Copyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "" + +#: lazarusidestrconsts:lisgplnotice +msgid "Copyright (C) %sThis program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "" + +#: lazarusidestrconsts:dlgsmbcounter +msgid "Counter (.pp;1)" +msgstr "" + +#: lazarusidestrconsts:lisnpcreate +msgid "Create" +msgstr "Maak" + +#: lazarusidestrconsts:lismenucreatepofile +msgid "Create .po files" +msgstr "Creer .po bestanden" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory +msgid "Create Defines for %s Directory" +msgstr "Creer definities voor %s folder" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject +msgid "Create Defines for %s Project" +msgstr "Creer definities voor %s Project" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcvssources +msgid "Create Defines for Free Pascal CVS Sources" +msgstr "Creer definities voor FP CVS Broncode" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler +msgid "Create Defines for Free Pascal Compiler" +msgstr "Creer definities voor Free Pascal Compiler" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir +msgid "Create Defines for Lazarus Directory" +msgstr "Creer definities voor Lazarus folder" + +#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory +msgid "Create FPC Macros and paths for a fpc project directory" +msgstr "Creer FPC macro's en paden voor een fpc project folder" + +#: lazarusidestrconsts:lismenueditorcreatesubmenu +msgid "Create Submenu" +msgstr "" + +#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained +msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." +msgstr "Maak een nieuwe cgi applicatie.%sHet bestand wordt door Lazarus bijgehouden." + +#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype +msgid "Create a new editor file.%sChoose a type." +msgstr "Maak een nieuw editor bestand.%sKies een type." + +#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile +msgid "Create a new empty text file." +msgstr "Maak een nieuw leeg tekst bestand." + +#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication +msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." +msgstr "Maak een nieuwe grafische applicatie.%sHet bestand wordt door Lazarus beheerd." + +#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit +msgid "Create a new pascal unit." +msgstr "Maak een nieuwe Pascal unit" + +#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram +msgid "Create a new program." +msgstr "Maak een nieuw programma." + +#: lazarusidestrconsts:lisnewdlgcreateanewprogram +msgid "Create a new program.%sThe program file is maintained by Lazarus." +msgstr "Maak een nieuw programma.%sHet programma wordt door Lazarus beheerd." + +#: lazarusidestrconsts:lisnpcreateanewproject +msgid "Create a new project" +msgstr "Maak een nieuw project" + +#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype +msgid "Create a new project.%sChoose a type." +msgstr "Maak een nieuw project.%sKies een type." + +#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun +msgid "Create a new standard package.%sA package is a collection of units and components." +msgstr "" + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform +msgid "Create a new unit with a LCL form." +msgstr "Maak een nieuwe unit met een LCL Form." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule +msgid "Create a new unit with a datamodule." +msgstr "Maak een nieuwe unit met een datamodule" + +#: lazarusidestrconsts:liscreateaprojectfirst +msgid "Create a project first!" +msgstr "Maak eerst een project!" + +#: lazarusidestrconsts:dlgruberbandcreationcolor +msgid "Creation" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolctrl +msgid "Ctrl" +msgstr "" + +#: lazarusidestrconsts:lisedtdefcurrentproject +msgid "Current Project" +msgstr "Huidig project" + +#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory +msgid "Current Project Directory" +msgstr "Huidige project folder" + +#: lazarusidestrconsts:lismenuinsertdatetime +msgid "Current date and time" +msgstr "Huidige datum en tijd" + +#: lazarusidestrconsts:lismenuinsertusername +msgid "Current username" +msgstr "Huidige username" + +#: lazarusidestrconsts:dlgcursorbeyondeol +msgid "Cursor beyond EOL" +msgstr "Cursor voorbij EOL" + +#: lazarusidestrconsts:liscursorcolumnincurrenteditor +msgid "Cursor column in current editor" +msgstr "Cursor kolom in huidige editor" + +#: lazarusidestrconsts:srkmcatcursormoving +msgid "Cursor moving commands" +msgstr "Cursor beweeg commando's" + +#: lazarusidestrconsts:liscursorrowincurrenteditor +msgid "Cursor row in current editor" +msgstr "Cursor rij in huidige editor" + +#: lazarusidestrconsts:lispckoptscustom +msgid "Custom" +msgstr "Aanpasbaar" + +#: lazarusidestrconsts:lismakeresstrcustomidentifier +msgid "Custom Identifier" +msgstr "Aanpasbare Identifier" + +#: lazarusidestrconsts:liscustomprogram +msgid "Custom Program" +msgstr "Aanpasbaar Programma" + +#: lazarusidestrconsts:liscustomprogramafreepascalprogram +msgid "Custom Program%sA freepascal program." +msgstr "Aanpasbaar Programma%sEen Freepascal programma." + +#: lazarusidestrconsts:liskeycatcustom +msgid "Custom commands" +msgstr "Aanpasbare commando's" + +#: lazarusidestrconsts:liscustomoptions2 +msgid "Custom options" +msgstr "Aanpasbare Opties" + +#: lazarusidestrconsts:rsiwpcustomposition +msgid "Custom position" +msgstr "Aanpasbare positie" + +#: lazarusidestrconsts:srkmeccustomtool +msgid "Custom tool %d" +msgstr "Aanpasbare Tool %d" + +#: lazarusidestrconsts:lismenucut +msgid "Cut" +msgstr "Knippen" + +#: lazarusidestrconsts:lisdsgcutcomponents +msgid "Cut selected components to clipboard" +msgstr "Knip geselecteerde componenten naar klipbord" + +#: lazarusidestrconsts:srkmeccut +msgid "Cut selection to clipboard" +msgstr "Knip selectie naar klipbord" + +#: lazarusidestrconsts:lishlpoptsdatabases +msgid "Databases" +msgstr "" + +#: lazarusidestrconsts:lisdate +msgid "Date" +msgstr "Datum" + +#: lazarusidestrconsts:uemdebugword +msgid "Debug" +msgstr "Debug" + +#: lazarusidestrconsts:lismenuviewdebugoutput +msgid "Debug output" +msgstr "Debugger output" + +#: lazarusidestrconsts:lismenudebugwindows +msgid "Debug windows" +msgstr "Debug schermen" + +#: lazarusidestrconsts:lismendebuggeroptions +msgid "Debugger Options" +msgstr "Debugger opties" + +#: lazarusidestrconsts:lisdebuggererror +msgid "Debugger error" +msgstr "Debuggerfout" + +#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate +msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." +msgstr "Debugger error%sSla uw werk op en kies 'stop'" + +#: lazarusidestrconsts:lisdebuggerinvalid +msgid "Debugger invalid" +msgstr "Debugger ongeldig" + +#: lazarusidestrconsts:dlgcodebugpath +msgid "Debugger path addition (none):" +msgstr "Debugger pad toevoeging (geen):" + +#: lazarusidestrconsts:dlgdebugtype +msgid "Debugger type and path" +msgstr "Debugger type en pad" + +#: lazarusidestrconsts:dlgcodebugging +msgid "Debugging:" +msgstr "Debugging:" + +#: lazarusidestrconsts:rsiwpdefault +msgid "Default" +msgstr "Standaard" + +#: lazarusidestrconsts:dlgdefaulteditorfont +msgid "Default editor font" +msgstr "Standaard editor font" + +#: lazarusidestrconsts:dlgpasext +msgid "Default pascal extension" +msgstr "Standaard pascal extenties" + +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsdefine +msgid "Define" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse +msgid "Define Recurse" +msgstr "" + +#: lazarusidestrconsts:dlgeddelay +msgid "Delay" +msgstr "" + +#: lazarusidestrconsts:dlgeddelete +msgid "Delete" +msgstr "Verwijder" + +#: lazarusidestrconsts:lismenueditordeletefromtemplate +msgid "Delete From Template..." +msgstr "Verwijder van template ..." + +#: lazarusidestrconsts:lismenueditordeleteitem +msgid "Delete Item" +msgstr "Verwijder item" + +#: lazarusidestrconsts:srkmecdeletelastchar +msgid "Delete Last Char" +msgstr "Verwijder laatste karakter" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile +msgid "Delete Old Package File?" +msgstr "Verwijder het oude Package bestand?" + +#: lazarusidestrconsts:lisdeleteambiguousfile +msgid "Delete ambiguous file?" +msgstr "" + +#: lazarusidestrconsts:srkmecdeletechar +msgid "Delete char at cursor" +msgstr "Verwijder karakter bij cursor" + +#: lazarusidestrconsts:srkmecdeleteline +msgid "Delete current line" +msgstr "Verwijder huidige regel" + +#: lazarusidestrconsts:lisprojinspdeletedependencyfor +msgid "Delete dependency for %s?" +msgstr "Verwijder afhankelijkheid voor %s?" + +#: lazarusidestrconsts:lispkgmangdeletefailed +msgid "Delete failed" +msgstr "Verwijderen mislukt" + +#: lazarusidestrconsts:lisdeletefilefailed +msgid "Delete file failed" +msgstr "Verwijderen bestand mislukt" + +#: lazarusidestrconsts:liscodetoolsdefsdeletenode +msgid "Delete node" +msgstr "Verwijder node" + +#: lazarusidestrconsts:lisdeleteoldfile +msgid "Delete old file %s%s%s?" +msgstr "Verwijder oud bestand %s%s%s?" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 +msgid "Delete old package file %s%s%s?" +msgstr "" + +#: lazarusidestrconsts:fdmdeleteselection +msgid "Delete selection" +msgstr "Verwijder selectie" + +#: lazarusidestrconsts:dlgdeltemplate +msgid "Delete template " +msgstr "Verwijder template" + +#: lazarusidestrconsts:srkmecdeletebol +msgid "Delete to beginning of line" +msgstr "Verwijder tot het begin van de regel" + +#: lazarusidestrconsts:srkmecdeleteeol +msgid "Delete to end of line" +msgstr "Verwijder tot het eind van de regel" + +#: lazarusidestrconsts:srkmecdeleteword +msgid "Delete to end of word" +msgstr "Verwijder tot het eind van het woord" + +#: lazarusidestrconsts:srkmecdeletelastword +msgid "Delete to start of word" +msgstr "Verwijder tot het begin van het woord" + +#: lazarusidestrconsts:srkmecclearall +msgid "Delete whole text" +msgstr "Verwijder gehele tekst" + +#: lazarusidestrconsts:lisdeletingoffilefailed +msgid "Deleting of file %s%s%s failed." +msgstr "Verwijderen van bestand %s%s%s mislukt." + +#: lazarusidestrconsts:dlgdelphi2ext +msgid "Delphi 2 Extensions" +msgstr "Delphi 2 extensies" + +#: lazarusidestrconsts:dlgdeplhicomp +msgid "Delphi Compatible" +msgstr "Delphi compatible" + +#: lazarusidestrconsts:lisa2pdependency +msgid "Dependency" +msgstr "Afhankelijkheid" + +#: lazarusidestrconsts:lispckeditdependencyproperties +msgid "Dependency Properties" +msgstr "Afhankelijkheid eigenschappen" + +#: lazarusidestrconsts:lisprojadddependencyalreadyexists +msgid "Dependency already exists" +msgstr "Afhankelijkheid bestaat al" + +#: lazarusidestrconsts:lispkgmangdependencywithoutowner +msgid "Dependency without Owner: %s" +msgstr "Afhankelijkheid zonder eigenaar: %s" + +#: lazarusidestrconsts:lissortseldescending +msgid "Descending" +msgstr "Neerwaarts" + +#: lazarusidestrconsts:listodoldescription +msgid "Description" +msgstr "Beschrijving" + +#: lazarusidestrconsts:lispckoptsdescriptionabstract +msgid "Description/Abstract" +msgstr "Beschrijving/Samenvatting" + +#: lazarusidestrconsts:liscodetoolsdefsdescription +msgid "Description:" +msgstr "Beschrijving:" + +#: lazarusidestrconsts:lisoipdescription +msgid "Description: " +msgstr "Beschrijving: " + +#: lazarusidestrconsts:liskeycatdesigner +msgid "Designer commands" +msgstr "" + +#: lazarusidestrconsts:lispckoptsdesigntimeandruntime +msgid "Designtime and Runtime" +msgstr "Designtime en Runtime" + +#: lazarusidestrconsts:lispckoptsdesigntimeonly +msgid "Designtime only" +msgstr "" + +#: lazarusidestrconsts:dlgdesktop +msgid "Desktop" +msgstr "" + +#: lazarusidestrconsts:dlgdesktopfiles +msgid "Desktop files" +msgstr "" + +#: lazarusidestrconsts:lisaf2pdestinationpackage +msgid "Destination Package" +msgstr "" + +#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete +msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." +msgstr "Doel folder %s%s%s is ongeldig.%sKies a.u.b. een geldig pad." + +#: lazarusidestrconsts:rslanguagedeutsch +msgid "Deutsch" +msgstr "" + +#: lazarusidestrconsts:lismenudiff +msgid "Diff" +msgstr "Verschil" + +#: lazarusidestrconsts:dlgdirection +msgid "Direction" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory +msgid "Directory" +msgstr "Folder" + +#: lazarusidestrconsts:dlgdirectorydoesnotexist +msgid "Directory does not exist" +msgstr "Folder bestaat niet" + +#: lazarusidestrconsts:dlgtestprjdir +msgid "Directory for building test projects" +msgstr "Folder voor bouwen van test projecten" + +#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound +msgid "Directory not found" +msgstr "Folder niet gevonden" + +#: lazarusidestrconsts:lisfindfiledirectoryoptions +msgid "Directory options" +msgstr "Folder opties" + +#: lazarusidestrconsts:dlgeddisplay +msgid "Display" +msgstr "" + +#: lazarusidestrconsts:dlgrunodisplay +msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" +msgstr "" + +#: lazarusidestrconsts:dlglnumsbct +msgid "Display Line Numbers in Run-time Error Backtraces" +msgstr "Toon regelnummers in Run-time Error Backtraces" + +#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda +msgid "Distinguish big and small letters e.g. A and a" +msgstr "Maak onderscheid in hoofd en kleine letters. Bijv. A en a" + +#: lazarusidestrconsts:dlgnotsplitlinefront +msgid "Do not split line In front of:" +msgstr "Splits een regel niet voor :" + +#: lazarusidestrconsts:dlgnotsplitlineafter +msgid "Do not split line after:" +msgstr "Splits een regel niet na :" + +#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand +msgid "Do you really want to forget all changes to package %s and reload it from file?" +msgstr "" + +#: lazarusidestrconsts:rsiwpdocked +msgid "Docked" +msgstr "" + +#: lazarusidestrconsts:lisdocumentationeditor +msgid "Documentation Editor" +msgstr "" + +#: lazarusidestrconsts:lissortseldomain +msgid "Domain" +msgstr "Domein" + +#: lazarusidestrconsts:dlgdoubleclickline +msgid "Double click line" +msgstr "Dubble klik regel" + +#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick +msgid "Double click on messages jumps (otherwise: single click)" +msgstr "Dubble klik regel op een bericht springt (anders: enkele klik)" + +#: lazarusidestrconsts:dlgdownword +msgid "Down" +msgstr "" + +#: lazarusidestrconsts:dlgdragdroped +msgid "Drag Drop editing" +msgstr "" + +#: lazarusidestrconsts:dlgdropfiles +msgid "Drop files" +msgstr "" + +#: lazarusidestrconsts:lismenuenvironent +msgid "E&nvironment" +msgstr "I&nstellingen" + +#: lazarusidestrconsts:liscodetoolsdefsedit +msgid "Edit" +msgstr "Bewerken" + +#: lazarusidestrconsts:lispckediteditgeneraloptions +msgid "Edit General Options" +msgstr "Bewerk algemene opies" + +#: lazarusidestrconsts:srkmeditkeys +msgid "Edit Keys" +msgstr "Bewerk toetsen" + +#: lazarusidestrconsts:lispckediteditoptionstocompilepackage +msgid "Edit Options to compile package" +msgstr "" + +#: lazarusidestrconsts:lisedtexttooledittool +msgid "Edit Tool" +msgstr "Bewerk Tool" + +#: lazarusidestrconsts:liscodetempleditcodetemplate +msgid "Edit code template" +msgstr "Bewerk code template" + +#: lazarusidestrconsts:srkmeditforcmd +msgid "Edit keys for command" +msgstr "Bewerk Toetsen voor commando's" + +#: lazarusidestrconsts:dlgededit +msgid "Edit..." +msgstr "Bewerken ..." + +#: lazarusidestrconsts:dlgedfiles +msgid "Editor files" +msgstr "Editor bestanden" + +#: lazarusidestrconsts:dlgeditorfont +msgid "Editor font" +msgstr "Editor Fonts" + +#: lazarusidestrconsts:dlgeditorfontheight +msgid "Editor font height" +msgstr "" + +#: lazarusidestrconsts:lismenueditoroptions +msgid "Editor options" +msgstr "Editor opties" + +#: lazarusidestrconsts:uemeditorproperties +msgid "Editor properties" +msgstr "Editor Eigenschappen" + +#: lazarusidestrconsts:dlgedelement +msgid "Element" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefselse +msgid "Else" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefselseif +msgid "ElseIf" +msgstr "" + +#: lazarusidestrconsts:lisenclose +msgid "Enclose" +msgstr "Omsluit" + +#: lazarusidestrconsts:uemencloseselection +msgid "Enclose Selection" +msgstr "Omsluit Selectie" + +#: lazarusidestrconsts:lismenuencloseselection +msgid "Enclose selection" +msgstr "Omsluit Selectie" + +#: lazarusidestrconsts:srvk_end +msgid "End" +msgstr "Einde" + +#: lazarusidestrconsts:rslanguageenglish +msgid "English" +msgstr "" + +#: lazarusidestrconsts:lismacropromptenterdata +msgid "Enter data" +msgstr "Voer data in" + +#: lazarusidestrconsts:lismacropromptenterrunparameters +msgid "Enter run parameters" +msgstr "Voer Start parameters in" + +#: lazarusidestrconsts:lisentertransla +msgid "Enter translation language" +msgstr "" + +#: lazarusidestrconsts:dlgentirescope +msgid "Entire Scope" +msgstr "Geheel bereik" + +#: lazarusidestrconsts:dlgrunoenvironment +msgid "Environment" +msgstr "Omgeving" + +#: lazarusidestrconsts:srkmcatenvmenu +msgid "Environment menu commands" +msgstr "Omgeving Menu commando's" + +#: lazarusidestrconsts:lismenugeneraloptions +msgid "Environment options" +msgstr "Omgeving opties" + +#: lazarusidestrconsts:liscodetemplerror +msgid "Error" +msgstr "Fout" + +#: lazarusidestrconsts:lispkgmangerrorreadingpackage +msgid "Error Reading Package" +msgstr "Fout bij Lezen Package" + +#: lazarusidestrconsts:lispkgmangerrorwritingpackage +msgid "Error Writing Package" +msgstr "Fout bij schrijven Package" + +#: lazarusidestrconsts:liserrorcreatingfile +msgid "Error creating file" +msgstr "Fout bij maken bestand" + +#: lazarusidestrconsts:liserrorcreatinglrs +msgid "Error creating lrs" +msgstr "" + +#: lazarusidestrconsts:liserrordeletingfile +msgid "Error deleting file" +msgstr "Fout bij verwijderen bestand" + +#: lazarusidestrconsts:liserrorin +msgid "Error in %s" +msgstr "Fout in %s" + +#: lazarusidestrconsts:lisueerrorinregularexpression +msgid "Error in regular expression" +msgstr "Fout in reguliere expressie" + +#: lazarusidestrconsts:liserrorinitializingprogramserrors +msgid "Error initializing program%s%s%s%s%sError: %s" +msgstr "Fout initialisering programma %s%s%s%sFout: %s" + +#: lazarusidestrconsts:liserrormovingcomponent +msgid "Error moving component" +msgstr "Fout bij verplaatsen component" + +#: lazarusidestrconsts:liserrormovingcomponent2 +msgid "Error moving component %s:%s" +msgstr "Fout bij verplaatsen component %s;%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorreading +msgid "Error reading %s%s%s%s%s" +msgstr "Fout bij lezen %s%s%s%s" + +#: lazarusidestrconsts:lispkgmangerrorreadingfile +msgid "Error reading file" +msgstr "Fout bij lezen bestand" + +#: lazarusidestrconsts:lisdiskdifferrorreadingfile +msgid "Error reading file: %s" +msgstr "Fout bij lezen bestand: %s" + +#: lazarusidestrconsts:liserrorreadingpackagelistfromfile +msgid "Error reading package list from file%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile +msgid "Error reading project info file %s%s%s%s%s" +msgstr "Fout bij lezen project info bestand %s%s%s%s" + +#: lazarusidestrconsts:liserrorrenamingfile +msgid "Error renaming file" +msgstr "Fout bij herbenoemen bestand" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting +msgid "Error while writing %s%s%s%s%s" +msgstr "Fout bij het schrijven %s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile +msgid "Error while writing project info file %s%s%s%s%s" +msgstr "Fout tijdens het schrijven project info file %s%s%s%s" + +#: lazarusidestrconsts:lispkgmangerrorwritingfile +msgid "Error writing file" +msgstr "Fout bij schrijven bestand" + +#: lazarusidestrconsts:liserrorwritingpackagelisttofile +msgid "Error writing package list to file%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:liserror +msgid "Error: " +msgstr "Fout:" + +#: lazarusidestrconsts:liscompilererrorinvalidcompiler +msgid "Error: invalid compiler: %s" +msgstr "" + +#: lazarusidestrconsts:liserrors +msgid "Errors" +msgstr "Fouten" + +#: lazarusidestrconsts:srvk_escape +msgid "Escape" +msgstr "Verlaat" + +#: lazarusidestrconsts:lismenuevaluate +msgid "Evaluate/Modify ..." +msgstr "Evalueer/Verander" + +#: lazarusidestrconsts:srvk_execute +msgid "Execute" +msgstr "Uitvoeren" + +#: lazarusidestrconsts:liscoexecuteafter +msgid "Execute after" +msgstr "Voer uit Na" + +#: lazarusidestrconsts:liscoexecutebefore +msgid "Execute before" +msgstr "Voer uit Voor" + +#: lazarusidestrconsts:lisexecutingcommandafter +msgid "Executing command after" +msgstr "Voer het commando uit Na" + +#: lazarusidestrconsts:lisexecutingcommandbefore +msgid "Executing command befor" +msgstr "Voer het commando uit Voor" + +#: lazarusidestrconsts:lisexecutionpaused +msgid "Execution paused" +msgstr "Uitvoering gepauzeerd" + +#: lazarusidestrconsts:lisexecutionpausedadress +msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" +msgstr "uitvoering gepauzeerd%s Adres: $%s%s Procedure: %s%s Bestand: %s%s(Hier komt t.z.t. een assembler window)%s" + +#: lazarusidestrconsts:lisexecutionstopped +msgid "Execution stopped" +msgstr "Uitvoering afgebroken" + +#: lazarusidestrconsts:lisexecutionstoppedon +msgid "Execution stopped%s" +msgstr "Uitvoering afgebroken%s" + +#: lazarusidestrconsts:liscodetoolsdefsexit +msgid "Exit" +msgstr "Verlaat" + +#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave +msgid "Exit without Save" +msgstr "Verlaat zonder Opslaan" + +#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor +msgid "Expanded filename of current editor file" +msgstr "Volledige bestandsnaam van huidige editor bestand" + +#: lazarusidestrconsts:lisexportlist +msgid "Export list" +msgstr "Export lijst" + +#: lazarusidestrconsts:lisexttoolexternaltools +msgid "External Tools" +msgstr "Externe hulpmiddelen" + +#: lazarusidestrconsts:srkmecexttool +msgid "External tool %d" +msgstr "" + +#: lazarusidestrconsts:srkmecexttoolsettings +msgid "External tools settings" +msgstr "Externe hulpmiddelen instellingen" + +#: lazarusidestrconsts:dlgextralinespacing +msgid "Extra line spacing" +msgstr "" + +#: lazarusidestrconsts:lisextract +msgid "Extract" +msgstr "" + +#: lazarusidestrconsts:uemextractproc +msgid "Extract Procedure" +msgstr "" + +#: lazarusidestrconsts:lismenuextractproc +msgid "Extract procedure" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsfpccvssourcedirectory +msgid "FPC CVS source directory" +msgstr "FPC CVS broncode directory" + +#: lazarusidestrconsts:lisfpcsourcedirectoryerror +msgid "FPC Source Directory error" +msgstr "FPC directory fout" + +#: lazarusidestrconsts:dlgfpcsrcpath +msgid "FPC source directory" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg +msgid "FPC source directory \"%s\" not found." +msgstr "FPC directory \"%s\" niet gevonden." + +#: lazarusidestrconsts:lisexttoolfailedtoruntool +msgid "Failed to run tool" +msgstr "" + +#: lazarusidestrconsts:dlgcofast +msgid "Faster Code" +msgstr "Snellere Code" + +#: lazarusidestrconsts:listodolfile +msgid "File" +msgstr "Bestand" + +#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject +msgid "File %s%s%s already exists in the project." +msgstr "Bestand %s%s%s bestaat reeds in het project" + +#: lazarusidestrconsts:lisfilehaschangedsave +msgid "File %s%s%s has changed. Save?" +msgstr "Bestand %s%s%s is veranderd. Opslaan?" + +#: lazarusidestrconsts:lisfileisvirtual +msgid "File %s%s%s is virtual." +msgstr "Bestand %s%s%s is Virtual" + +#: lazarusidestrconsts:lispkgmangfilenotfound +msgid "File %s%s%s not found." +msgstr "Bestand %s%s%s niet gevonden" + +#: lazarusidestrconsts:lisfilenotfound2 +msgid "File %s%s%s not found.%s" +msgstr "Bestand %s%s%s niet gevonden.%s" + +#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit +msgid "File %s%s%s not found.%sDo you want to create it?%s" +msgstr "Bestand %s%s%s niet gevonden.%sWilt u het bestand maken?%s" + +#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway +msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" +msgstr "Bestand %s%s%s%slijkt niet op een tekst bestand.%sToch openen?" + +#: lazarusidestrconsts:lispckeditfileproperties +msgid "File Properties" +msgstr "" + +#: lazarusidestrconsts:lisaf2pfiletype +msgid "File Type" +msgstr "" + +#: lazarusidestrconsts:lisa2pfilealreadyexists +msgid "File already exists" +msgstr "Bestand bestaat reeds" + +#: lazarusidestrconsts:lisa2pfilealreadyinpackage +msgid "File already in package" +msgstr "" + +#: lazarusidestrconsts:dlgfileexts +msgid "File extensions:" +msgstr "Bestand extensies:" + +#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage +msgid "File is already in package" +msgstr "" + +#: lazarusidestrconsts:lispkgmangfileisinproject +msgid "File is in Project" +msgstr "" + +#: lazarusidestrconsts:lisfileisnotwritable +msgid "File is not writable" +msgstr "Bestand is niet schrijfbaar" + +#: lazarusidestrconsts:uefilerocap +msgid "File is readonly" +msgstr "" + +#: lazarusidestrconsts:lisa2pfileisused +msgid "File is used" +msgstr "Bestand wordt gebruikt" + +#: lazarusidestrconsts:lisfindfilefilemaskbak +msgid "File mask (*;*.*;*.bak?)" +msgstr "" + +#: lazarusidestrconsts:srkmcatfilemenu +msgid "File menu commands" +msgstr "" + +#: lazarusidestrconsts:lisa2pfilename +msgid "File name:" +msgstr "" + +#: lazarusidestrconsts:lisrunparamsfilenotexecutable +msgid "File not executable" +msgstr "Bestand niet uitvoerbaar" + +#: lazarusidestrconsts:lisfilenotfound +msgid "File not found" +msgstr "Bestand niet gevonden" + +#: lazarusidestrconsts:lisfilenotlowercase +msgid "File not lowercase" +msgstr "Bestand niet met kleine letters" + +#: lazarusidestrconsts:lispkgmangfilenotsaved +msgid "File not saved" +msgstr "Bestand niet bewaard" + +#: lazarusidestrconsts:lisfilenottext +msgid "File not text" +msgstr "Bestand is geen tekst" + +#: lazarusidestrconsts:lisa2pfilenotunit +msgid "File not unit" +msgstr "Bestand is geen unit" + +#: lazarusidestrconsts:lisa2pfilename2 +msgid "Filename" +msgstr "Bestandsnaam" + +#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename +msgid "Filename differs from Packagename" +msgstr "Bestandsnaam verschilt van packagenaam" + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage +msgid "Filename is used by other package" +msgstr "" + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject +msgid "Filename is used by project" +msgstr "Bestand in gebruik door project" + +#: lazarusidestrconsts:lisoipfilename +msgid "Filename: %s" +msgstr "Bestandsnaam: %s" + +#: lazarusidestrconsts:dlgenvfiles +msgid "Files" +msgstr "Bestanden" + +#: lazarusidestrconsts:srvk_final +msgid "Final" +msgstr "" + +#: lazarusidestrconsts:lismenufind +msgid "Find" +msgstr "Zoeken" + +#: lazarusidestrconsts:lismenufindnext +msgid "Find &Next" +msgstr "Zoek &Volgende" + +#: lazarusidestrconsts:lismenufindprevious +msgid "Find &Previous" +msgstr "Zoek V&orige" + +#: lazarusidestrconsts:lismenufindinfiles +msgid "Find &in files" +msgstr "Zoek in &Bestanden" + +#: lazarusidestrconsts:lismenufinddeclarationatcursor +msgid "Find Declaration at cursor" +msgstr "Zoek Declaraties (op cursor)" + +#: lazarusidestrconsts:lismenufindidentifierrefs +msgid "Find Identifier References" +msgstr "Zoek Identifier Referenties" + +#: lazarusidestrconsts:lismenutemplatefindnext +msgid "Find Next" +msgstr "Zoek Volgende" + +#: lazarusidestrconsts:lisfrifindreferences +msgid "Find References" +msgstr "" + +#: lazarusidestrconsts:srkmecfindblockotherend +msgid "Find block other end" +msgstr "Zoek blok Einde" + +#: lazarusidestrconsts:srkmecfindblockstart +msgid "Find block start" +msgstr "Zoek blok Start" + +#: lazarusidestrconsts:lismenufindcodeblockstart +msgid "Find code block start" +msgstr "Spring naar begin code blok " + +#: lazarusidestrconsts:srkmecfinddeclaration +msgid "Find declaration" +msgstr "Zoek Declaratie" + +#: lazarusidestrconsts:srkmecfindidentifierrefs +msgid "Find identifier references" +msgstr "Vind identifier referenties" + +#: lazarusidestrconsts:srkmecfindinfiles +msgid "Find in files" +msgstr "Vind in bestanden" + +#: lazarusidestrconsts:srkmecfindnext +msgid "Find next" +msgstr "Vind volgende" + +#: lazarusidestrconsts:lisfrifindorrenameidentifier +msgid "Find or Rename Identifier" +msgstr "Vind of hernoem identifier" + +#: lazarusidestrconsts:lismenufindblockotherendofcodeblock +msgid "Find other end of code block" +msgstr "Spring naar eind code blok" + +#: lazarusidestrconsts:srkmecfindprevious +msgid "Find previous" +msgstr "Vind vorige" + +#: lazarusidestrconsts:srkmecfindproceduredefinition +msgid "Find procedure definiton" +msgstr "Vind procedure definitie" + +#: lazarusidestrconsts:srkmecfindproceduremethod +msgid "Find procedure method" +msgstr "Vind procedure methode" + +#: lazarusidestrconsts:srkmecfind +msgid "Find text" +msgstr "Zoek Tekst" + +#: lazarusidestrconsts:dlgfindtextatcursor +msgid "Find text at cursor" +msgstr "Zoek Tekst (op cursor)" + +#: lazarusidestrconsts:rslanguagefinnish +msgid "Finnish" +msgstr "" + +#: lazarusidestrconsts:rslanguagefinnishwin +msgid "Finnish for MS Windows" +msgstr "" + +#: lazarusidestrconsts:lisfixlfmfile +msgid "Fix LFM file" +msgstr "Repareer .lfm bestand" + +#: lazarusidestrconsts:srkmecjumptoeditor +msgid "Focus to source editor" +msgstr "Focus naar Broncode Editor" + +#: lazarusidestrconsts:dlgforecolor +msgid "Foreground color" +msgstr "Voorgrond kleur" + +#: lazarusidestrconsts:dlgfrmeditor +msgid "Form Editor" +msgstr "" + +#: lazarusidestrconsts:lisformloaderror +msgid "Form load error" +msgstr "Fout bij laden Form" + +#: lazarusidestrconsts:lisformaterror +msgid "Format error" +msgstr "Format fout" + +#: lazarusidestrconsts:dlgpofroms +msgid "Forms" +msgstr "" + +#: lazarusidestrconsts:lismenuviewforms +msgid "Forms..." +msgstr "Forms..." + +#: lazarusidestrconsts:lisfrforwardsearch +msgid "Forward search" +msgstr "Zoek voorwaarts" + +#: lazarusidestrconsts:lisfreepascalcompilernotfound +msgid "Free Pascal Compiler not found" +msgstr "FP compiler niet gevonden" + +#: lazarusidestrconsts:lisfreepascalsourcesnotfound +msgid "Free Pascal Sources not found" +msgstr "FP bronnen niet gevonden" + +#: lazarusidestrconsts:lisfreepascalsourcedirectory +msgid "Freepascal source directory" +msgstr "FreePascal bronnen directory" + +#: lazarusidestrconsts:rslanguagefrench +msgid "French" +msgstr "" + +#: lazarusidestrconsts:dlgfromcursor +msgid "From Cursor" +msgstr "" + +#: lazarusidestrconsts:listmfunctionappendpathdelimiter +msgid "Function: append path delimiter" +msgstr "" + +#: lazarusidestrconsts:listmfunctionchomppathdelimiter +msgid "Function: chomp path delimiter" +msgstr "" + +#: lazarusidestrconsts:listmfunctionextractfileextension +msgid "Function: extract file extension" +msgstr "" + +#: lazarusidestrconsts:listmfunctionextractfilenameonly +msgid "Function: extract file name only" +msgstr "" + +#: lazarusidestrconsts:listmfunctionextractfilenameextension +msgid "Function: extract file name+extension" +msgstr "" + +#: lazarusidestrconsts:listmfunctionextractfilepath +msgid "Function: extract file path" +msgstr "" + +#: lazarusidestrconsts:dlggpccomp +msgid "GPC (GNU Pascal Compiler) Compatible" +msgstr "" + +#: lazarusidestrconsts:lismenuinsertgplnotice +msgid "GPL notice" +msgstr "" + +#: lazarusidestrconsts:lismenuinsertgeneral +msgid "General" +msgstr "Algemeen" + +#: lazarusidestrconsts:lispckeditgeneraloptions +msgid "General Options" +msgstr "Algemene Opties" + +#: lazarusidestrconsts:srkmecenvironmentoptions +msgid "General environment options" +msgstr "Algemene omgeving Opties" + +#: lazarusidestrconsts:dlgcodbx +msgid "Generate Debugging Info For DBX (Slows Compiling)" +msgstr "genereer Debugging info voor DBX (Compileert langzamer)" + +#: lazarusidestrconsts:dlgcogdb +msgid "Generate Debugging Info For GDB (Slows Compiling)" +msgstr "Genereer Debugging info voor GDB (Compileert langzamer)" + +#: lazarusidestrconsts:dlggprof +msgid "Generate code for gprof" +msgstr "Genereer code voor gprof" + +#: lazarusidestrconsts:dlgcovalgrind +msgid "Generate code for valgrind" +msgstr "" + +#: lazarusidestrconsts:dlgcogenerate +msgid "Generate:" +msgstr "Genereer:" + +#: lazarusidestrconsts:dlggetposition +msgid "Get position" +msgstr "positie" + +#: lazarusidestrconsts:dlgglobal +msgid "Global" +msgstr "Globaal" + +#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition +msgid "Global Source Path addition" +msgstr "" + +#: lazarusidestrconsts:srkmecgotomarker +msgid "Go to Marker %d" +msgstr "Ga naar Marker %d" + +#: lazarusidestrconsts:srkmecgotoeditor +msgid "Go to editor %d" +msgstr "" + +#: lazarusidestrconsts:srkmecgotolinenumber +msgid "Go to line number" +msgstr "Ga naar lijn nummer" + +#: lazarusidestrconsts:srkmecmatchbracket +msgid "Go to matching bracket" +msgstr "" + +#: lazarusidestrconsts:srkmecnexteditor +msgid "Go to next editor" +msgstr "" + +#: lazarusidestrconsts:srkmecpreveditor +msgid "Go to prior editor" +msgstr "" + +#: lazarusidestrconsts:srkmecgotoincludedirective +msgid "Go to to include directive of current include file" +msgstr "" + +#: lazarusidestrconsts:srkmecgotoxy +msgid "Goto XY" +msgstr "" + +#: lazarusidestrconsts:lismenugotoincludedirective +msgid "Goto include directive" +msgstr "Ga naar include directive" + +#: lazarusidestrconsts:lismenugotoline +msgid "Goto line" +msgstr "Ga naar lijn" + +#: lazarusidestrconsts:lisuegotoline +msgid "Goto line :" +msgstr "" + +#: lazarusidestrconsts:listodolistgotoline +msgid "Goto selected source line" +msgstr "" + +#: lazarusidestrconsts:srkmgrabkey +msgid "Grab Key" +msgstr "" + +#: lazarusidestrconsts:dlggrabbercolor +msgid "Grabber color" +msgstr "" + +#: lazarusidestrconsts:dlgenvgrid +msgid "Grid" +msgstr "" + +#: lazarusidestrconsts:dlggridcolor +msgid "Grid color" +msgstr "" + +#: lazarusidestrconsts:dlggridx +msgid "Grid size X" +msgstr "" + +#: lazarusidestrconsts:dlggridy +msgid "Grid size Y" +msgstr "" + +#: lazarusidestrconsts:srkmecguessmisplacedifdef +msgid "Guess misplaced $IFDEF" +msgstr "Corrigeer verkeerde $IFDEF" + +#: lazarusidestrconsts:lismenuguessmisplacedifdef +msgid "Guess misplaced IFDEF/ENDIF" +msgstr "Corrigeer verkeerde IFDEF/ENDIF" + +#: lazarusidestrconsts:lismenuguessunclosedblock +msgid "Guess unclosed block" +msgstr "Corrigeer open blok" + +#: lazarusidestrconsts:dlgenvlguidelines +msgid "Guide lines" +msgstr "Richtlijnen" + +#: lazarusidestrconsts:dlgguttercolor +msgid "Gutter color" +msgstr "" + +#: lazarusidestrconsts:dlggutterwidth +msgid "Gutter width" +msgstr "" + +#: lazarusidestrconsts:dlghalfpagescroll +msgid "Half page scroll" +msgstr "" + +#: lazarusidestrconsts:lismenueditorhandleonclickevent +msgid "Handle OnClick Event" +msgstr "" + +#: lazarusidestrconsts:srvk_hanja +msgid "Hanja" +msgstr "" + +#: lazarusidestrconsts:lisaf2phasregisterprocedure +msgid "Has Register procedure" +msgstr "" + +#: lazarusidestrconsts:lisheadercommentforclass +msgid "Header comment for class" +msgstr "" + +#: lazarusidestrconsts:dlgheapsize +msgid "Heap Size" +msgstr "" + +#: lazarusidestrconsts:rslanguagehebrew +msgid "Hebrew" +msgstr "" + +#: lazarusidestrconsts:dlgheightpos +msgid "Height:" +msgstr "" + +#: lazarusidestrconsts:srvk_help +msgid "Help" +msgstr "" + +#: lazarusidestrconsts:lishelpcontextnotfound +msgid "Help Context not found" +msgstr "" + +#: lazarusidestrconsts:lishelpdatabasenotfound +msgid "Help Database not found" +msgstr "" + +#: lazarusidestrconsts:lishlpoptshelpoptions +msgid "Help Options" +msgstr "Help Opties" + +#: lazarusidestrconsts:lishelpselectorerror +msgid "Help Selector Error" +msgstr "" + +#: lazarusidestrconsts:lishelpviewererror +msgid "Help Viewer Error" +msgstr "" + +#: lazarusidestrconsts:lishelpviewernotfound +msgid "Help Viewer not found" +msgstr "" + +#: lazarusidestrconsts:srkmcarhelpmenu +msgid "Help menu commands" +msgstr "" + +#: lazarusidestrconsts:lishelpnotfound +msgid "Help not found" +msgstr "Help niet gevonden" + +#: lazarusidestrconsts:dlghideideonrun +msgid "Hide IDE windows on run" +msgstr "" + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 +msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." +msgstr "" + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon +msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." +msgstr "" + +#: lazarusidestrconsts:dlgedhintcommand +msgid "Hint: click on the command you want to edit" +msgstr "" + +#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath +msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" +msgstr "" + +#: lazarusidestrconsts:dlgpalhints +msgid "Hints for component palette" +msgstr "" + +#: lazarusidestrconsts:dlgspbhints +msgid "Hints for main speed buttons (open, save, ...)" +msgstr "" + +#: lazarusidestrconsts:srvk_home +msgid "Home" +msgstr "" + +#: lazarusidestrconsts:dlghomekeyjumpstoneareststart +msgid "Home key jumps to nearest start" +msgstr "" + +#: lazarusidestrconsts:lishorizontal +msgid "Horizontal" +msgstr "" + +#: lazarusidestrconsts:dlggridxhint +msgid "Horizontal grid step size" +msgstr "" + +#: lazarusidestrconsts:dlghostapplication +msgid "Host application" +msgstr "" + +#: lazarusidestrconsts:uenotimplcapagain +msgid "I told You: Not implemented yet" +msgstr "Nog niet geimplementeerd (Yoda rant)" + +#: lazarusidestrconsts:lispckoptsideintegration +msgid "IDE Integration" +msgstr "IDE Integratie" + +#: lazarusidestrconsts:lisideoptions +msgid "IDE Options:" +msgstr "" + +#: lazarusidestrconsts:uepins +msgid "INS" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptsidentifier +msgid "Identifier" +msgstr "" + +#: lazarusidestrconsts:lismakeresstridentifierlength +msgid "Identifier Length:" +msgstr "" + +#: lazarusidestrconsts:lismakeresstridentifierprefix +msgid "Identifier Prefix:" +msgstr "" + +#: lazarusidestrconsts:dlgedidcomlet +msgid "Identifier completion" +msgstr "" + +#: lazarusidestrconsts:dlgidentifierpolicy +msgid "Identifier policy" +msgstr "" + +#: lazarusidestrconsts:lisfriidentifier +msgid "Identifier: %s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsif +msgid "If" +msgstr "" + +#: lazarusidestrconsts:uenotimpltext +msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" +msgstr "Als u deze feature kunt implementeren, mail naar lazarus@miraclec.com" + +#: lazarusidestrconsts:liscodetoolsdefsifdef +msgid "IfDef" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsifndef +msgid "IfNDef" +msgstr "" + +#: lazarusidestrconsts:dlgignoreverb +msgid "Ignore" +msgstr "Negeren" + +#: lazarusidestrconsts:lissortselignorespace +msgid "Ignore Space" +msgstr "Negeer Space" + +#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd +msgid "Ignore amount of space chars" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe +msgid "Ignore difference in line ends (e.g. #10 = #13#10)" +msgstr "" + +#: lazarusidestrconsts:lisdiskdiffignorediskchanges +msgid "Ignore disk changes" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd +msgid "Ignore if empty lines were added or removed" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgignorespaces +msgid "Ignore spaces (newline chars not included)" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline +msgid "Ignore spaces at end of line" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline +msgid "Ignore spaces at start of line" +msgstr "" + +#: lazarusidestrconsts:srkmecimestr +msgid "Ime Str" +msgstr "" + +#: lazarusidestrconsts:lisimportlist +msgid "Import list" +msgstr "" + +#: lazarusidestrconsts:dlginfrontofmethods +msgid "In front of methods" +msgstr "" + +#: lazarusidestrconsts:lispckoptsinclude +msgid "Include" +msgstr "" + +#: lazarusidestrconsts:dlgassertcode +msgid "Include Assertion Code" +msgstr "" + +#: lazarusidestrconsts:dlgcoincfiles +msgid "Include Files (-Fi):" +msgstr "" + +#: lazarusidestrconsts:lispkgfiletypeinclude +msgid "Include file" +msgstr "" + +#: lazarusidestrconsts:lisfindfileincludesubdirectories +msgid "Include sub directories" +msgstr "" + +#: lazarusidestrconsts:dlgincludesystemvariables +msgid "Include system variables" +msgstr "" + +#: lazarusidestrconsts:lisuidincludedby +msgid "Included by:" +msgstr "" + +#: lazarusidestrconsts:lismenuincrementalfind +msgid "Incremental Find" +msgstr "Incrementeel Zoeken" + +#: lazarusidestrconsts:srkmecblockindent +msgid "Indent block" +msgstr "Blok Inspringen" + +#: lazarusidestrconsts:dlgindentcodeto +msgid "Indent code to" +msgstr "Laat code Inspringen tot" + +#: lazarusidestrconsts:lismenuindentselection +msgid "Indent selection" +msgstr "Selectie Inspringen" + +#: lazarusidestrconsts:lisinformationaboutunit +msgid "Information about %s" +msgstr "Informatie over %s" + +#: lazarusidestrconsts:dlgcoinherited +msgid "Inherited" +msgstr "" + +#: lazarusidestrconsts:srvk_insert +msgid "Insert" +msgstr "Invoegen" + +#: lazarusidestrconsts:lismenuconditionalselection +msgid "Insert $IFDEF..." +msgstr "$IFDEF Invoegen" + +#: lazarusidestrconsts:srkmecinsertcvsauthor +msgid "Insert CVS keyword Author" +msgstr "Invoegen CVS Keyword Auteur" + +#: lazarusidestrconsts:srkmecinsertcvsdate +msgid "Insert CVS keyword Date" +msgstr "Invoegen CVS keyword Datum" + +#: lazarusidestrconsts:srkmecinsertcvsheader +msgid "Insert CVS keyword Header" +msgstr "Invoegen CVS keyword Header" + +#: lazarusidestrconsts:srkmecinsertcvsid +msgid "Insert CVS keyword ID" +msgstr "Invoegen CVS keyword ID" + +#: lazarusidestrconsts:srkmecinsertcvslog +msgid "Insert CVS keyword Log" +msgstr "Invoegen CVS keyword Log" + +#: lazarusidestrconsts:srkmecinsertcvsname +msgid "Insert CVS keyword Name" +msgstr "Invoegen CVS keyword Naam" + +#: lazarusidestrconsts:srkmecinsertcvsrevision +msgid "Insert CVS keyword Revision" +msgstr "Invoegen CVS keyword Revisie" + +#: lazarusidestrconsts:srkmecinsertcvssource +msgid "Insert CVS keyword Source" +msgstr "Invoegen CVS keyword Broncode" + +#: lazarusidestrconsts:srkmecinsertchangelogentry +msgid "Insert ChangeLog entry" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp +msgid "Insert Delphi 5 Compiler Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem +msgid "Insert Delphi 5 Directory Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl +msgid "Insert Delphi 5 Project Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp +msgid "Insert Delphi 6 Compiler Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem +msgid "Insert Delphi 6 Directory Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl +msgid "Insert Delphi 6 Project Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp +msgid "Insert Delphi 7 Compiler Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem +msgid "Insert Delphi 7 Directory Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl +msgid "Insert Delphi 7 Project Template" +msgstr "Invoegen Delphi 7 Project Template" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcvssource +msgid "Insert Free Pascal CVS Source Template" +msgstr "Invoegen FP CVS Broncode template" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert +msgid "Insert Free Pascal Compiler Template" +msgstr "Invoegen FP Compiler Template" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte +msgid "Insert Free Pascal Project Template" +msgstr "Invoegen FP project Template" + +#: lazarusidestrconsts:lismenueditorinsertfromtemplate +msgid "Insert From Template..." +msgstr "Invoegen van Template ..." + +#: lazarusidestrconsts:srkmecinsertgplnotice +msgid "Insert GPL notice" +msgstr "Invoegen GPL notice" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp +msgid "Insert Kylix 3 Compiler Template" +msgstr "Invoegen Kylic 3 Compiler template" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem +msgid "Insert Kylix 3 Directory Template" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl +msgid "Insert Kylix 3 Project Template" +msgstr "" + +#: lazarusidestrconsts:srkmecinsertlgplnotice +msgid "Insert LGPL notice" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem +msgid "Insert Lazarus Directory Template" +msgstr "" + +#: lazarusidestrconsts:srkmecinsertmode +msgid "Insert Mode" +msgstr "" + +#: lazarusidestrconsts:lismenueditorinsertnewitemafter +msgid "Insert New Item (after)" +msgstr "" + +#: lazarusidestrconsts:lismenueditorinsertnewitembefore +msgid "Insert New Item (before)" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinserttemplate +msgid "Insert Template" +msgstr "Invoegen Template" + +#: lazarusidestrconsts:lismakeresstrinsertalphabetically +msgid "Insert alphabetically" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive +msgid "Insert context sensitive" +msgstr "" + +#: lazarusidestrconsts:srkmecinsertdatetime +msgid "Insert current date and time" +msgstr "" + +#: lazarusidestrconsts:srkmecinsertusername +msgid "Insert current username" +msgstr "" + +#: lazarusidestrconsts:lismenuinsertcharacter +msgid "Insert from Character Map" +msgstr "Invoegen van Karakter Map" + +#: lazarusidestrconsts:srkmecinsertcharacter +msgid "Insert from Charactermap" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild +msgid "Insert node as child" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow +msgid "Insert node below" +msgstr "" + +#: lazarusidestrconsts:dlginsspaceafter +msgid "Insert space after" +msgstr "" + +#: lazarusidestrconsts:dlginsspacefront +msgid "Insert space in front of" +msgstr "" + +#: lazarusidestrconsts:lismenuinserttext +msgid "Insert text" +msgstr "Invoegen Tekst" + +#: lazarusidestrconsts:lismenuinspect +msgid "Inspect ..." +msgstr "Inspecteer" + +#: lazarusidestrconsts:lispckeditinstall +msgid "Install" +msgstr "Installeren" + +#: lazarusidestrconsts:lispckexplinstallonnextstart +msgid "Install on next start" +msgstr "Installeer bij volgende start" + +#: lazarusidestrconsts:lispckeditinstallpackageintheide +msgid "Install package in the IDE" +msgstr "" + +#: lazarusidestrconsts:lisinstallselection +msgid "Install selection" +msgstr "Installeer selectie" + +#: lazarusidestrconsts:lispckexplinstalled +msgid "Installed" +msgstr "Geinstalleerd." + +#: lazarusidestrconsts:lisinstalledpackages +msgid "Installed Packages" +msgstr "Geinstalleerde packages" + +#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstall +msgid "Installing the package %s will automatically install the package(s):%s%s" +msgstr "" + +#: lazarusidestrconsts:dlgintvinsec +msgid "Interval in secs" +msgstr "" + +#: lazarusidestrconsts:lisa2pinvalidancestortype +msgid "Invalid Ancestor Type" +msgstr "Ongeldige Ancestor Type" + +#: lazarusidestrconsts:lisa2pinvalidcircle +msgid "Invalid Circle" +msgstr "" + +#: lazarusidestrconsts:lisa2pinvalidclassname +msgid "Invalid Class Name" +msgstr "Ongeldige Class naam" + +#: lazarusidestrconsts:lisinvalidcompilerfilename +msgid "Invalid Compiler Filename" +msgstr "" + +#: lazarusidestrconsts:lispublprojinvalidexcludefilter +msgid "Invalid Exclude filter" +msgstr "" + +#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory +msgid "Invalid Free Pascal source directory" +msgstr "" + +#: lazarusidestrconsts:lisfriinvalididentifier +msgid "Invalid Identifier" +msgstr "" + +#: lazarusidestrconsts:lispublprojinvalidincludefilter +msgid "Invalid Include filter" +msgstr "" + +#: lazarusidestrconsts:lisprojaddinvalidminmaxversion +msgid "Invalid Min-Max version" +msgstr "" + +#: lazarusidestrconsts:lisaf2pinvalidpackage +msgid "Invalid Package" +msgstr "" + +#: lazarusidestrconsts:lispkgmanginvalidpackagename2 +msgid "Invalid Package Name" +msgstr "" + +#: lazarusidestrconsts:lisinvalidpascalidentifiercap +msgid "Invalid Pascal Identifier" +msgstr "Ungueltiger Pascal Identifier" + +#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect +msgid "Invalid Resourcestring section" +msgstr "" + +#: lazarusidestrconsts:lisa2pinvalidunitname +msgid "Invalid Unit Name" +msgstr "Ongeldige unit naam" + +#: lazarusidestrconsts:lispkgsysinvalidunitname +msgid "Invalid Unitname: %s" +msgstr "Ogeldige unit naam: %s" + +#: lazarusidestrconsts:lisinvalidcommand +msgid "Invalid command" +msgstr "Ongeldig commando" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename +msgid "Invalid compiler filename" +msgstr "" + +#: lazarusidestrconsts:lispkgsysinvalidcomponentclass +msgid "Invalid component class" +msgstr "Ongeldige component Class" + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename +msgid "Invalid debugger filename" +msgstr "Ongeldige debugger bestandsnaam" + +#: lazarusidestrconsts:lisinvaliddelete +msgid "Invalid delete" +msgstr "Ongeldige verwijdering" + +#: lazarusidestrconsts:lisinvaliddestinationdirectory +msgid "Invalid destination directory" +msgstr "Ongeldige destinatie directory" + +#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction +msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." +msgstr "" + +#: lazarusidestrconsts:lisa2pinvalidfile +msgid "Invalid file" +msgstr "Ongeldig bestand" + +#: lazarusidestrconsts:lispkgmanginvalidfileextension +msgid "Invalid file extension" +msgstr "Ongeldige bestands extensie" + +#: lazarusidestrconsts:lisa2pinvalidfilename +msgid "Invalid filename" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename +msgid "Invalid make filename" +msgstr "Ongeldige Maak bestandsnaam" + +#: lazarusidestrconsts:lispckeditinvalidmaximumversion +msgid "Invalid maximum version" +msgstr "" + +#: lazarusidestrconsts:lispckeditinvalidminimumversion +msgid "Invalid minimum version" +msgstr "" + +#: lazarusidestrconsts:lisinvalidmultiselection +msgid "Invalid multiselection" +msgstr "" + +#: lazarusidestrconsts:fdinvalidmutliselectioncap +msgid "Invalid mutliselection" +msgstr "" + +#: lazarusidestrconsts:lisaf2pinvalidpackageid +msgid "Invalid package ID: %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension +msgid "Invalid package file extension" +msgstr "" + +#: lazarusidestrconsts:lispkgmanginvalidpackagefilename +msgid "Invalid package filename" +msgstr "" + +#: lazarusidestrconsts:lispkgmanginvalidpackagename +msgid "Invalid package name" +msgstr "" + +#: lazarusidestrconsts:lispckoptsinvalidpackagetype +msgid "Invalid package type" +msgstr "" + +#: lazarusidestrconsts:lisprojaddinvalidpackagename +msgid "Invalid packagename" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparent +msgid "Invalid parent" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode +msgid "Invalid parent node" +msgstr "" + +#: lazarusidestrconsts:lisprojaddinvalidpascalunitname +msgid "Invalid pascal unit name" +msgstr "Ongeldige Pascal unit naam" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode +msgid "Invalid previous node" +msgstr "" + +#: lazarusidestrconsts:lisinvalidprocname +msgid "Invalid proc name" +msgstr "" + +#: lazarusidestrconsts:lisinvalidprojectfilename +msgid "Invalid project filename" +msgstr "Ongeldige project bestandsnaam" + +#: lazarusidestrconsts:lisinvalidselection +msgid "Invalid selection" +msgstr "" + +#: lazarusidestrconsts:lissvuoinvalidvariablename +msgid "Invalid variable name" +msgstr "" + +#: lazarusidestrconsts:lisprojaddinvalidversion +msgid "Invalid version" +msgstr "" + +#: lazarusidestrconsts:ueminvertassignment +msgid "Invert Assignment" +msgstr "" + +#: lazarusidestrconsts:srkmecinvertassignment +msgid "Invert assignment" +msgstr "" + +#: lazarusidestrconsts:srvk_irregular +msgid "Irregular " +msgstr "" + +#: lazarusidestrconsts:rslanguageitalian +msgid "Italian" +msgstr "" + +#: lazarusidestrconsts:rslanguageitalianiso +msgid "Italian(ISO 8859-1)" +msgstr "" + +#: lazarusidestrconsts:dlgedital +msgid "Italic" +msgstr "Italic" + +#: lazarusidestrconsts:dlgoiitemheight +msgid "Item height" +msgstr "" + +#: lazarusidestrconsts:lismenujumpback +msgid "Jump back" +msgstr "Spring terug" + +#: lazarusidestrconsts:lismenujumpforward +msgid "Jump forward" +msgstr "Spring voorwaarts" + +#: lazarusidestrconsts:lismenujumptonexterror +msgid "Jump to next error" +msgstr "Spring naar volgende fout" + +#: lazarusidestrconsts:lismenujumptopreverror +msgid "Jump to previous error" +msgstr "Spring naar vorige fout" + +#: lazarusidestrconsts:dlgjumpingetc +msgid "Jumping (e.g. Method Jumping)" +msgstr "Springen ('Method Jumping')" + +#: lazarusidestrconsts:srvk_junja +msgid "Junja" +msgstr "" + +#: lazarusidestrconsts:srvk_kana +msgid "Kana" +msgstr "" + +#: lazarusidestrconsts:dlgkeepcaretx +msgid "Keep X caret" +msgstr "" + +#: lazarusidestrconsts:liscldirkeepalltextfiles +msgid "Keep all text files" +msgstr "ehoud alle Tekst bestanden" + +#: lazarusidestrconsts:dlgcokeepvarsreg +msgid "Keep certain variables in registers" +msgstr "" + +#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter +msgid "Keep files matching filter" +msgstr "" + +#: lazarusidestrconsts:dlgforwardprocskeeporder +msgid "Keep order of procedures" +msgstr "" + +#: lazarusidestrconsts:srkmkey +msgid "Key" +msgstr "Toets" + +#: lazarusidestrconsts:dlgkeymappingscheme +msgid "Key Mapping Scheme" +msgstr "" + +#: lazarusidestrconsts:dlgkeymapping +msgid "Key Mappings" +msgstr "" + +#: lazarusidestrconsts:dlgkeymappingerrors +msgid "Key mapping errors" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptskeyword +msgid "Keyword" +msgstr "" + +#: lazarusidestrconsts:dlgkeywordpolicy +msgid "Keyword policy" +msgstr "" + +#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions +msgid "LCL Interface specific options:" +msgstr "" + +#: lazarusidestrconsts:lislclwidgettype +msgid "LCL Widget Type" +msgstr "LCL Widget Art" + +#: lazarusidestrconsts:lislazbuildlclinterface +msgid "LCL interface" +msgstr "" + +#: lazarusidestrconsts:lislclunitpathmissing +msgid "LCL unit path missing" +msgstr "" + +#: lazarusidestrconsts:lispkgfiletypelfm +msgid "LFM - Lazarus form text" +msgstr "" + +#: lazarusidestrconsts:lislfmfile +msgid "LFM file" +msgstr "" + +#: lazarusidestrconsts:lislfmfilecorrupt +msgid "LFM file corrupt" +msgstr "" + +#: lazarusidestrconsts:lislfmfilenotfound +msgid "LFM file not found" +msgstr "" + +#: lazarusidestrconsts:lismenuinsertlgplnotice +msgid "LGPL notice" +msgstr "" + +#: lazarusidestrconsts:lispkgfiletypelrs +msgid "LRS - Lazarus resource" +msgstr "" + +#: lazarusidestrconsts:dlgenvlanguage +msgid "Language" +msgstr "Taal" + +#: lazarusidestrconsts:dlglang +msgid "Language:" +msgstr "Taal:" + +#: lazarusidestrconsts:dlgcdtlast +msgid "Last" +msgstr "Laatste" + +#: lazarusidestrconsts:dlglast +msgid "Last (i.e. at end of source)" +msgstr "Laatste (einde broncode)" + +#: lazarusidestrconsts:lislaunchingapplicationinvalid +msgid "Launching application invalid" +msgstr "Starten applicatie is ongeldig" + +#: lazarusidestrconsts:lislaunchingcmdline +msgid "Launching target command line" +msgstr "starten v. command line" + +#: lazarusidestrconsts:lispkgmanglazarus +msgid "Lazarus" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory +msgid "Lazarus Directory" +msgstr "" + +#: lazarusidestrconsts:lislazaruseditorv +msgid "Lazarus Editor v%s" +msgstr "" + +#: lazarusidestrconsts:locwndsrceditor +msgid "Lazarus Source Editor" +msgstr "Lazarus Broncode Editor" + +#: lazarusidestrconsts:lisconfigdirectory +msgid "Lazarus config directory" +msgstr "" + +#: lazarusidestrconsts:lislazarusdirectory +msgid "Lazarus directory" +msgstr "Lazarus Verzeichnis" + +#: lazarusidestrconsts:dlglazarusdir +msgid "Lazarus directory (default for all projects)" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg +msgid "Lazarus directory \"%s\" not found." +msgstr "" + +#: lazarusidestrconsts:lislazarusdirectorynotfound +msgid "Lazarus directory not found" +msgstr "Lazarus directory niet gevonden." + +#: lazarusidestrconsts:lisleaveemptyfo +msgid "Leave empty for default .po file" +msgstr "" + +#: lazarusidestrconsts:srvk_left +msgid "Left" +msgstr "Links" + +#: lazarusidestrconsts:lisleftsides +msgid "Left sides" +msgstr "" + +#: lazarusidestrconsts:lisleftspaceequally +msgid "Left space equally" +msgstr "" + +#: lazarusidestrconsts:dlgleftpos +msgid "Left:" +msgstr "" + +#: lazarusidestrconsts:dlglevelnoneopt +msgid "Level 0 (no extra Optimizations)" +msgstr "Level 0 (geen extra optimalisaties)" + +#: lazarusidestrconsts:dlglevel1opt +msgid "Level 1 (Quick Optimizations)" +msgstr "Level 1(Snelle optimalisaties)" + +#: lazarusidestrconsts:dlglevel2opt +msgid "Level 2 (Level 1 + Slower Optimizations)" +msgstr "Level 2(Level 1 + Langzame optimalisaties)" + +#: lazarusidestrconsts:dlglevel3opt +msgid "Level 3 (Level 2 + Uncertain)" +msgstr "Level 3 (Level 2 + onzeker)" + +#: lazarusidestrconsts:dlgcolibraries +msgid "Libraries (-Fl):" +msgstr "" + +#: lazarusidestrconsts:lispckoptslibrary +msgid "Library" +msgstr "Bibliotheek" + +#: lazarusidestrconsts:lispckoptslicense +msgid "License:" +msgstr "" + +#: lazarusidestrconsts:lisaboutlazarusmsg +msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers." +msgstr "" + +#: lazarusidestrconsts:listodolline +msgid "Line" +msgstr "Lijn" + +#: lazarusidestrconsts:dlglinesplitting +msgid "Line Splitting" +msgstr "" + +#: lazarusidestrconsts:srkmeclineselect +msgid "Line selection mode" +msgstr "" + +#: lazarusidestrconsts:lissortsellines +msgid "Lines" +msgstr "" + +#: lazarusidestrconsts:dlglinksmart +msgid "Link Smart" +msgstr "" + +#: lazarusidestrconsts:dlglinklibraries +msgid "Link Style:" +msgstr "" + +#: lazarusidestrconsts:lispckoptslinker +msgid "Linker" +msgstr "" + +#: lazarusidestrconsts:dlgcolinking +msgid "Linking" +msgstr "" + +#: lazarusidestrconsts:dlgloaddfile +msgid "Load desktop settings from file" +msgstr "" + +#: lazarusidestrconsts:dlgcoloadsave +msgid "Load/Save" +msgstr "Laden/Bewaren" + +#: lazarusidestrconsts:lispckexplloadedpackages +msgid "Loaded Packages:" +msgstr "" + +#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage +msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" +msgstr "" + +#: lazarusidestrconsts:dlgrunolocal +msgid "Local" +msgstr "Lokaal" + +#: lazarusidestrconsts:lismenuviewlocalvariables +msgid "Local Variables" +msgstr "Lokale Variabelen" + +#: lazarusidestrconsts:lismenulowercaseselection +msgid "Lowercase selection" +msgstr "Verander selectie in kleine letters" + +#: lazarusidestrconsts:dlg1up2low +msgid "Lowercase, first letter up" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolmacros +msgid "Macros" +msgstr "" + +#: lazarusidestrconsts:dlgmainmenu +msgid "Main Menu" +msgstr "Algemeen menu" + +#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements +msgid "Main Unit has Application.CreateForm statements" +msgstr "" + +#: lazarusidestrconsts:lismainunithasapplicationtitlestatements +msgid "Main Unit has Application.Title statements" +msgstr "" + +#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject +msgid "Main Unit has Uses Section containing all Units of project" +msgstr "" + +#: lazarusidestrconsts:lismainunitispascalsource +msgid "Main Unit is Pascal Source" +msgstr "" + +#: lazarusidestrconsts:lispckoptsmajor +msgid "Major" +msgstr "" + +#: lazarusidestrconsts:lismakeexe +msgid "Make Executable" +msgstr "Maak Executable" + +#: lazarusidestrconsts:lismenumakeresourcestring +msgid "Make Resource String" +msgstr "Maak Resource string" + +#: lazarusidestrconsts:lismakeresourcestring +msgid "Make ResourceString" +msgstr "" + +#: lazarusidestrconsts:lismakenotfound +msgid "Make not found" +msgstr "" + +#: lazarusidestrconsts:dlgmakepath +msgid "Make path" +msgstr "" + +#: lazarusidestrconsts:srkmecmakeresourcestring +msgid "Make resource string" +msgstr "" + +#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically +msgid "Manual compilation (never automatically)" +msgstr "" + +#: lazarusidestrconsts:dlgmargingutter +msgid "Margin and gutter" +msgstr "" + +#: lazarusidestrconsts:dlgmarkercolor +msgid "Marker color" +msgstr "" + +#: lazarusidestrconsts:dlgmaxlinelength +msgid "Max line length:" +msgstr "" + +#: lazarusidestrconsts:dlgmaxrecentfiles +msgid "Max recent files" +msgstr "" + +#: lazarusidestrconsts:dlgmaxrecentprojs +msgid "Max recent project files" +msgstr "" + +#: lazarusidestrconsts:lisexttoolmaximumtoolsreached +msgid "Maximum Tools reached" +msgstr "Maximum aantal Hulpmiddelen bereikt" + +#: lazarusidestrconsts:lisprojaddmaximumversionoptional +msgid "Maximum Version (optional):" +msgstr "" + +#: lazarusidestrconsts:lispckeditmaximumversion +msgid "Maximum Version:" +msgstr "" + +#: lazarusidestrconsts:dlgmaxcntr +msgid "Maximum counter" +msgstr "" + +#: lazarusidestrconsts:srvk_menu +msgid "Menu" +msgstr "" + +#: lazarusidestrconsts:lismenueditormenueditor +msgid "Menu Editor" +msgstr "" + +#: lazarusidestrconsts:lismenuviewmessages +msgid "Messages" +msgstr "Berichten" + +#: lazarusidestrconsts:dlgmethodinspolicy +msgid "Method insert policy" +msgstr "" + +#: lazarusidestrconsts:dlgminimizeallonminimizemain +msgid "Minimize all on minimize main" +msgstr "" + +#: lazarusidestrconsts:lisprojaddminimumversionoptional +msgid "Minimum Version (optional):" +msgstr "" + +#: lazarusidestrconsts:lispckeditminimumversion +msgid "Minimum Version:" +msgstr "" + +#: lazarusidestrconsts:lispckoptsminor +msgid "Minor" +msgstr "" + +#: lazarusidestrconsts:fdmmirrorhorizontal +msgid "Mirror horizontal" +msgstr "" + +#: lazarusidestrconsts:fdmmirrorvertical +msgid "Mirror vertical" +msgstr "" + +#: lazarusidestrconsts:dlgenvmisc +msgid "Miscellaneous" +msgstr "" + +#: lazarusidestrconsts:lismissingpackages +msgid "Missing Packages" +msgstr "" + +#: lazarusidestrconsts:dlgmixmethodsandproperties +msgid "Mix methods and properties" +msgstr "" + +#: lazarusidestrconsts:srvk_modechange +msgid "Mode Change" +msgstr "" + +#: lazarusidestrconsts:uemodified +msgid "Modified" +msgstr "" + +#: lazarusidestrconsts:lispckeditmodified +msgid "Modified: %s" +msgstr "" + +#: lazarusidestrconsts:lispckeditmore +msgid "More ..." +msgstr "" + +#: lazarusidestrconsts:srvk_lbutton +msgid "Mouse Button Left" +msgstr "" + +#: lazarusidestrconsts:srvk_mbutton +msgid "Mouse Button Middle" +msgstr "" + +#: lazarusidestrconsts:srvk_rbutton +msgid "Mouse Button Right" +msgstr "" + +#: lazarusidestrconsts:dlgmouselinks +msgid "Mouse links" +msgstr "" + +#: lazarusidestrconsts:lisexttoolmovedown +msgid "Move Down" +msgstr "" + +#: lazarusidestrconsts:uemmoveeditorleft +msgid "Move Editor Left" +msgstr "" + +#: lazarusidestrconsts:uemmoveeditorright +msgid "Move Editor Right" +msgstr "" + +#: lazarusidestrconsts:lisexttoolmoveup +msgid "Move Up" +msgstr "" + +#: lazarusidestrconsts:lismenueditormoveup +msgid "Move Up(left)" +msgstr "" + +#: lazarusidestrconsts:lismenueditormovedown +msgid "Move Up(right)" +msgstr "" + +#: lazarusidestrconsts:srkmecpagedown +msgid "Move cursor down one page" +msgstr "" + +#: lazarusidestrconsts:srkmecpageleft +msgid "Move cursor left one page" +msgstr "" + +#: lazarusidestrconsts:srkmecpageright +msgid "Move cursor right one page" +msgstr "" + +#: lazarusidestrconsts:srkmeceditortop +msgid "Move cursor to absolute beginning" +msgstr "" + +#: lazarusidestrconsts:srkmeceditorbottom +msgid "Move cursor to absolute end" +msgstr "" + +#: lazarusidestrconsts:srkmecpagebottom +msgid "Move cursor to bottom of page" +msgstr "" + +#: lazarusidestrconsts:srkmeclineend +msgid "Move cursor to line end" +msgstr "" + +#: lazarusidestrconsts:srkmeclinestart +msgid "Move cursor to line start" +msgstr "" + +#: lazarusidestrconsts:srkmecpagetop +msgid "Move cursor to top of page" +msgstr "" + +#: lazarusidestrconsts:srkmecpageup +msgid "Move cursor up one page" +msgstr "" + +#: lazarusidestrconsts:srkmecwordleft +msgid "Move cursor word left" +msgstr "" + +#: lazarusidestrconsts:srkmecwordright +msgid "Move cursor word right" +msgstr "" + +#: lazarusidestrconsts:lispckeditmovedependencydown +msgid "Move dependency down" +msgstr "" + +#: lazarusidestrconsts:lispckeditmovedependencyup +msgid "Move dependency up" +msgstr "" + +#: lazarusidestrconsts:srkmecmoveeditorleft +msgid "Move editor left" +msgstr "" + +#: lazarusidestrconsts:srkmecmoveeditorright +msgid "Move editor right" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodedown +msgid "Move node down" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown +msgid "Move node one level down" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup +msgid "Move node one level up" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeup +msgid "Move node up" +msgstr "" + +#: lazarusidestrconsts:lispatheditmovepathdown +msgid "Move path down" +msgstr "" + +#: lazarusidestrconsts:lispatheditmovepathup +msgid "Move path up" +msgstr "" + +#: lazarusidestrconsts:dlgmulti +msgid "Multi" +msgstr "" + +#: lazarusidestrconsts:dlgmultiline +msgid "Multi Line" +msgstr "" + +#: lazarusidestrconsts:fdinvalidmutliselectiontext +msgid "Multiselected components must be of a single form." +msgstr "" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal +msgid "NOTE: Could not create Define Template for Free Pascal Sources" +msgstr "" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources +msgid "NOTE: Could not create Define Template for Lazarus Sources" +msgstr "" + +#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults +msgid "NOTE: codetools config file not found - using defaults" +msgstr "" + +#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile +msgid "NOTE: loading old codetools options file: " +msgstr "" + +#: lazarusidestrconsts:lisnameofnewprocedure +msgid "Name of new procedure" +msgstr "Naam van nieuwe procedure" + +#: lazarusidestrconsts:liscodetoolsdefsname +msgid "Name:" +msgstr "Naam:" + +#: lazarusidestrconsts:dlgnaming +msgid "Naming" +msgstr "" + +#: lazarusidestrconsts:srkmecnew +msgid "New" +msgstr "Nieuw" + +#: lazarusidestrconsts:lismenunewother +msgid "New ..." +msgstr "Nieuw ..." + +#: lazarusidestrconsts:lisa2pnewcomponent +msgid "New Component" +msgstr "Nieuw Component" + +#: lazarusidestrconsts:lismenunewform +msgid "New Form" +msgstr "Nieuwe Form" + +#: lazarusidestrconsts:lismenunewproject +msgid "New Project" +msgstr "Nieuw Project" + +#: lazarusidestrconsts:lismenunewprojectfromfile +msgid "New Project from file" +msgstr "Nieuw Project van bestand" + +#: lazarusidestrconsts:lisprojaddnewrequirement +msgid "New Requirement" +msgstr "" + +#: lazarusidestrconsts:lismenueditornewtemplatedescription +msgid "New Template Description..." +msgstr "Nieuw 'template' beschrijving ..." + +#: lazarusidestrconsts:lismenunewunit +msgid "New Unit" +msgstr "Nieuwe Unit" + +#: lazarusidestrconsts:lisa2pnewclassname +msgid "New class name:" +msgstr "Nieuwe Class naam:" + +#: lazarusidestrconsts:srkmecnewform +msgid "New form" +msgstr "Nieuwe Form" + +#: lazarusidestrconsts:srkmecnewunit +msgid "New unit" +msgstr "Nieuwe unit" + +#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath +msgid "New unit not in unitpath" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsnewnode +msgid "NewNode" +msgstr "" + +#: lazarusidestrconsts:lispkgmangnewpackage +msgid "NewPackage" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptsnewline +msgid "Newline" +msgstr "" + +#: lazarusidestrconsts:srvk_next +msgid "Next" +msgstr "" + +#: lazarusidestrconsts:lisnoresourcestringsectionfound +msgid "No ResourceString Section found" +msgstr "" + +#: lazarusidestrconsts:lisnostringconstantfound +msgid "No String Constant Found" +msgstr "" + +#: lazarusidestrconsts:lisnochange +msgid "No change" +msgstr "" + +#: lazarusidestrconsts:lisnocodeselected +msgid "No code selected" +msgstr "" + +#: lazarusidestrconsts:lisnocompileroptionsinherited +msgid "No compiler options inherited." +msgstr "" + +#: lazarusidestrconsts:dlgednoerr +msgid "No errors in key mapping found." +msgstr "" + +#: lazarusidestrconsts:lisnewdlgnoitemselected +msgid "No item selected" +msgstr "" + +#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting +msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." +msgstr "" + +#: lazarusidestrconsts:lisoipnopackageselected +msgid "No package selected" +msgstr "" + +#: lazarusidestrconsts:lisnoprogramfilesfound +msgid "No program file %s%s%s found." +msgstr "Geen programma bestand %s%s%s gevonden." + +#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly +msgid "Node and its children are only valid for this project" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly +msgid "Node is readonly" +msgstr "" + +#: lazarusidestrconsts:srvk_nonconvert +msgid "Nonconvert" +msgstr "" + +#: lazarusidestrconsts:dlgenvnone +msgid "None" +msgstr "Geen" + +#: lazarusidestrconsts:dlgconormal +msgid "Normal Code" +msgstr "Normale code" + +#: lazarusidestrconsts:srkmecnormalselect +msgid "Normal selection mode" +msgstr "Normale selectie modus" + +#: lazarusidestrconsts:lisnotadelphiproject +msgid "Not a Delphi project" +msgstr "Geen Dephi project" + +#: lazarusidestrconsts:lisnotadelphiunit +msgid "Not a Delphi unit" +msgstr "Geen Delphi unit" + +#: lazarusidestrconsts:lisuenotfound +msgid "Not found" +msgstr "Niet gevonden." + +#: lazarusidestrconsts:uenotimplcap +msgid "Not implemented yet" +msgstr "Nog niet geimplementeerd" + +#: lazarusidestrconsts:lisnotnow +msgid "Not now" +msgstr "Niet nu" + +#: lazarusidestrconsts:dlgenvbackuphelpnote +msgid "Notes: Project files are all files in the project directory" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptsnumber +msgid "Number" +msgstr "Nummer" + +#: lazarusidestrconsts:srvk_numlock +msgid "Numlock" +msgstr "" + +#: lazarusidestrconsts:srvk_numpad +msgid "Numpad %d" +msgstr "" + +#: lazarusidestrconsts:uepovr +msgid "OVR" +msgstr "" + +#: lazarusidestrconsts:lispckoptsobject +msgid "Object" +msgstr "" + +#: lazarusidestrconsts:lismenuviewobjectinspector +msgid "Object Inspector" +msgstr "Object Inspector" + +#: lazarusidestrconsts:lislazbuildok +msgid "Ok" +msgstr "" + +#: lazarusidestrconsts:lismenuonlinehelp +msgid "Online Help" +msgstr "" + +#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented +msgid "Online Help not yet implemented" +msgstr "" + +#: lazarusidestrconsts:lisonlysearchforwholewords +msgid "Only search for whole words" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgonlyselection +msgid "Only selection" +msgstr "" + +#: lazarusidestrconsts:lisfindfileonlytextfiles +msgid "Only text files" +msgstr "" + +#: lazarusidestrconsts:lismenuopen +msgid "Open" +msgstr "Openen" + +#: lazarusidestrconsts:lisdiffdlgopendiffineditor +msgid "Open Diff in editor" +msgstr "" + +#: lazarusidestrconsts:lisopenpackagefile +msgid "Open Package File" +msgstr "Open Package bestand" + +#: lazarusidestrconsts:lisopenpackage +msgid "Open Package?" +msgstr "Open Package?" + +#: lazarusidestrconsts:lisctdefsopenpreview +msgid "Open Preview" +msgstr "" + +#: lazarusidestrconsts:lismenuopenproject +msgid "Open Project" +msgstr "Open Project" + +#: lazarusidestrconsts:lisopenprojectfile +msgid "Open Project File" +msgstr "Open Project bestand" + +#: lazarusidestrconsts:lisopenproject +msgid "Open Project?" +msgstr "Open Project?" + +#: lazarusidestrconsts:lismenuopenrecent +msgid "Open Recent" +msgstr "Open Recent" + +#: lazarusidestrconsts:lismenuopenrecentproject +msgid "Open Recent Project" +msgstr "Open Recent Project" + +#: lazarusidestrconsts:lisopenfile +msgid "Open file" +msgstr "Open bestand" + +#: lazarusidestrconsts:srkmecopenfileatcursor +msgid "Open file at cursor" +msgstr "Open bestand (op cursor)" + +#: lazarusidestrconsts:lismenuopenfilenameatcursor +msgid "Open filename at cursor" +msgstr "Open bestandsnaam (op cursor)" + +#: lazarusidestrconsts:dlgqopenlastprj +msgid "Open last project at start" +msgstr "Open laatste project bij start" + +#: lazarusidestrconsts:lismenuopenpackage +msgid "Open loaded package" +msgstr "Open een geladen Package" + +#: lazarusidestrconsts:liscomppalopenpackage +msgid "Open package" +msgstr "Open een Package" + +#: lazarusidestrconsts:lismenuopenpackagefile +msgid "Open package file (.lpk)" +msgstr "Open Package bestand (.lpk)" + +#: lazarusidestrconsts:lismenuopenpackageofcurunit +msgid "Open package of current unit" +msgstr "Open Package van huidige unit" + +#: lazarusidestrconsts:lismenuopenrecentpkg +msgid "Open recent package" +msgstr "Open recente Package" + +#: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile +msgid "Open the package %s?%sAnswer No to load it as xml file." +msgstr "" + +#: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile +msgid "Open the project %s?%sAnswer No to load it as xml file." +msgstr "Het Project openen %s?%s'Nee' om het als .xml bestand in te lezen." + +#: lazarusidestrconsts:liscomppalopenunit +msgid "Open unit" +msgstr "" + +#: lazarusidestrconsts:dlgoptimiz +msgid "Optimizations:" +msgstr "Optimaliseringen:" + +#: lazarusidestrconsts:fdmsnaptogridoption +msgid "Option: Snap to grid" +msgstr "Optie: Snap to grid" + +#: lazarusidestrconsts:fdmsnaptoguidelinesoption +msgid "Option: Snap to guide lines" +msgstr "" + +#: lazarusidestrconsts:dlgfropts +msgid "Options" +msgstr "Opties" + +#: lazarusidestrconsts:lislazbuildoptions +msgid "Options:" +msgstr "Opties:" + +#: lazarusidestrconsts:dlgcoopts +msgid "Options: " +msgstr "Opties:" + +#: lazarusidestrconsts:dlgsrorigin +msgid "Origin" +msgstr "Oorsprong" + +#: lazarusidestrconsts:dlgcoother +msgid "Other" +msgstr "Ander" + +#: lazarusidestrconsts:dlgcosources +msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" +msgstr "Andere Bronnen (.pp / .pas bestanden, alleen door IDE gebruikt)" + +#: lazarusidestrconsts:dlgotherunitfiles +msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" +msgstr "Andere unit bestanden (-Fu)" + +#: lazarusidestrconsts:dlgenvotherfiles +msgid "Other files" +msgstr "Andere bestanden" + +#: lazarusidestrconsts:dlgpooutputsettings +msgid "Output Settings" +msgstr "Output Instellingen" + +#: lazarusidestrconsts:lispkgdefsoutputdirectory +msgid "Output directory" +msgstr "" + +#: lazarusidestrconsts:dlgcooverflow +msgid "Overflow" +msgstr "" + +#: lazarusidestrconsts:lissvuooverridesystemvariable +msgid "Override system variable" +msgstr "" + +#: lazarusidestrconsts:srkmecoverwritemode +msgid "Overwrite Mode" +msgstr "" + +#: lazarusidestrconsts:lisoverwritefile +msgid "Overwrite file?" +msgstr "Bestand overschrijven?" + +#: lazarusidestrconsts:lispckeditpackage +msgid "Package %s" +msgstr "" + +#: lazarusidestrconsts:lispckexplpackagenotfound +msgid "Package %s not found" +msgstr "Package %s niet gevonden" + +#: lazarusidestrconsts:lispkgmangpackagechangedsave +msgid "Package %s%s%s changed. Save?" +msgstr "Package %s%s%s chaged. Opslaan?" + +#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage +msgid "Package %s%s%s has changed.%sSave package?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory +msgid "Package %s%s%s has no valid output directory:%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisaf2ppackagenotfound +msgid "Package %s%s%s not found." +msgstr "" + +#: lazarusidestrconsts:lismenupackagegraph +msgid "Package Graph" +msgstr "" + +#: lazarusidestrconsts:lisoippackagename +msgid "Package Name" +msgstr "" + +#: lazarusidestrconsts:lisprojaddpackagename +msgid "Package Name:" +msgstr "" + +#: lazarusidestrconsts:lispckoptspackageoptions +msgid "Package Options" +msgstr "" + +#: lazarusidestrconsts:lispkgdefssrcdirmark +msgid "Package Source Directory Mark" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackageconflicts +msgid "Package conflicts" +msgstr "" + +#: lazarusidestrconsts:lispkgsyspackagefilenotfound +msgid "Package file not found" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage +msgid "Package is no designtime package" +msgstr "" + +#: lazarusidestrconsts:lisaf2ppackageisreadonly +msgid "Package is read only" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackageisrequired +msgid "Package is required" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists +msgid "Package name already exists" +msgstr "" + +#: lazarusidestrconsts:lispackageneedsinstallation +msgid "Package needs installation" +msgstr "" + +#: lazarusidestrconsts:lisprojaddpackagenotfound +msgid "Package not found" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackage +msgid "Package: %s" +msgstr "" + +#: lazarusidestrconsts:lispckoptspackagetype +msgid "PackageType" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk +msgid "Packages must have the extension .lpk" +msgstr "" + +#: lazarusidestrconsts:lispackagestoinstallintheide +msgid "Packages to install in the IDE" +msgstr "" + +#: lazarusidestrconsts:lisa2ppagenametoolong +msgid "Page Name too long" +msgstr "" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu +msgid "Paint designer items only on idle (reduce overhead for slow computers)" +msgstr "" + +#: lazarusidestrconsts:lisa2ppalettepage +msgid "Palette Page:" +msgstr "" + +#: lazarusidestrconsts:lissortselparagraphs +msgid "Paragraphs" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolparameters +msgid "Parameters:" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch +msgid "Parent node can not contain child nodes." +msgstr "" + +#: lazarusidestrconsts:dlgcoparsing +msgid "Parsing" +msgstr "" + +#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas +msgid "Pascal units must have the extension .pp or .pas" +msgstr "" + +#: lazarusidestrconsts:dlgpassoptslinker +msgid "Pass Options To The Linker (Delimiter is space)" +msgstr "" + +#: lazarusidestrconsts:lismenupaste +msgid "Paste" +msgstr "Plakken" + +#: lazarusidestrconsts:srkmecpaste +msgid "Paste clipboard to current position" +msgstr "" + +#: lazarusidestrconsts:lisdsgpastecomponents +msgid "Paste selected components from clipboard" +msgstr "" + +#: lazarusidestrconsts:lispatheditpathtemplates +msgid "Path templates" +msgstr "" + +#: lazarusidestrconsts:listofpcpath +msgid "Path:" +msgstr "Pad:" + +#: lazarusidestrconsts:dlgsearchpaths +msgid "Paths" +msgstr "Paden:" + +#: lazarusidestrconsts:lisuidpathsreadonly +msgid "Paths (Read Only)" +msgstr "" + +#: lazarusidestrconsts:lismenupause +msgid "Pause" +msgstr "Pauze" + +#: lazarusidestrconsts:srvk_pause +msgid "Pause key" +msgstr "Pauze toets" + +#: lazarusidestrconsts:dlgpersistentcaret +msgid "Persistent caret" +msgstr "" + +#: lazarusidestrconsts:lisplzcheckthecompilername +msgid "Please check the compiler name" +msgstr "Controleer compiler naam" + +#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory +msgid "Please check the freepascal source directory" +msgstr "Controleer de FP bron directory" + +#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring +msgid "Please choose a resourstring section from the list." +msgstr "" + +#: lazarusidestrconsts:lispleaseopenaunitbeforerun +msgid "Please open a unit before run." +msgstr "A.u.b. een unit openen .." + +#: lazarusidestrconsts:srkmpresskey +msgid "Please press a key ..." +msgstr "Druk een toets in" + +#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage +msgid "Please save the file before adding it to a package." +msgstr "" + +#: lazarusidestrconsts:lisoippleaseselectapackage +msgid "Please select a package" +msgstr "" + +#: lazarusidestrconsts:lisoippleaseselectapackagetoopen +msgid "Please select a package to open" +msgstr "" + +#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst +msgid "Please select an item first." +msgstr "" + +#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod +msgid "Please select some code to extract a new procedure/method." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptspoint +msgid "Point" +msgstr "Punt" + +#: lazarusidestrconsts:rslanguagepolish +msgid "Polish" +msgstr "" + +#: lazarusidestrconsts:rslanguagepolishwin +msgid "Polish(CP1250)" +msgstr "" + +#: lazarusidestrconsts:rslanguagepolishiso +msgid "Polish(ISO 8859-2)" +msgstr "" + +#: lazarusidestrconsts:dlgwrdpreview +msgid "Preview" +msgstr "" + +#: lazarusidestrconsts:dlgcdtpreview +msgid "Preview (Max line length = 1)" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes +msgid "Previous node can not contain child nodes." +msgstr "" + +#: lazarusidestrconsts:srvk_print +msgid "Print" +msgstr "" + +#: lazarusidestrconsts:listodolistprintlist +msgid "Print todo items" +msgstr "" + +#: lazarusidestrconsts:srvk_prior +msgid "Prior" +msgstr "" + +#: lazarusidestrconsts:lisprivatemethod +msgid "Private Method" +msgstr "" + +#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti +msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" +msgstr "" + +#: lazarusidestrconsts:lisprocedure +msgid "Procedure" +msgstr "" + +#: lazarusidestrconsts:dlgforwardprocsinsertpolicy +msgid "Procedure insert policy" +msgstr "" + +#: lazarusidestrconsts:lisprocedurewithinterface +msgid "Procedure with interface" +msgstr "Procedure met interface" + +#: lazarusidestrconsts:lisprogram +msgid "Program" +msgstr "Programma" + +#: lazarusidestrconsts:lisprogramdetected +msgid "Program detected" +msgstr "Programma vastgesteld" + +#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp +msgid "Program source must have a pascal extension like .pas, .pp or .lpr" +msgstr "Programma broncode dient een Pascal extensie, zoals .pas, .pp of .lpr, te hebben." + +#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic +msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." +msgstr "Programma%sEen Freepascal programma. Het programma wordt automatisch door Lazarus bijgehouden." + +#: lazarusidestrconsts:lisedtexttoolprogramfilename +msgid "Programfilename:" +msgstr "Programma bestandsnaam:" + +#: lazarusidestrconsts:dlgenvproject +msgid "Project" +msgstr "" + +#: lazarusidestrconsts:lisprojectsuccessfullybuilt +msgid "Project %s%s%s successfully built. :)" +msgstr "Project %s%s%s succesvol gebouwd" + +#: lazarusidestrconsts:lisedtdefprojectincpath +msgid "Project IncPath" +msgstr "" + +#: lazarusidestrconsts:lisprojectincpath +msgid "Project Include Path" +msgstr "" + +#: lazarusidestrconsts:lismenuprojectinspector +msgid "Project Inspector" +msgstr "" + +#: lazarusidestrconsts:lisprojinspprojectinspector +msgid "Project Inspector - %s" +msgstr "" + +#: lazarusidestrconsts:dlgprojectoptions +msgid "Project Options" +msgstr "Project Opties" + +#: lazarusidestrconsts:lismenuprojectoptions +msgid "Project Options..." +msgstr "Project Opties ..." + +#: lazarusidestrconsts:lisprojectsrcpath +msgid "Project Src Path" +msgstr "" + +#: lazarusidestrconsts:lisedtdefprojectsrcpath +msgid "Project SrcPath" +msgstr "" + +#: lazarusidestrconsts:lisprojectunitpath +msgid "Project Unit Path" +msgstr "Project Unit pad" + +#: lazarusidestrconsts:lisedtdefprojectunitpath +msgid "Project UnitPath" +msgstr "Project Unit pad" + +#: lazarusidestrconsts:lisprojectchanged +msgid "Project changed" +msgstr "Projekt is veranderd" + +#: lazarusidestrconsts:lisprojectdirectory +msgid "Project directory" +msgstr "Project directory" + +#: lazarusidestrconsts:lisprojectfilename +msgid "Project filename" +msgstr "Project bestandsnaam" + +#: lazarusidestrconsts:dlgprojfiles +msgid "Project files" +msgstr "Project bestanden" + +#: lazarusidestrconsts:lisprojectinfofiledetected +msgid "Project info file detected" +msgstr "" + +#: lazarusidestrconsts:lisprojectisrunnable +msgid "Project is runnable" +msgstr "Project is 'runnable'" + +#: lazarusidestrconsts:srkmcatprojectmenu +msgid "Project menu commands" +msgstr "" + +#: lazarusidestrconsts:lispkgmangproject +msgid "Project: %s" +msgstr "" + +#: lazarusidestrconsts:dlgpromptonreplace +msgid "Prompt On Replace" +msgstr "" + +#: lazarusidestrconsts:lispromptforvalue +msgid "Prompt for value" +msgstr "Benutzer nach Daten fragen" + +#: lazarusidestrconsts:lishlpoptsproperties +msgid "Properties:" +msgstr "" + +#: lazarusidestrconsts:dlgpropertycompletion +msgid "Property completion" +msgstr "" + +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + +#: lazarusidestrconsts:lisprotectedmethod +msgid "Protected Method" +msgstr "" + +#: lazarusidestrconsts:lispublicmethod +msgid "Public Method" +msgstr "Publieke methode" + +#: lazarusidestrconsts:lispkgeditpublishpackage +msgid "Publish Package" +msgstr "Publiceer Package" + +#: lazarusidestrconsts:lismenupublishproject +msgid "Publish Project" +msgstr "Publiceer Project" + +#: lazarusidestrconsts:lispublishprojdir +msgid "Publish project directory" +msgstr "" + +#: lazarusidestrconsts:lispublishedmethod +msgid "Published Method" +msgstr "Gepubliceerde methode" + +#: lazarusidestrconsts:lismenuquicksyntaxcheck +msgid "Quick syntax check" +msgstr "Snellere Syntaxcheck" + +#: lazarusidestrconsts:lismenuquit +msgid "Quit" +msgstr "Afsluiten" + +#: lazarusidestrconsts:dlgcorange +msgid "Range" +msgstr "Bereik" + +#: lazarusidestrconsts:lispckeditreadddependency +msgid "Re-Add dependency" +msgstr "" + +#: lazarusidestrconsts:lispckeditreaddfile +msgid "Re-Add file" +msgstr "" + +#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages +msgid "Re-Compile this and all required packages?" +msgstr "Hercompileer, en alle benodigde Packages?" + +#: lazarusidestrconsts:lisreaderror +msgid "Read Error" +msgstr "Leesfout" + +#: lazarusidestrconsts:uemreadonly +msgid "Read Only" +msgstr "Uitsluitend lezen" + +#: lazarusidestrconsts:lispckeditreadonly +msgid "Read Only: %s" +msgstr "Uitsluitend lezen: %s" + +#: lazarusidestrconsts:liscodetoolsdefsreaderror +msgid "Read error" +msgstr "Leesfout" + +#: lazarusidestrconsts:dlgcdtreadprefix +msgid "Read prefix" +msgstr "" + +#: lazarusidestrconsts:uepreadonly +msgid "Readonly" +msgstr "Uitsluitend leesbaar" + +#: lazarusidestrconsts:lispkgmangrebuildlazarus +msgid "Rebuild Lazarus?" +msgstr "" + +#: lazarusidestrconsts:lispckeditrecompileallrequired +msgid "Recompile all required" +msgstr "Hercompileer wat benodigd is" + +#: lazarusidestrconsts:lispckeditrecompileclean +msgid "Recompile clean" +msgstr "Hercompileer opnieuw" + +#: lazarusidestrconsts:lismenuredo +msgid "Redo" +msgstr "Opnieuw" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidle +msgid "Reduce designer painting" +msgstr "" + +#: lazarusidestrconsts:uemrefactor +msgid "Refactoring" +msgstr "" + +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + +#: lazarusidestrconsts:dlgunitdeprefresh +msgid "Refresh" +msgstr "" + +#: lazarusidestrconsts:listodolistrefresh +msgid "Refresh todo items" +msgstr "" + +#: lazarusidestrconsts:lispkgsysregisterprocedureisnil +msgid "Register procedure is nil" +msgstr "" + +#: lazarusidestrconsts:lispckeditregisterunit +msgid "Register unit" +msgstr "Registreer unit" + +#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering +msgid "RegisterUnit was called, but no package is registering." +msgstr "" + +#: lazarusidestrconsts:lispckeditregisteredplugins +msgid "Registered plugins" +msgstr "" + +#: lazarusidestrconsts:lispkgsysregistrationerror +msgid "Registration Error" +msgstr "" + +#: lazarusidestrconsts:dlgregularexpressions +msgid "Regular Expressions" +msgstr "" + +#: lazarusidestrconsts:lisfindfileregularexpressions +msgid "Regular expressions" +msgstr "" + +#: lazarusidestrconsts:lispckoptsrelease +msgid "Release" +msgstr "" + +#: lazarusidestrconsts:lisdiskdiffrevertall +msgid "Reload from disk" +msgstr "" + +#: lazarusidestrconsts:lisexttoolremove +msgid "Remove" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovedependency2 +msgid "Remove Dependency?" +msgstr "" + +#: lazarusidestrconsts:lisremoveallinvalidproperties +msgid "Remove all invalid properties" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovedependency +msgid "Remove dependency" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovedependencyfrompackage +msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovefile +msgid "Remove file" +msgstr "Verwijder bestand" + +#: lazarusidestrconsts:lisprojinspremovefilefromproject +msgid "Remove file %s from project?" +msgstr "Verwijder bestand %s van het project?" + +#: lazarusidestrconsts:lispckeditremovefilefrompackage +msgid "Remove file %s%s%s%sfrom package %s%s%s?" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovefile2 +msgid "Remove file?" +msgstr "Verwijder bestand?" + +#: lazarusidestrconsts:liscldirremovefilesmatchingfilter +msgid "Remove files matching filter" +msgstr "" + +#: lazarusidestrconsts:lismenuremovefromproject +msgid "Remove from Project" +msgstr "Verwijder van Project" + +#: lazarusidestrconsts:lisremovefromproject +msgid "Remove from project" +msgstr "Verwijder van Project" + +#: lazarusidestrconsts:lispckeditremoveselecteditem +msgid "Remove selected item" +msgstr "Verwijder geselecteerde items" + +#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile +msgid "Removed Files (these entries are not saved to the lpk file)" +msgstr "" + +#: lazarusidestrconsts:lisprojinspremovedrequiredpackages +msgid "Removed required packages" +msgstr "" + +#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved +msgid "Removed required packages (these entries are not saved to the lpk file)" +msgstr "" + +#: lazarusidestrconsts:lisfrirename +msgid "Rename" +msgstr "Hernoemen" + +#: lazarusidestrconsts:lispkgmangrenamefilelowercase +msgid "Rename File lowercase?" +msgstr "" + +#: lazarusidestrconsts:lismenurenameidentifier +msgid "Rename Identifier" +msgstr "Hernoem Identifier" + +#: lazarusidestrconsts:lisfrirenameallreferences +msgid "Rename all References" +msgstr "Hernoem alle referenties" + +#: lazarusidestrconsts:lisrenamefilefailed +msgid "Rename file failed" +msgstr "Hernoemen van bestand gefaald." + +#: lazarusidestrconsts:lispkgmangrenamefileinpackage +msgid "Rename file in package?" +msgstr "" + +#: lazarusidestrconsts:lisrenamefile +msgid "Rename file?" +msgstr "Hernoem bestand?" + +#: lazarusidestrconsts:srkmecrenameidentifier +msgid "Rename identifier" +msgstr "Hernoem identifier" + +#: lazarusidestrconsts:lisfrirenameto +msgid "Rename to" +msgstr "Hernoem naar" + +#: lazarusidestrconsts:lismenureplace +msgid "Replace" +msgstr "Vervangen" + +#: lazarusidestrconsts:dlgreplaceall +msgid "Replace All" +msgstr "Alles Vervangen" + +#: lazarusidestrconsts:lispkgmangreplacefile +msgid "Replace File" +msgstr "Vervang bestand" + +#: lazarusidestrconsts:lispkgmangreplaceexistingfile +msgid "Replace existing file %s%s%s?" +msgstr "Vervang bestaand bestand %s%s%s?" + +#: lazarusidestrconsts:srkmecreplace +msgid "Replace text" +msgstr "Vervang tekst" + +#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith +msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" +msgstr "Vervang dit exemplaar van %s%s%s%s met %s%s%s?" + +#: lazarusidestrconsts:dlgreport +msgid "Report" +msgstr "Rapporteer" + +#: lazarusidestrconsts:lispckeditrequiredpackages +msgid "Required Packages" +msgstr "Benodigde Packages" + +#: lazarusidestrconsts:lismenurescanfpcsourcedirectory +msgid "Rescan FPC source directory" +msgstr "Lees FPC broncode directory" + +#: lazarusidestrconsts:lismenuresetdebugger +msgid "Reset debugger" +msgstr "" + +#: lazarusidestrconsts:lisresourceloaderror +msgid "Resource load error" +msgstr "" + +#: lazarusidestrconsts:lisresourcesaveerror +msgid "Resource save error" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrresourcestringsection +msgid "Resourcestring Section:" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis +msgid "Resourcestring already exists" +msgstr "" + +#: lazarusidestrconsts:lismenurestart +msgid "Restart" +msgstr "Herstart" + +#: lazarusidestrconsts:lislazbuildrestartafterbuild +msgid "Restart After Successfull Build" +msgstr "Herstart na succesvol bouwen" + +#: lazarusidestrconsts:rsiwprestorewindowgeometry +msgid "Restore window geometry" +msgstr "" + +#: lazarusidestrconsts:rsiwprestorewindowsize +msgid "Restore window size" +msgstr "" + +#: lazarusidestrconsts:srvk_return +msgid "Return" +msgstr "Terug" + +#: lazarusidestrconsts:lismenurevert +msgid "Revert" +msgstr "Terugzetten" + +#: lazarusidestrconsts:lisrevertfailed +msgid "Revert failed" +msgstr "" + +#: lazarusidestrconsts:lispkgeditrevertpackage +msgid "Revert package?" +msgstr "" + +#: lazarusidestrconsts:srvk_right +msgid "Right" +msgstr "" + +#: lazarusidestrconsts:dlgrightclickselects +msgid "Right Click selects" +msgstr "" + +#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav +msgid "Right click on the items tree to get the popupmenu with all available package functions." +msgstr "" + +#: lazarusidestrconsts:dlgrightmargin +msgid "Right margin" +msgstr "" + +#: lazarusidestrconsts:dlgrightmargincolor +msgid "Right margin color" +msgstr "" + +#: lazarusidestrconsts:dlgrightmousemovescursor +msgid "Right mouse moves caret" +msgstr "" + +#: lazarusidestrconsts:lisrightsides +msgid "Right sides" +msgstr "" + +#: lazarusidestrconsts:lisrightspaceequally +msgid "Right space equally" +msgstr "" + +#: lazarusidestrconsts:dlgrubberbandgroup +msgid "Rubber band" +msgstr "" + +#: lazarusidestrconsts:lismenuprojectrun +msgid "Run" +msgstr "Starten" + +#: lazarusidestrconsts:lismenurunfile +msgid "Run File" +msgstr "Start bestand" + +#: lazarusidestrconsts:lismenurunparameters +msgid "Run Parameters ..." +msgstr "Start Parameter ..." + +#: lazarusidestrconsts:srkmcatrunmenu +msgid "Run menu commands" +msgstr "Start menu commando's" + +#: lazarusidestrconsts:dlgrunparameters +msgid "Run parameters" +msgstr "Start parameters" + +#: lazarusidestrconsts:lismenuruntocursor +msgid "Run to cursor" +msgstr "Start tot cursor" + +#: lazarusidestrconsts:lisruntofailed +msgid "Run-to failed" +msgstr "" + +#: lazarusidestrconsts:lispckoptsruntimeonly +msgid "Runtime only" +msgstr "" + +#: lazarusidestrconsts:rslanguagerussian +msgid "Russian" +msgstr "" + +#: lazarusidestrconsts:rslanguagerussianwin +msgid "Russian(CP1251)" +msgstr "" + +#: lazarusidestrconsts:rslanguagerussianutf +msgid "Russian(UTF8)" +msgstr "" + +#: lazarusidestrconsts:dlgbckupsubdir +msgid "Same name (in subdirectory)" +msgstr "" + +#: lazarusidestrconsts:lismenusave +msgid "Save" +msgstr "Opslaan" + +#: lazarusidestrconsts:lissavespace +msgid "Save " +msgstr "Opslaan " + +#: lazarusidestrconsts:lismenusaveall +msgid "Save All" +msgstr "Alles Opslaan" + +#: lazarusidestrconsts:lismenusaveas +msgid "Save As" +msgstr "Opslaan Als" + +#: lazarusidestrconsts:dlgcharcasefileact +msgid "Save As - auto rename pascal files lower case" +msgstr "" + +#: lazarusidestrconsts:lismenueditorsaveastemplate +msgid "Save As Template..." +msgstr "Opslaan als Template" + +#: lazarusidestrconsts:lispckeditsavechanges +msgid "Save Changes?" +msgstr "Veranderingen Opslaan?" + +#: lazarusidestrconsts:lispkgmangsavepackagelpk +msgid "Save Package %s (*.lpk)" +msgstr "Package Opslaan %s (*.lpk)" + +#: lazarusidestrconsts:lispkgmangsavepackage +msgid "Save Package?" +msgstr "Package Opslaan ?" + +#: lazarusidestrconsts:lismenusaveproject +msgid "Save Project" +msgstr "Project Opslaan " + +#: lazarusidestrconsts:lissaveprojectlpi +msgid "Save Project %s (*.lpi)" +msgstr "Opslaan Projecy %s (*.lpi)" + +#: lazarusidestrconsts:lismenusaveprojectas +msgid "Save Project As..." +msgstr "Project Opslaan Als ..." + +#: lazarusidestrconsts:lishintsaveall +msgid "Save all" +msgstr "Alles Opslaan" + +#: lazarusidestrconsts:lissaveallmessagestofile +msgid "Save all messages to file" +msgstr "Alle berichten naar bestand schrijven" + +#: lazarusidestrconsts:liscodetoolsdefssaveandexit +msgid "Save and Exit" +msgstr "Opslaan en Afsluiten" + +#: lazarusidestrconsts:lissaveandexitdialog +msgid "Save and exit dialog" +msgstr "" + +#: lazarusidestrconsts:lissaveandrebuildide +msgid "Save and rebuild IDE" +msgstr "" + +#: lazarusidestrconsts:srkmecsaveas +msgid "Save as" +msgstr "Opslaan Als" + +#: lazarusidestrconsts:lissavechangestoproject +msgid "Save changes to project %s?" +msgstr "Veranderingen aan project %s opslaan?" + +#: lazarusidestrconsts:lissavechanges +msgid "Save changes?" +msgstr "Veranderingen opslaan?" + +#: lazarusidestrconsts:dlgsavedfile +msgid "Save desktop settings to file" +msgstr "" + +#: lazarusidestrconsts:dlgsaveeditorinfo +msgid "Save editor info for closed files" +msgstr "" + +#: lazarusidestrconsts:dlgsaveeditorinfoproject +msgid "Save editor info only for project files" +msgstr "" + +#: lazarusidestrconsts:lissavefilebeforeclosingform +msgid "Save file %s%s%s%sbefore closing form %s%s%s?" +msgstr "" + +#: lazarusidestrconsts:lispckeditsavepackage +msgid "Save package" +msgstr "" + +#: lazarusidestrconsts:lispkgmangsavepackage2 +msgid "Save package?" +msgstr "" + +#: lazarusidestrconsts:fdmscaleword +msgid "Scale" +msgstr "" + +#: lazarusidestrconsts:lisscalingfactor +msgid "Scaling factor:" +msgstr "" + +#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure +msgid "Scan Unit for Unit Name and Register procedure" +msgstr "" + +#: lazarusidestrconsts:liscoscanforfpcmessages +msgid "Scan for FPC messages" +msgstr "" + +#: lazarusidestrconsts:liscoscanformakemessages +msgid "Scan for Make messages" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages +msgid "Scan output for Free Pascal Compiler messages" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages +msgid "Scan output for make messages" +msgstr "" + +#: lazarusidestrconsts:dlgscope +msgid "Scope" +msgstr "" + +#: lazarusidestrconsts:srvk_scroll +msgid "Scroll" +msgstr "" + +#: lazarusidestrconsts:dlgscrollbyoneless +msgid "Scroll by one less" +msgstr "" + +#: lazarusidestrconsts:srkmecscrolldown +msgid "Scroll down one line" +msgstr "" + +#: lazarusidestrconsts:srkmecscrollleft +msgid "Scroll left one char" +msgstr "" + +#: lazarusidestrconsts:dlgscrollpastendfile +msgid "Scroll past end of file" +msgstr "" + +#: lazarusidestrconsts:dlgscrollpastendline +msgid "Scroll past end of line" +msgstr "" + +#: lazarusidestrconsts:srkmecscrollright +msgid "Scroll right one char" +msgstr "" + +#: lazarusidestrconsts:srkmecscrollup +msgid "Scroll up one line" +msgstr "" + +#: lazarusidestrconsts:lissearchfor +msgid "Search For " +msgstr "Zoek naar " + +#: lazarusidestrconsts:lismenuviewsearchresults +msgid "Search Results" +msgstr "Zoek Resultaten" + +#: lazarusidestrconsts:lissearchagain +msgid "Search again" +msgstr "Zoek opnieuw" + +#: lazarusidestrconsts:lisfrisearchincommentstoo +msgid "Search in comments too" +msgstr "" + +#: lazarusidestrconsts:lispatheditsearchpaths +msgid "Search paths:" +msgstr "" + +#: lazarusidestrconsts:lisuesearchstringnotfound +msgid "Search string '%s' not found!" +msgstr "" + +#: lazarusidestrconsts:dlgsearchabort +msgid "Search terminated by user." +msgstr "" + +#: lazarusidestrconsts:lisfrisearchwhere +msgid "Search where" +msgstr "" + +#: lazarusidestrconsts:dlgsearchcaption +msgid "Searching..." +msgstr "" + +#: lazarusidestrconsts:lisuesearching +msgid "Searching: %s" +msgstr "" + +#: lazarusidestrconsts:lisseemessages +msgid "See messages." +msgstr "" + +#: lazarusidestrconsts:srkmecselleft +msgid "SelLeft" +msgstr "" + +#: lazarusidestrconsts:srkmecselright +msgid "SelRight" +msgstr "" + +#: lazarusidestrconsts:lismenuselect +msgid "Select" +msgstr "Selecteer" + +#: lazarusidestrconsts:srkmecselectall +msgid "Select All" +msgstr "Selecteer Alles" + +#: lazarusidestrconsts:lisselectdfmfiles +msgid "Select Delphi form files (*.dfm)" +msgstr "" + +#: lazarusidestrconsts:srkmecseldown +msgid "Select Down" +msgstr "" + +#: lazarusidestrconsts:srkmecselgotoxy +msgid "Select Goto XY" +msgstr "" + +#: lazarusidestrconsts:srkmecsellineend +msgid "Select Line End" +msgstr "" + +#: lazarusidestrconsts:srkmecsellinestart +msgid "Select Line Start" +msgstr "" + +#: lazarusidestrconsts:lismenueditorselectmenu +msgid "Select Menu:" +msgstr "" + +#: lazarusidestrconsts:srkmecselpagebottom +msgid "Select Page Bottom" +msgstr "" + +#: lazarusidestrconsts:srkmecselpagedown +msgid "Select Page Down" +msgstr "" + +#: lazarusidestrconsts:srkmecselpageleft +msgid "Select Page Left" +msgstr "" + +#: lazarusidestrconsts:srkmecselpageright +msgid "Select Page Right" +msgstr "" + +#: lazarusidestrconsts:srkmecselpagetop +msgid "Select Page Top" +msgstr "" + +#: lazarusidestrconsts:srkmecselpageup +msgid "Select Page Up" +msgstr "" + +#: lazarusidestrconsts:lismenueditorselecttemplate +msgid "Select Template:" +msgstr "Selecteer een Template" + +#: lazarusidestrconsts:srkmecselup +msgid "Select Up" +msgstr "" + +#: lazarusidestrconsts:srkmecselwordleft +msgid "Select Word Left" +msgstr "" + +#: lazarusidestrconsts:srkmecselwordright +msgid "Select Word Right" +msgstr "" + +#: lazarusidestrconsts:lisselectahelpitem +msgid "Select a help item:" +msgstr "Selecteer een help item:" + +#: lazarusidestrconsts:lisselectanode +msgid "Select a node" +msgstr "Selecteer een node" + +#: lazarusidestrconsts:lisnpselectaprojecttype +msgid "Select a project type" +msgstr "Selecteer een Project type" + +#: lazarusidestrconsts:lismenuselectall +msgid "Select all" +msgstr "Selecteer Alles" + +#: lazarusidestrconsts:lismenuselectcodeblock +msgid "Select code block" +msgstr "Selecteer code blok" + +#: lazarusidestrconsts:lispatheditselectdirectory +msgid "Select directory" +msgstr "" + +#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds +msgid "Select grand childs" +msgstr "" + +#: lazarusidestrconsts:lismenuselectline +msgid "Select line" +msgstr "Selecteer lijn" + +#: lazarusidestrconsts:lismenuselectparagraph +msgid "Select paragraph" +msgstr "Selecteer paragraaf" + +#: lazarusidestrconsts:lisdsgselectparentcomponent +msgid "Select parent component" +msgstr "" + +#: lazarusidestrconsts:srkmecseleditortop +msgid "Select to absolute beginning" +msgstr "Selecteer tot begin" + +#: lazarusidestrconsts:srkmecseleditorbottom +msgid "Select to absolute end" +msgstr "Selecteer tot eind" + +#: lazarusidestrconsts:lismenuselecttobrace +msgid "Select to brace" +msgstr "Selecteer tot accolade" + +#: lazarusidestrconsts:liscodetoolsdefsselectednode +msgid "Selected Node:" +msgstr "Geselecteerde node:" + +#: lazarusidestrconsts:dlgselectedtext +msgid "Selected Text" +msgstr "Selecteer tekst" + +#: lazarusidestrconsts:lispckexplisrequiredby +msgid "Selected package is required by:" +msgstr "" + +#: lazarusidestrconsts:dlgruberbandselectioncolor +msgid "Selection" +msgstr "" + +#: lazarusidestrconsts:lisselectionexceedsstringconstant +msgid "Selection exceeds string constant" +msgstr "" + +#: lazarusidestrconsts:lisselectiontool +msgid "Selection tool" +msgstr "Auswahlwerkzeug" + +#: lazarusidestrconsts:liscodetoolsoptssemicolon +msgid "Semicolon" +msgstr "" + +#: lazarusidestrconsts:fdmsendtoback +msgid "Send to back" +msgstr "" + +#: lazarusidestrconsts:srkmecsetmarker +msgid "Set Marker %d" +msgstr "" + +#: lazarusidestrconsts:dlgsetallelementdefault +msgid "Set all elements to default" +msgstr "" + +#: lazarusidestrconsts:dlgsetelementdefault +msgid "Set element to default" +msgstr "" + +#: lazarusidestrconsts:dlgsetpropertyvariable +msgid "Set property Variable" +msgstr "" + +#: lazarusidestrconsts:lislazbuildsettobuildall +msgid "Set to %sBuild All%s" +msgstr "" + +#: lazarusidestrconsts:srvk_shift +msgid "Shift" +msgstr "" + +#: lazarusidestrconsts:srkmecshifttab +msgid "Shift Tab" +msgstr "" + +#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto +msgid "Should the file be renamed lowercase to%s%s%s%s?" +msgstr "Moet het bestand met kleine letters hernoemd worden? (%s%s%s%s)" + +#: lazarusidestrconsts:lisaf2pshowall +msgid "Show All" +msgstr "" + +#: lazarusidestrconsts:lisuishowcodetoolsvalues +msgid "Show CodeTools Values" +msgstr "" + +#: lazarusidestrconsts:dlgcoshowerr +msgid "Show Errors" +msgstr "" + +#: lazarusidestrconsts:dlgguidelines +msgid "Show Guide Lines" +msgstr "" + +#: lazarusidestrconsts:dlgshowhint +msgid "Show Hints" +msgstr "" + +#: lazarusidestrconsts:dlghintsunused +msgid "Show Hints for unused units in main source" +msgstr "" + +#: lazarusidestrconsts:dlgshownotes +msgid "Show Notes" +msgstr "" + +#: lazarusidestrconsts:dlgcoshowoptions +msgid "Show Options" +msgstr "" + +#: lazarusidestrconsts:fdmshowoptions +msgid "Show Options for form editing" +msgstr "" + +#: lazarusidestrconsts:dlgshowwarnings +msgid "Show Warnings" +msgstr "Toon waarschuwingen" + +#: lazarusidestrconsts:lisa2pshowall +msgid "Show all" +msgstr "Toon alles" + +#: lazarusidestrconsts:liscoshowallmessages +msgid "Show all messages" +msgstr "Toon alle berichten" + +#: lazarusidestrconsts:dlgshowprocserror +msgid "Show all procs on error" +msgstr "" + +#: lazarusidestrconsts:dlgclosebuttonsnotebook +msgid "Show close buttons in notebook" +msgstr "" + +#: lazarusidestrconsts:dlgshowcompiledprocedures +msgid "Show compiled procedures" +msgstr "Toon gecompileerde procedures" + +#: lazarusidestrconsts:dlgshowcompileroptions +msgid "Show compiler options" +msgstr "Toon compiler opties" + +#: lazarusidestrconsts:dlgshowcaps +msgid "Show component captions" +msgstr "" + +#: lazarusidestrconsts:dlgshowconditionals +msgid "Show conditionals" +msgstr "" + +#: lazarusidestrconsts:dlgshowdebuginfo +msgid "Show debug info" +msgstr "" + +#: lazarusidestrconsts:dlgshowdefinedmacros +msgid "Show defined macros" +msgstr "" + +#: lazarusidestrconsts:dlgshowedrhints +msgid "Show editor hints" +msgstr "" + +#: lazarusidestrconsts:dlgshoweverything +msgid "Show everything" +msgstr "Toon alles" + +#: lazarusidestrconsts:dlgshowgeneralinfo +msgid "Show general info" +msgstr "" + +#: lazarusidestrconsts:dlgqshowgrid +msgid "Show grid" +msgstr "" + +#: lazarusidestrconsts:dlgshowgutterhints +msgid "Show gutter hints" +msgstr "" + +#: lazarusidestrconsts:dlgshowlinenumbers +msgid "Show line numbers" +msgstr "" + +#: lazarusidestrconsts:dlgshownothing +msgid "Show nothing (only errors)" +msgstr "" + +#: lazarusidestrconsts:dlgshowscrollhint +msgid "Show scroll hint" +msgstr "" + +#: lazarusidestrconsts:dlgshowsummary +msgid "Show summary" +msgstr "" + +#: lazarusidestrconsts:dlgshowtriedfiles +msgid "Show tried files" +msgstr "" + +#: lazarusidestrconsts:dlgshowusedfiles +msgid "Show used files" +msgstr "Toon gebruikte bestanden" + +#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof +msgid "Simple Syntax (e.g. * instead of .*)" +msgstr "Eenvoudige syntax (* i.p.v. .*)" + +#: lazarusidestrconsts:fdmsizeword +msgid "Size" +msgstr "" + +#: lazarusidestrconsts:liscoskipcallingcompiler +msgid "Skip calling Compiler" +msgstr "" + +#: lazarusidestrconsts:dlgcosmaller +msgid "Smaller Code" +msgstr "" + +#: lazarusidestrconsts:dlgcosmartlinkable +msgid "Smart Linkable" +msgstr "" + +#: lazarusidestrconsts:dlgsmarttabs +msgid "Smart tabs" +msgstr "" + +#: lazarusidestrconsts:dlgsnapguidelines +msgid "Snap to Guide Lines" +msgstr "" + +#: lazarusidestrconsts:dlgqsnaptogrid +msgid "Snap to grid" +msgstr "" + +#: lazarusidestrconsts:srvk_snapshot +msgid "Snapshot" +msgstr "" + +#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk +msgid "Some files have changed on disk:" +msgstr "" + +#: lazarusidestrconsts:lissorrynotimplementedyet +msgid "Sorry, not implemented yet" +msgstr "Excuses, dit is nog niet geimplementeerd" + +#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented +msgid "Sorry, this type is not yet implemented" +msgstr "Excuses, dit type is nog niet geimplementeerd." + +#: lazarusidestrconsts:lismenusortselection +msgid "Sort selection" +msgstr "Sorteer Selectie" + +#: lazarusidestrconsts:lismenuviewsourceeditor +msgid "Source Editor" +msgstr "Broncode Editor" + +#: lazarusidestrconsts:srkmcatsrcnotebook +msgid "Source Notebook commands" +msgstr "" + +#: lazarusidestrconsts:lissourceanddestinationarethesame +msgid "Source and Destination are the same:%s%s" +msgstr "" + +#: lazarusidestrconsts:lismenuaddbpsource +msgid "Source breakpoint" +msgstr "" + +#: lazarusidestrconsts:lissourcedirectorydoesnotexists +msgid "Source directory %s%s%s does not exists." +msgstr "" + +#: lazarusidestrconsts:lissourcemodified +msgid "Source modified" +msgstr "" + +#: lazarusidestrconsts:lissourceofpagehaschangedsave +msgid "Source of page %s%s%s has changed. Save?" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrsourcepreview +msgid "Source preview" +msgstr "" + +#: lazarusidestrconsts:dlgspacenotcosmos +msgid "Space" +msgstr "" + +#: lazarusidestrconsts:lisspaceequally +msgid "Space equally" +msgstr "" + +#: lazarusidestrconsts:srvk_space +msgid "Space key" +msgstr "" + +#: lazarusidestrconsts:rslanguagespanish +msgid "Spanish" +msgstr "" + +#: lazarusidestrconsts:rslanguagespanishutf +msgid "Spanish (UTF8)" +msgstr "" + +#: lazarusidestrconsts:lisuidsrc +msgid "Src" +msgstr "" + +#: lazarusidestrconsts:dlgcostack +msgid "Stack" +msgstr "" + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu +msgid "Standard Edit Menu" +msgstr "Standaard Edit Menu" + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu +msgid "Standard File Menu" +msgstr "" + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu +msgid "Standard Help Menu" +msgstr "" + +#: lazarusidestrconsts:lisoipstate +msgid "State" +msgstr "" + +#: lazarusidestrconsts:dlgstatickeyword +msgid "Static Keyword in Objects" +msgstr "" + +#: lazarusidestrconsts:lishintstepinto +msgid "Step Into" +msgstr "Step Into" + +#: lazarusidestrconsts:lishintstepover +msgid "Step Over" +msgstr "Step Over" + +#: lazarusidestrconsts:lismenustepinto +msgid "Step into" +msgstr "Step Into" + +#: lazarusidestrconsts:lismenustepover +msgid "Step over" +msgstr "Step Over" + +#: lazarusidestrconsts:lismenustop +msgid "Stop" +msgstr "Stoppen" + +#: lazarusidestrconsts:lisstopdebugging +msgid "Stop Debugging?" +msgstr "" + +#: lazarusidestrconsts:dlgstopafternrerr +msgid "Stop after number of errors:" +msgstr "" + +#: lazarusidestrconsts:lisstopthedebugging +msgid "Stop the debugging?" +msgstr "" + +#: lazarusidestrconsts:dlgcdtstoredpostfix +msgid "Stored postfix" +msgstr "" + +#: lazarusidestrconsts:lisstreamingerror +msgid "Streaming error" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrstringconstantinsource +msgid "String Constant in source" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptsstringconst +msgid "String constant" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrstringswithsamevalue +msgid "Strings with same value:" +msgstr "" + +#: lazarusidestrconsts:dlgcostrip +msgid "Strip Symbols From Executable" +msgstr "" + +#: lazarusidestrconsts:dlgcostyle +msgid "Style:" +msgstr "" + +#: lazarusidestrconsts:lissubprocedure +msgid "Sub Procedure" +msgstr "" + +#: lazarusidestrconsts:lissubprocedureonsamelevel +msgid "Sub Procedure on same level" +msgstr "" + +#: lazarusidestrconsts:dlgedbsubdir +msgid "Sub directory" +msgstr "" + +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + +#: lazarusidestrconsts:lisa2pswitchpaths +msgid "Switch Paths" +msgstr "" + +#: lazarusidestrconsts:srkmectoggleformunit +msgid "Switch between form and unit" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsoptssymbol +msgid "Symbol" +msgstr "" + +#: lazarusidestrconsts:dlgsmbbehind +msgid "Symbol behind (.pp~)" +msgstr "" + +#: lazarusidestrconsts:dlgsmbfront +msgid "Symbol in front (.~pp)" +msgstr "" + +#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus +msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" +msgstr "" + +#: lazarusidestrconsts:srkmecsyntaxcheck +msgid "Syntax check" +msgstr "" + +#: lazarusidestrconsts:dlgsyntaxoptions +msgid "Syntax options" +msgstr "" + +#: lazarusidestrconsts:dlgrunosystemvariables +msgid "System variables" +msgstr "" + +#: lazarusidestrconsts:dlgbp7cptb +msgid "TP/BP 7.0 Compatible" +msgstr "" + +#: lazarusidestrconsts:srvk_tab +msgid "Tab" +msgstr "" + +#: lazarusidestrconsts:dlgtabindent +msgid "Tab indents blocks" +msgstr "" + +#: lazarusidestrconsts:dlgtabwidths +msgid "Tab widths:" +msgstr "" + +#: lazarusidestrconsts:dlgtabstospaces +msgid "Tabs to spaces" +msgstr "" + +#: lazarusidestrconsts:lismenutabstospacesselection +msgid "Tabs to spaces in selection" +msgstr "Tabs naar Spaces" + +#: lazarusidestrconsts:listargetcpu +msgid "Target CPU" +msgstr "" + +#: lazarusidestrconsts:lislazbuildtargetdirectory +msgid "Target Directory:" +msgstr "" + +#: lazarusidestrconsts:listargetos +msgid "Target OS" +msgstr "" + +#: lazarusidestrconsts:liscotargetosspecificoptions +msgid "Target OS specific options" +msgstr "" + +#: lazarusidestrconsts:lislazbuildtargetos +msgid "Target OS:" +msgstr "" + +#: lazarusidestrconsts:dlgtargetproc +msgid "Target Processor:" +msgstr "" + +#: lazarusidestrconsts:dlgpotargetfilename +msgid "Target file name:" +msgstr "" + +#: lazarusidestrconsts:listargetfilenameplusparams +msgid "Target filename + params" +msgstr "Zieldateiname+Parameter des Projekts" + +#: lazarusidestrconsts:listargetfilenameofproject +msgid "Target filename of project" +msgstr "Zieldateiname des Projekts" + +#: lazarusidestrconsts:lismenueditortemplatepreview +msgid "Template Preview" +msgstr "" + +#: lazarusidestrconsts:dlgtplfname +msgid "Template file name" +msgstr "" + +#: lazarusidestrconsts:liscomptest +msgid "Test" +msgstr "" + +#: lazarusidestrconsts:listestdirectory +msgid "Test directory" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg +msgid "Test directory \"%s\" not found." +msgstr "" + +#: lazarusidestrconsts:lispkgfiletypetext +msgid "Text" +msgstr "" + +#: lazarusidestrconsts:dlgtextattributes +msgid "Text attributes" +msgstr "" + +#: lazarusidestrconsts:srkmcatediting +msgid "Text editing commands" +msgstr "" + +#: lazarusidestrconsts:srkmcatmarker +msgid "Text marker commands" +msgstr "" + +#: lazarusidestrconsts:srkmcatsearchreplace +msgid "Text search and replace commands" +msgstr "" + +#: lazarusidestrconsts:srkmcatselection +msgid "Text selection commands" +msgstr "" + +#: lazarusidestrconsts:lisfindfiletexttofind +msgid "Text to find:" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgtext1 +msgid "Text1" +msgstr "" + +#: lazarusidestrconsts:lisdiffdlgtext2 +msgid "Text2" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory +msgid "The %s project directory,%swhich contains the .dpr, dpk file." +msgstr "" + +#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase +msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir +msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedir +msgid "The Free Pascal CVS source directory." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory +msgid "The Free Pascal CVS source directory. Not required. This will improve find declarationand debugging." +msgstr "" + +#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm +msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory +msgid "The Free Pascal project directory." +msgstr "" + +#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun +msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase +msgid "The LCL - Lazarus Component Library contains all base components for form editing." +msgstr "" + +#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis +msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." +msgstr "" + +#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr +msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory +msgid "The Lazarus main directory." +msgstr "" + +#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid +msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "" + +#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion +msgid "The Maximum Version is lower than the Minimim Version." +msgstr "" + +#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid +msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "" + +#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt +msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" +msgstr "" + +#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit +msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier +msgid "The ancestor type %s%s%s is not a valid pascal identifier." +msgstr "" + +#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro +msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame +msgid "The class name %s%s%s and ancestor type %s%s%s are the same." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile +msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit +msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier +msgid "The class name %s%s%s is not a valid pascal identifier." +msgstr "" + +#: lazarusidestrconsts:listhecommandafterisnotexecutable +msgid "The command after %s%s%s is not executable." +msgstr "" + +#: lazarusidestrconsts:listhecommandafterpublishingisinvalid +msgid "The command after publishing is invalid:%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg +msgid "The compiler file \"%s\" is not an executable." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable +msgid "The compiler file for package %s is not a valid executable:%s%s" +msgstr "" + +#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated +msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror +msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" +msgstr "" + +#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits +msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." +msgstr "" + +#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro +msgid "The debugger %s%s%s%sdoes not exists or is not executable.%s%sSee Environment -> Debugger Options" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg +msgid "The debugger file \"%s\" is not an executable." +msgstr "" + +#: lazarusidestrconsts:lisprojaddthedependencywasnotfound +msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." +msgstr "" + +#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist +msgid "The destination directory%s%s%s%s does not exist." +msgstr "" + +#: lazarusidestrconsts:dlgthedirectory +msgid "The directory \"" +msgstr "" + +#: lazarusidestrconsts:listhefile +msgid "The file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage +msgid "The file %s%s%s is already in the package." +msgstr "" + +#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr +msgid "The file %s%s%s is not a Delphi project (.dpr)" +msgstr "" + +#: lazarusidestrconsts:listhefileisnotadelphiunit +msgid "The file %s%s%s is not a Delphi unit." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage +msgid "The file %s%s%s is not a lazarus package." +msgstr "" + +#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea +msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage +msgid "The file %s%s%s%sis already in the package %s." +msgstr "" + +#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage +msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" +msgstr "" + +#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject +msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." +msgstr "het bestand %s%s%s%slijkt een programma te zijn. Het huidige project sluiten, en een nieuw Lazarus project voor dit programma maken?%s\"Nee\" zal het bestand als een normale bron laden." + +#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus +msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source." +msgstr "" + +#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac +msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" +msgstr "" + +#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself +msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" +msgstr "" + +#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject +msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." +msgstr "" + +#: lazarusidestrconsts:uefilerotext1 +msgid "The file \"" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject +msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile +msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage +msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" +msgstr "" + +#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename +msgid "The filename %s%s%s is ambiguous.%sPlease specifiy a filename with full path." +msgstr "" + +#: lazarusidestrconsts:listhefollowingpackagesfailedtoload +msgid "The following package(s) failed to load:%s%s" +msgstr "" + +#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren +msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" +msgstr "" + +#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable +msgid "The host application %s%s%s is not executable." +msgstr "" + +#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta +msgid "The launching application %s%s%s%sdoes not exists or is not executable.%s%sSee Run -> Run parameters -> Local" +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir +msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." +msgstr "" + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg +msgid "The make file \"%s\" is not an executable." +msgstr "" + +#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion +msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "" + +#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion +msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "" + +#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier +msgid "The name %s%s%s is not a valid pascal identifier." +msgstr "" + +#: lazarusidestrconsts:lisinvalidpascalidentifiertext +msgid "The name \"%s\" is not a valid pascal identifier." +msgstr "The name \"%s\" is not a valid pascal identifier." + +#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages +msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." +msgstr "" + +#: lazarusidestrconsts:lisaf2pthepackageisreadonly +msgid "The package %s is read only." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation +msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed +msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" +msgstr "" + +#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans +msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." +msgstr "" + +#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound +msgid "The package %s%s%s is installed, but no valid package file was found.%sA broken dummy package was created." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound +msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus +msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus +msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename +msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." +msgstr "" + +#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe +msgid "The package has already a dependency for the package %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag +msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." +msgstr "" + +#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting +msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean +msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid +msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." +msgstr "" + +#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars +msgid "The page name %s%s%s is too long (max 100 chars)." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject +msgid "The path to the free pascal compiler for this project. Only required if you set the FPC CVS source below. Used to autocreate macros." +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample +msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." +msgstr "" + +#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla +msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" +msgstr "" + +#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency +msgid "The project has already a dependency for the package %s%s%s." +msgstr "" + +#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource +msgid "The project info file %s%s%s%sis equal to the project main source file!" +msgstr "" + +#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest +msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound +msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." +msgstr "" + +#: lazarusidestrconsts:lismakeresstrchooseanothername +msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." +msgstr "" + +#: lazarusidestrconsts:listherootcomponentcannotbedeleted +msgid "The root component can not be deleted." +msgstr "" + +#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming +msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." +msgstr "" + +#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds +msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" +msgstr "" + +#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus +msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." +msgstr "" + +#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject +msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection +msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer +msgid "The unit name %s%s%s and filename differ." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename +msgid "The unit name %s%s%s does not correspond to the filename." +msgstr "" + +#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier +msgid "The unit name %s%s%s is not a valid pascal identifier." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent +msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." +msgstr "" + +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage +msgid "The unitname %s%s%s already exists in the package:%s%s" +msgstr "" + +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage +msgid "The unitname %s%s%s already exists in this package." +msgstr "" + +#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu +msgid "There are more functions in the popupmenu" +msgstr "" + +#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename +msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" +msgstr "" + +#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from +msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage +msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom +msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages +msgid "There is a circle in the required packages. See package graph." +msgstr "" + +#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension +msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" +msgstr "" + +#: lazarusidestrconsts:lisexttoolthereisamaximumoftools +msgid "There is a maximum of %s tools." +msgstr "Er is een maximum van %s hulpmiddelen" + +#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose +msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 +msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:listhereisalreadyaformwiththename +msgid "There is already a form with the name %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile +msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." +msgstr "" + +#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus +msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename +msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages +msgid "There is an unsaved package in the required packages. See package graph." +msgstr "" + +#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent +msgid "There was an error during writing the selected component %s:%s:%s%s" +msgstr "" + +#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe +msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" +msgstr "" + +#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli +msgid "There was an error while copying the component stream to clipboard:%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage +msgid "This file is not in any loaded package." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit +msgid "This file was automatically created by Lazarus. Do not edit!" +msgstr "" + +#: lazarusidestrconsts:lisresourcefilecomment +msgid "This is an automatically generated lazarus resource file" +msgstr "Dies ist eine automatisch erzeugtes resource Datei" + +#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents +msgid "This is the default package. Used only for components without a package. These components are outdated." +msgstr "" + +#: lazarusidestrconsts:listhislookslikeapascalfilefpc10xexpectspascalfiles +msgid "This looks like a pascal file.%sfpc 1.0.x expects pascal files lowercase.%sRename it to lowercase?" +msgstr "" + +#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound +msgid "This package is installed, but the lpk file was not found.All its components are deactivated. Please fix this." +msgstr "" + +#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage +msgid "This source is only used to compile and install the package." +msgstr "" + +#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode +msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." +msgstr "" + +#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired +msgid "Title and Filename required" +msgstr "" + +#: lazarusidestrconsts:dlgpotitle +msgid "Title:" +msgstr "" + +#: lazarusidestrconsts:listodolistcaption +msgid "ToDo List" +msgstr "" + +#: lazarusidestrconsts:listodolistoptions +msgid "ToDo options..." +msgstr "" + +#: lazarusidestrconsts:lishinttoggleformunit +msgid "Toggle Form/Unit" +msgstr "Schakel tussen Form/Unit" + +#: lazarusidestrconsts:srkmectogglemode +msgid "Toggle Mode" +msgstr "" + +#: lazarusidestrconsts:lismenuviewtoggleformunit +msgid "Toggle form/unit view" +msgstr "Schakel tussen Form/Unit zicht" + +#: lazarusidestrconsts:liscodetempltoken +msgid "Token:" +msgstr "Teken:" + +#: lazarusidestrconsts:lisctdefstools +msgid "Tools" +msgstr "Hulpmiddelen" + +#: lazarusidestrconsts:srkmcattoolmenu +msgid "Tools menu commands" +msgstr "Hulpmiddelen menu commando's" + +#: lazarusidestrconsts:dlgtooltipeval +msgid "Tooltip expression evaluation" +msgstr "" + +#: lazarusidestrconsts:dlgtooltiptools +msgid "Tooltip symbol Tools" +msgstr "Tooltip symbool Hulpmiddelen" + +#: lazarusidestrconsts:listopspaceequally +msgid "Top space equally" +msgstr "" + +#: lazarusidestrconsts:dlgtoppos +msgid "Top:" +msgstr "" + +#: lazarusidestrconsts:listops +msgid "Tops" +msgstr "" + +#: lazarusidestrconsts:dlgtrimtrailingspaces +msgid "Trim trailing spaces" +msgstr "" + +#: lazarusidestrconsts:lismenutemplatetutorial +msgid "Tutorial" +msgstr "" + +#: lazarusidestrconsts:dlgenvtype +msgid "Type" +msgstr "" + +#: lazarusidestrconsts:lisuidtype +msgid "Type:" +msgstr "" + +#: lazarusidestrconsts:dlgcdtuppercase +msgid "UPPERCASE" +msgstr "Hoofdletters" + +#: lazarusidestrconsts:lisunableconvertbinarystreamtotext +msgid "Unable convert binary stream to text" +msgstr "" + +#: lazarusidestrconsts:lisunablecopycomponentstoclipboard +msgid "Unable copy components to clipboard" +msgstr "" + +#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith +msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." +msgstr "" + +#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably +msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "" + +#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile +msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "" + +#: lazarusidestrconsts:lisunabletobackupfileto +msgid "Unable to backup file %s%s%s to %s%s%s!" +msgstr "" + +#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist +msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." +msgstr "" + +#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions +msgid "Unable to clean up %s%s%s.%sPlease check permissions." +msgstr "" + +#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory +msgid "Unable to clean up destination directory" +msgstr "" + +#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat +msgid "Unable to convert component text into binary format:%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletoconvertfileerror +msgid "Unable to convert file %s%s%s%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile +msgid "Unable to convert lfm to lrs and write lrs file." +msgstr "" + +#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream +msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" +msgstr "" + +#: lazarusidestrconsts:lisunabletocopyfile +msgid "Unable to copy file" +msgstr "" + +#: lazarusidestrconsts:lisunabletocopyfileto +msgid "Unable to copy file %s%s%s%sto %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletocopyfileto2 +msgid "Unable to copy file %s%s%s%sto %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatebackupdirectory +msgid "Unable to create backup directory %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletocreatedirectory +msgid "Unable to create directory" +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatedirectory2 +msgid "Unable to create directory %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatedirectory +msgid "Unable to create directory %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatefile +msgid "Unable to create file" +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatefile2 +msgid "Unable to create file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatefilename +msgid "Unable to create file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatefile3 +msgid "Unable to create file%s%s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin +msgid "Unable to create new method. Plz fix the error shown in the message window." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage +msgid "Unable to create output directory %s%s%s%sfor package %s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage +msgid "Unable to create package source directory %s%s%s%sfor package %s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus +msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." +msgstr "" + +#: lazarusidestrconsts:lisunabletodeleteambiguousfile +msgid "Unable to delete ambiguous file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletodeletefilename +msgid "Unable to delete file" +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletodeletefile +msgid "Unable to delete file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage +msgid "Unable to delete old state file %s%s%s%sfor package %s." +msgstr "" + +#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe +msgid "Unable to find a ResourceString section in this or any of the used units." +msgstr "" + +#: lazarusidestrconsts:lisunabletofindavalidclassnamein +msgid "Unable to find a valid classname in %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletofindfile +msgid "Unable to find file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption +msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" +msgstr "" + +#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage +msgid "Unable to find method. Plz fix the error shown in the message window." +msgstr "" + +#: lazarusidestrconsts:lisdebugunabletoloadfile +msgid "Unable to load file" +msgstr "" + +#: lazarusidestrconsts:lisdebugunabletoloadfile2 +msgid "Unable to load file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis +msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletoloadpackage +msgid "Unable to load package" +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletoopenthepackage +msgid "Unable to open the package %s%s%s.%sThis package was marked for for installation." +msgstr "" + +#: lazarusidestrconsts:lisunabletoreadfile +msgid "Unable to read file" +msgstr "" + +#: lazarusidestrconsts:lisunabletoreadfile2 +msgid "Unable to read file %s%s%s!" +msgstr "" + +#: lazarusidestrconsts:lisunabletoreadfileerror +msgid "Unable to read file %s%s%s%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lisunabletoreadfilename +msgid "Unable to read file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletoreadpackagefile +msgid "Unable to read package file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror +msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lisunabletoremoveoldbackupfile +msgid "Unable to remove old backup file %s%s%s!" +msgstr "" + +#: lazarusidestrconsts:lisunabletorenameambiguousfileto +msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletorenamefile +msgid "Unable to rename file" +msgstr "" + +#: lazarusidestrconsts:lisunabletorenamefileto +msgid "Unable to rename file %s%s%s to %s%s%s!" +msgstr "" + +#: lazarusidestrconsts:lisunabletorenamefileto2 +msgid "Unable to rename file %s%s%s%sto %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletorenameforminsource +msgid "Unable to rename form in source." +msgstr "" + +#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag +msgid "Unable to rename method. Plz fix the error shown in the message window." +msgstr "" + +#: lazarusidestrconsts:lisunabletorenamevariableinsource +msgid "Unable to rename variable in source." +msgstr "" + +#: lazarusidestrconsts:lisexttoolunabletorunthetool +msgid "Unable to run the tool %s%s%s:%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletosavefile +msgid "Unable to save file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage +msgid "Unable to show method. Plz fix the error shown in the message window." +msgstr "" + +#: lazarusidestrconsts:lisunabletostreamt +msgid "Unable to stream %s:T%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletostreamselectedcomponents +msgid "Unable to stream selected components" +msgstr "" + +#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext +msgid "Unable to transform binary component stream of %s:T%s into text." +msgstr "" + +#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource +msgid "Unable to update CreateForm statement in project source" +msgstr "" + +#: lazarusidestrconsts:lisunabletowrite +msgid "Unable to write %s%s%s%s%s." +msgstr "" + +#: lazarusidestrconsts:lisunabletowritefile +msgid "Unable to write file" +msgstr "" + +#: lazarusidestrconsts:lisunabletowritefile2 +msgid "Unable to write file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletowritefileerror +msgid "Unable to write file %s%s%s%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lisunabletowritefilename +msgid "Unable to write file %s%s%s." +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror +msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror +msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" +msgstr "" + +#: lazarusidestrconsts:lisunabletowritetofile2 +msgid "Unable to write to file %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lisunabletowritetofile +msgid "Unable to write to file %s%s%s!" +msgstr "" + +#: lazarusidestrconsts:dlguncertopt +msgid "Uncertain Optimizations" +msgstr "" + +#: lazarusidestrconsts:lismenuuncommentselection +msgid "Uncomment selection" +msgstr "Commentaar Selectie ongedaan maken" + +#: lazarusidestrconsts:liscodetoolsdefsundefine +msgid "Undefine" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsundefineall +msgid "Undefine All" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse +msgid "Undefine Recurse" +msgstr "" + +#: lazarusidestrconsts:dlgedunder +msgid "Underline" +msgstr "" + +#: lazarusidestrconsts:lismenuundo +msgid "Undo" +msgstr "Ongedaan maken" + +#: lazarusidestrconsts:dlgundoaftersave +msgid "Undo after save" +msgstr "Ongedaan maken na Opslaan" + +#: lazarusidestrconsts:dlgundolimit +msgid "Undo limit:" +msgstr "Ongedaan maken Limiet" + +#: lazarusidestrconsts:srkmecblockunindent +msgid "Unindent block" +msgstr "Unindent Blok" + +#: lazarusidestrconsts:lismenuunindentselection +msgid "Unindent selection" +msgstr "Selectie Inspringen ongedaan maken" + +#: lazarusidestrconsts:lispckedituninstall +msgid "Uninstall" +msgstr "De-installeer" + +#: lazarusidestrconsts:lispckexpluninstallonnextstart +msgid "Uninstall on next start" +msgstr "De-installeer bij volgende start" + +#: lazarusidestrconsts:lispkgmanguninstallpackage2 +msgid "Uninstall package %s?" +msgstr "" + +#: lazarusidestrconsts:lispkgmanguninstallpackage +msgid "Uninstall package?" +msgstr "" + +#: lazarusidestrconsts:lisuninstallselection +msgid "Uninstall selection" +msgstr "De-installeer Selectie" + +#: lazarusidestrconsts:lispkgfiletypeunit +msgid "Unit" +msgstr "Unit" + +#: lazarusidestrconsts:lisunithaschangedsave +msgid "Unit %s%s%s has changed. Save?" +msgstr "" + +#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage +msgid "Unit %s%s%s was removed from package" +msgstr "" + +#: lazarusidestrconsts:lisa2punitfilename2 +msgid "Unit File Name:" +msgstr "" + +#: lazarusidestrconsts:uemunitinfo +msgid "Unit Info" +msgstr "" + +#: lazarusidestrconsts:lisa2punitnameinvalid +msgid "Unit Name Invalid" +msgstr "" + +#: lazarusidestrconsts:lisa2punitname +msgid "Unit Name:" +msgstr "" + +#: lazarusidestrconsts:lisaf2punitname +msgid "Unit Name: " +msgstr "" + +#: lazarusidestrconsts:lisunitoutputdirectory +msgid "Unit Output directory" +msgstr "" + +#: lazarusidestrconsts:lispkgdefsunitpath +msgid "Unit Path" +msgstr "" + +#: lazarusidestrconsts:dlgcounitstyle +msgid "Unit Style:" +msgstr "" + +#: lazarusidestrconsts:dlgunitdepcaption +msgid "Unit dependencies" +msgstr "Unit afhankelijkheden" + +#: lazarusidestrconsts:lisa2punitfilename +msgid "Unit file name:" +msgstr "" + +#: lazarusidestrconsts:lisunitidentifierexists +msgid "Unit identifier exists" +msgstr "" + +#: lazarusidestrconsts:lisprojaddunitnamealreadyexists +msgid "Unit name already exists" +msgstr "" + +#: lazarusidestrconsts:lispkgsysunitnotfound +msgid "Unit not found: %s%s%s" +msgstr "" + +#: lazarusidestrconsts:dlgunitoutp +msgid "Unit output directory (-FE):" +msgstr "" + +#: lazarusidestrconsts:lisunitsnotfound +msgid "Unit(s) not found" +msgstr "" + +#: lazarusidestrconsts:lisunitlfmfile +msgid "Unit: %s%sLFM file: %s" +msgstr "" + +#: lazarusidestrconsts:lisa2punitnamealreadyexists +msgid "Unitname already exists" +msgstr "" + +#: lazarusidestrconsts:lisunitnamealreadyexistscap +msgid "Unitname already in project" +msgstr "Unitname existiert bereits im Projekt" + +#: lazarusidestrconsts:lismenuviewunits +msgid "Units..." +msgstr "Units..." + +#: lazarusidestrconsts:srvk_unknown +msgid "Unknown" +msgstr "Onbekend" + +#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug +msgid "Unknown Error, please report this bug" +msgstr "Onbekende fout, mail deze fout a.u.b. " + +#: lazarusidestrconsts:lispkgmangunsavedpackage +msgid "Unsaved package" +msgstr "" + +#: lazarusidestrconsts:dlgupword +msgid "Up" +msgstr "Naar boven" + +#: lazarusidestrconsts:lispckoptsupdaterebuild +msgid "Update/Rebuild" +msgstr "Update/Herbouwen" + +#: lazarusidestrconsts:lismenuuppercaseselection +msgid "Uppercase selection" +msgstr "Verander selectie in hoofdletters" + +#: lazarusidestrconsts:lispckoptsusage +msgid "Usage" +msgstr "" + +#: lazarusidestrconsts:dlgcoansistr +msgid "Use Ansi Strings" +msgstr "" + +#: lazarusidestrconsts:dlgcoheaptrc +msgid "Use Heaptrc Unit" +msgstr "" + +#: lazarusidestrconsts:dlgusecustomconfig +msgid "Use addional Compiler Config File" +msgstr "" + +#: lazarusidestrconsts:dlgedusedefcolor +msgid "Use default color" +msgstr "" + +#: lazarusidestrconsts:dlgrunousedisplay +msgid "Use display" +msgstr "" + +#: lazarusidestrconsts:dlguselaunchingapp +msgid "Use launching application" +msgstr "" + +#: lazarusidestrconsts:dlgusefpccfg +msgid "Use standard Compiler Config File (fpc.cfg)" +msgstr "" + +#: lazarusidestrconsts:dlgusesyntaxhighlight +msgid "Use syntax highlight" +msgstr "" + +#: lazarusidestrconsts:rsiwpusewindowmanagersetting +msgid "Use windowmanager setting" +msgstr "" + +#: lazarusidestrconsts:srkmecuserfirst +msgid "User First" +msgstr "" + +#: lazarusidestrconsts:dlgedcustomext +msgid "User defined extension" +msgstr "" + +#: lazarusidestrconsts:dlgcustomext +msgid "User defined extension (.pp.xxx)" +msgstr "" + +#: lazarusidestrconsts:dlgrunouseroverrides +msgid "User overrides" +msgstr "" + +#: lazarusidestrconsts:dlgvaluecolor +msgid "Value" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths +msgid "Value as File Paths" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsvalueastext +msgid "Value as Text" +msgstr "" + +#: lazarusidestrconsts:dlgrunovariable +msgid "Variable" +msgstr "" + +#: lazarusidestrconsts:lisctdefvariablename +msgid "Variable Name" +msgstr "" + +#: lazarusidestrconsts:dlgcdtvariableprefix +msgid "Variable prefix" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsvariable +msgid "Variable:" +msgstr "" + +#: lazarusidestrconsts:lisctdefvariable +msgid "Variable: %s" +msgstr "" + +#: lazarusidestrconsts:dlgverbosity +msgid "Verbosity during compilation:" +msgstr "" + +#: lazarusidestrconsts:lisversion +msgid "Version" +msgstr "Versie" + +#: lazarusidestrconsts:lisvertical +msgid "Vertical" +msgstr "Verticaal" + +#: lazarusidestrconsts:dlggridyhint +msgid "Vertical grid step size" +msgstr "" + +#: lazarusidestrconsts:lismenuviewanchoreditor +msgid "View Anchor Editor" +msgstr "Toon Anchor Editor" + +#: lazarusidestrconsts:uemviewcallstackcursor +msgid "View Call Stack" +msgstr "Toon Call Stack" + +#: lazarusidestrconsts:srkmectogglecodeexpl +msgid "View Code Explorer" +msgstr "Toon Code Verkenner" + +#: lazarusidestrconsts:lishintviewforms +msgid "View Forms" +msgstr "Toon Forms" + +#: lazarusidestrconsts:lismenuviewjumphistory +msgid "View Jump-History" +msgstr "Toon Springpunt geschiedenis" + +#: lazarusidestrconsts:srkmectoggleobjectinsp +msgid "View Object Inspector" +msgstr "Toon Object Inspector" + +#: lazarusidestrconsts:lispckeditviewpackgesource +msgid "View Package Source" +msgstr "Toon Package Source" + +#: lazarusidestrconsts:lisviewprojectunits +msgid "View Project Units" +msgstr "Toon Project Units" + +#: lazarusidestrconsts:srkmectogglesearchresults +msgid "View Search Results" +msgstr "Toon zoek resultaten" + +#: lazarusidestrconsts:lismenuviewsource +msgid "View Source" +msgstr "Toon Broncode" + +#: lazarusidestrconsts:srkmectogglesourceeditor +msgid "View Source Editor" +msgstr "Toon Broncode Editor" + +#: lazarusidestrconsts:lismenuviewprojecttodos +msgid "View ToDo List" +msgstr "Toon ToDo Lijst" + +#: lazarusidestrconsts:lismenuviewunitdependencies +msgid "View Unit Dependencies" +msgstr "Toon Unit Afhankelijkheden" + +#: lazarusidestrconsts:lismenuviewunitinfo +msgid "View Unit Information" +msgstr "Toon Unit informatie" + +#: lazarusidestrconsts:lishintviewunits +msgid "View Units" +msgstr "Toon Units" + +#: lazarusidestrconsts:srkmecviewanchoreditor +msgid "View anchor editor" +msgstr "" + +#: lazarusidestrconsts:srkmectogglebreakpoints +msgid "View breakpoints" +msgstr "Toon Breekpunten" + +#: lazarusidestrconsts:srkmectogglecallstack +msgid "View call stack" +msgstr "Toon Call Stack" + +#: lazarusidestrconsts:srkmectoggledebuggerout +msgid "View debugger output" +msgstr "Toon Debugger output " + +#: lazarusidestrconsts:srkmecviewforms +msgid "View forms" +msgstr "Toon Forms" + +#: lazarusidestrconsts:srkmectogglelocals +msgid "View local variables" +msgstr "Toon lokale variabelen" + +#: lazarusidestrconsts:srkmcatviewmenu +msgid "View menu commands" +msgstr "Toon Menu commando's" + +#: lazarusidestrconsts:srkmectogglemessages +msgid "View messages" +msgstr "Toon Berichten" + +#: lazarusidestrconsts:dlgmainviewforms +msgid "View project forms" +msgstr "Toon Project Forms" + +#: lazarusidestrconsts:dlgmainviewunits +msgid "View project units" +msgstr "Toon Project Units" + +#: lazarusidestrconsts:srkmecviewunitdependencies +msgid "View unit dependencies" +msgstr "Toon Unit Afhankelijkheden" + +#: lazarusidestrconsts:srkmecviewunitinfo +msgid "View unit information" +msgstr "Toon Unit informatie" + +#: lazarusidestrconsts:srkmecviewunits +msgid "View units" +msgstr "Toon Units" + +#: lazarusidestrconsts:srkmectogglewatches +msgid "View watches" +msgstr "Toon Watches" + +#: lazarusidestrconsts:lishlpoptsviewers +msgid "Viewers" +msgstr "" + +#: lazarusidestrconsts:lispkgfiletypevirtualunit +msgid "Virtual Unit" +msgstr "Virtuele Unit" + +#: lazarusidestrconsts:lisaf2pisvirtualunit +msgid "Virtual unit (source is not in package)" +msgstr "" + +#: lazarusidestrconsts:dlgvisiblegutter +msgid "Visible gutter" +msgstr "" + +#: lazarusidestrconsts:dlgvisiblerightmargin +msgid "Visible right margin" +msgstr "" + +#: lazarusidestrconsts:dlgambigwarn +msgid "Warn on compile" +msgstr "" + +#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena +msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." +msgstr "" + +#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject +msgid "Warning: The file %s%s%s%sbelongs to the current project." +msgstr "" + +#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis +msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" +msgstr "" + +#: lazarusidestrconsts:lismenuviewwatches +msgid "Watches" +msgstr "Watches" + +#: lazarusidestrconsts:dlgautocreatenewforms +msgid "When creating new forms, add them to auto-created forms" +msgstr "" + +#: lazarusidestrconsts:lisfindfilewhere +msgid "Where" +msgstr "" + +#: lazarusidestrconsts:dlgwholewordsonly +msgid "Whole Words Only" +msgstr "" + +#: lazarusidestrconsts:lisfindfilewholewordsonly +msgid "Whole words only" +msgstr "" + +#: lazarusidestrconsts:dlgwidthpos +msgid "Width:" +msgstr "Breedte:" + +#: lazarusidestrconsts:dlgwinpos +msgid "Window Positions" +msgstr "Venster Posities" + +#: lazarusidestrconsts:dlgwindows +msgid "Windows" +msgstr "Vensters" + +#: lazarusidestrconsts:lislazbuildwithstaticpackages +msgid "With Packages" +msgstr "" + +#: lazarusidestrconsts:liswordatcursorincurrenteditor +msgid "Word at cursor in current editor" +msgstr "Wort an der aktuellen editor position" + +#: lazarusidestrconsts:srkmecwordcompletion +msgid "Word completion" +msgstr "" + +#: lazarusidestrconsts:dlgwordspolicies +msgid "Words" +msgstr "" + +#: lazarusidestrconsts:lisedtexttoolworkingdirectory +msgid "Working Directory:" +msgstr "" + +#: lazarusidestrconsts:dlgroworkingdirectory +msgid "Working directory" +msgstr "" + +#: lazarusidestrconsts:liswriteerror +msgid "Write Error" +msgstr "" + +#: lazarusidestrconsts:dlgwritefpclogo +msgid "Write an FPC logo" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefswriteerror +msgid "Write error" +msgstr "" + +#: lazarusidestrconsts:dlgcdtwriteprefix +msgid "Write prefix" +msgstr "" + +#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling +msgid "You can not build lazarus while debugging or compiling." +msgstr "" + +#: lazarusidestrconsts:dlgdoesnotexist +msgid "\" does not exist." +msgstr "\" nicht gefunden." + +#: lazarusidestrconsts:uefilerotext2 +msgid "\" is not writable." +msgstr "\" ist schreibgeschuetzt." + +#: lazarusidestrconsts:srkmecabortbuild +msgid "abort build" +msgstr "" + +#: lazarusidestrconsts:srkmecaddbreakpoint +msgid "add break point" +msgstr "" + +#: lazarusidestrconsts:srkmecaddwatch +msgid "add watch" +msgstr "" + +#: lazarusidestrconsts:srvk_apps +msgid "application key" +msgstr "" + +#: lazarusidestrconsts:lisoipautoinstalldynamic +msgid "auto install dynamic" +msgstr "" + +#: lazarusidestrconsts:lisoipautoinstallstatic +msgid "auto install static" +msgstr "" + +#: lazarusidestrconsts:srkmecbuildall +msgid "build all files of program/project" +msgstr "" + +#: lazarusidestrconsts:srkmecbuildfile +msgid "build file" +msgstr "" + +#: lazarusidestrconsts:srkmecbuild +msgid "build program/project" +msgstr "" + +#: lazarusidestrconsts:dlglefttopclr +msgid "color for left, top" +msgstr "" + +#: lazarusidestrconsts:dlgrightbottomclr +msgid "color for right, bottom" +msgstr "" + +#: lazarusidestrconsts:srkmeccompileroptions +msgid "compiler options" +msgstr "compiler opties" + +#: lazarusidestrconsts:liscodetoolsdefscompilerpath +msgid "compiler path" +msgstr "" + +#: lazarusidestrconsts:srkmecconfigbuildfile +msgid "config build file" +msgstr "" + +#: lazarusidestrconsts:liscustomoptions +msgid "custom options" +msgstr "aanpasbare opties" + +#: lazarusidestrconsts:liscodefault +msgid "default (%s)" +msgstr "" + +#: lazarusidestrconsts:srkmecevaluate +msgid "evaluate/modify" +msgstr "" + +#: lazarusidestrconsts:lisuidinproject +msgid "in Project:" +msgstr "" + +#: lazarusidestrconsts:lisfriinallopenpackagesandprojects +msgid "in all open packages and projects" +msgstr "" + +#: lazarusidestrconsts:lisfriincurrentunit +msgid "in current unit" +msgstr "" + +#: lazarusidestrconsts:lisfriinmainproject +msgid "in main project" +msgstr "" + +#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit +msgid "in project/package owning current unit" +msgstr "" + +#: lazarusidestrconsts:lisincludepath +msgid "include path" +msgstr "" + +#: lazarusidestrconsts:srkmecinspect +msgid "inspect" +msgstr "" + +#: lazarusidestrconsts:lisoipinstalleddynamic +msgid "installed dynamic" +msgstr "" + +#: lazarusidestrconsts:lisoipinstalledstatic +msgid "installed static" +msgstr "" + +#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename +msgid "invalid Compiler filename" +msgstr "" + +#: lazarusidestrconsts:lislazarusoptionsprojectfilename +msgid "lazarus [options] " +msgstr "" + +#: lazarusidestrconsts:srvk_lwin +msgid "left windows key" +msgstr "" + +#: lazarusidestrconsts:lislibrarypath +msgid "library path" +msgstr "Bibliotheek pad" + +#: lazarusidestrconsts:lislinkeroptions +msgid "linker options" +msgstr "" + +#: lazarusidestrconsts:dlgcdtlower +msgid "lowercase" +msgstr "Kleine letters" + +#: lazarusidestrconsts:lisoipmissing +msgid "missing" +msgstr "niet aanwwezig" + +#: lazarusidestrconsts:lisoipmodified +msgid "modified" +msgstr "" + +#: lazarusidestrconsts:lisuidno +msgid "no" +msgstr "" + +#: lazarusidestrconsts:dlgnoautomaticrenaming +msgid "no automatic renaming" +msgstr "" + +#: lazarusidestrconsts:lisnoname +msgid "noname" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsnoneselected +msgid "none selected" +msgstr "" + +#: lazarusidestrconsts:lisobjectpath +msgid "object path" +msgstr "" + +#: lazarusidestrconsts:lispckeditpackagenotsaved +msgid "package %s not saved" +msgstr "" + +#: lazarusidestrconsts:lispkgmangpackagemainsourcefile +msgid "package main source file" +msgstr "" + +#: lazarusidestrconsts:srkmecpause +msgid "pause program" +msgstr "" + +#: lazarusidestrconsts:lisoipreadonly +msgid "readonly" +msgstr "" + +#: lazarusidestrconsts:srkmecremovebreakpoint +msgid "remove break point" +msgstr "" + +#: lazarusidestrconsts:srkmecresetdebugger +msgid "reset debugger" +msgstr "" + +#: lazarusidestrconsts:srvk_rwin +msgid "right windows key" +msgstr "" + +#: lazarusidestrconsts:srkmecrunfile +msgid "run file" +msgstr "" + +#: lazarusidestrconsts:srkmecrunparameters +msgid "run parameters" +msgstr "" + +#: lazarusidestrconsts:srkmecrun +msgid "run program" +msgstr "" + +#: lazarusidestrconsts:lissaveallmodified +msgid "save all modified files" +msgstr "Alles speichern" + +#: lazarusidestrconsts:lissavecurrenteditorfile +msgid "save current editor file" +msgstr "Speichern des aktuellen editors" + +#: lazarusidestrconsts:lisfindfilesearchallfilesinproject +msgid "search all files in project" +msgstr "" + +#: lazarusidestrconsts:lisfindfilesearchallopenfiles +msgid "search all open files" +msgstr "" + +#: lazarusidestrconsts:lisfindfilesearchindirectories +msgid "search in directories" +msgstr "" + +#: lazarusidestrconsts:dlgtimesecondunit +msgid "sec" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi +msgid "set FPC mode to DELPHI" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc +msgid "set FPC mode to GPC" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetotp +msgid "set FPC mode to TP" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetiocheckson +msgid "set IOCHECKS on" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetoverflowcheckson +msgid "set OVERFLOWCHECKS on" +msgstr "" + +#: lazarusidestrconsts:lisedtdefsetrangecheckson +msgid "set RANGECHECKS on" +msgstr "" + +#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile +msgid "static packages config file" +msgstr "" + +#: lazarusidestrconsts:srkmecstopprogram +msgid "stop program" +msgstr "Stop programma" + +#: lazarusidestrconsts:listhishelpmessage +msgid "this help message" +msgstr "Dit Help bericht" + +#: lazarusidestrconsts:lisunitpath +msgid "unit path" +msgstr "Unit pad" + +#: lazarusidestrconsts:srkmecunknown +msgid "unknown editor command" +msgstr "Onbekend Editor commando" + +#: lazarusidestrconsts:lisedtdefuseheaptrcunit +msgid "use HeapTrc unit" +msgstr "" + +#: lazarusidestrconsts:lisedtdefuselineinfounit +msgid "use LineInfo unit" +msgstr "" + +#: lazarusidestrconsts:lisuidyes +msgid "yes" +msgstr "Ja" + diff --git a/languages/lazaruside.pl.po b/languages/lazaruside.pl.po index 8afa6429b6..a7ed3e0a48 100644 --- a/languages/lazaruside.pl.po +++ b/languages/lazaruside.pl.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "W tył" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Kolor tła" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "Domyślna czcionka edytora" msgid "Default pascal extension" msgstr "Domyślne rozszerzenie pascala" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "\"Define\"" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "Uzupełnianie właściwości" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Odśwież" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "Podkatalog" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Przełącz ścieżki" @@ -7169,7 +7185,7 @@ msgstr "Inne rozszerzenie (.pp.xxx)" msgid "User overrides" msgstr "Nadpisanie zmiennych" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Wartość" diff --git a/languages/lazaruside.pliso.po b/languages/lazaruside.pliso.po index f84ffcd4bb..8ce98b5422 100644 --- a/languages/lazaruside.pliso.po +++ b/languages/lazaruside.pliso.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "W ty" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Kolor ta" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "Domy msgid "Default pascal extension" msgstr "Domylne rozszerzenie pascala" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "\"Define\"" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "Uzupenianie waciwoci" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Odwie" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "Podkatalog" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Przecz cieki" @@ -7169,7 +7185,7 @@ msgstr "Inne rozszerzenie (.pp.xxx)" msgid "User overrides" msgstr "Nadpisanie zmiennych" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Warto" diff --git a/languages/lazaruside.plwin.po b/languages/lazaruside.plwin.po index a32eec0432..17842bb879 100644 --- a/languages/lazaruside.plwin.po +++ b/languages/lazaruside.plwin.po @@ -618,8 +618,8 @@ msgid "Back" msgstr "W ty" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Kolor ta" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1625,6 +1625,10 @@ msgstr "Domy msgid "Default pascal extension" msgstr "Domylne rozszerzenie pascala" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "\"Define\"" @@ -4729,6 +4733,10 @@ msgstr "" msgid "Property completion" msgstr "Uzupenianie waciwoci" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" @@ -4825,6 +4833,10 @@ msgstr "" msgid "Refactoring" msgstr "" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Odwie" @@ -5877,6 +5889,10 @@ msgstr "" msgid "Sub directory" msgstr "Podkatalog" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Przecz cieki" @@ -7169,7 +7185,7 @@ msgstr "Inne rozszerzenie (.pp.xxx)" msgid "User overrides" msgstr "Nadpisanie zmiennych" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Warto" diff --git a/languages/lazaruside.po b/languages/lazaruside.po index e80e931d78..2a78445f65 100644 --- a/languages/lazaruside.po +++ b/languages/lazaruside.po @@ -1983,7 +1983,27 @@ msgid "Ignore" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" +msgid "Background" +msgstr "" + +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + +#: lazarusidestrconsts:dlgvaluecolor +msgid "Value" +msgstr "" + +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" msgstr "" #: lazarusidestrconsts:dlgoimiscellaneous diff --git a/languages/lazaruside.ru.po b/languages/lazaruside.ru.po index 5aa8d6acc6..afdbadb747 100644 --- a/languages/lazaruside.ru.po +++ b/languages/lazaruside.ru.po @@ -607,8 +607,8 @@ msgid "Back" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr " " +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1614,6 +1614,10 @@ msgstr " msgid "Default pascal extension" msgstr " " +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4718,6 +4722,10 @@ msgstr " msgid "Property completion" msgstr " " +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "ݣ " @@ -4814,6 +4822,10 @@ msgstr " msgid "Refactoring" msgstr " " +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5866,6 +5878,10 @@ msgstr " msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr " " @@ -7158,7 +7174,7 @@ msgstr " msgid "User overrides" msgstr " " -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/lazaruside.ruutf.po b/languages/lazaruside.ruutf.po index b9ebfe0191..ee07eaf6fd 100644 --- a/languages/lazaruside.ruutf.po +++ b/languages/lazaruside.ruutf.po @@ -607,8 +607,8 @@ msgid "Back" msgstr "Назад" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr "Цвет фона" +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1614,6 +1614,10 @@ msgstr "Шрифт редактора по умолчанию" msgid "Default pascal extension" msgstr "Стандартное расширение паскаля" +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Определение" @@ -4718,6 +4722,10 @@ msgstr "Свойства:" msgid "Property completion" msgstr "Завершение свойств" +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Защищённый метод" @@ -4814,6 +4822,10 @@ msgstr "Уменьшить прорисовку дизайнеров" msgid "Refactoring" msgstr "Переработка кода" +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Обновить" @@ -5866,6 +5878,10 @@ msgstr "Подпроцедура того же уровня" msgid "Sub directory" msgstr "Подкаталог" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "Переключить пути" @@ -7158,7 +7174,7 @@ msgstr "Расширение пользователя (.pp.xxx)" msgid "User overrides" msgstr "Пользовательские замены" -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Значение" diff --git a/languages/lazaruside.ruwin.po b/languages/lazaruside.ruwin.po index 0f5597c277..cd6f2b1797 100644 --- a/languages/lazaruside.ruwin.po +++ b/languages/lazaruside.ruwin.po @@ -607,8 +607,8 @@ msgid "Back" msgstr "" #: lazarusidestrconsts:dlgbackcolor -msgid "Background color" -msgstr " " +msgid "Background" +msgstr "" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -1614,6 +1614,10 @@ msgstr " msgid "Default pascal extension" msgstr " " +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" @@ -4718,6 +4722,10 @@ msgstr " msgid "Property completion" msgstr " " +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "" + #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr " " @@ -4814,6 +4822,10 @@ msgstr " msgid "Refactoring" msgstr " " +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "" + #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" @@ -5866,6 +5878,10 @@ msgstr " msgid "Sub directory" msgstr "" +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "" + #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr " " @@ -7158,7 +7174,7 @@ msgstr " msgid "User overrides" msgstr " " -#: lazarusidestrconsts:dlgrunovalue +#: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "" diff --git a/languages/objinspstrconsts.ca.po b/languages/objinspstrconsts.ca.po index 43ecbb556c..731a119afb 100644 --- a/languages/objinspstrconsts.ca.po +++ b/languages/objinspstrconsts.ca.po @@ -16,11 +16,11 @@ msgstr " Imatge seleccionada " #: objinspstrconsts:oishelpalreadyregistered msgid "%s: Already registered" -msgstr "%s: Ja registrat" +msgstr "%s: Ja est registrat" #: objinspstrconsts:oishelpnotregistered msgid "%s: Not registered" -msgstr "%s: No registrat" +msgstr "%s: No est registrat" #: objinspstrconsts:oisitemsselected msgid "%u items selected" @@ -28,51 +28,51 @@ msgstr "%u elements seleccionats" #: objinspstrconsts:oiscadd msgid "&Add" -msgstr "&Afegir" +msgstr "&Afegeix" #: objinspstrconsts:oistdactdatasetcancelheadline msgid "&Cancel" -msgstr "&Cancellar" +msgstr "&Cancella" #: objinspstrconsts:oistdacthelpcontentsheadline msgid "&Contents" -msgstr "" +msgstr "&ndex" #: objinspstrconsts:oistdacteditcopyheadline msgid "&Copy" -msgstr "" +msgstr "Co&pia" #: objinspstrconsts:oiscdelete msgid "&Delete" -msgstr "E&sborrar" +msgstr "&Elimina" #: objinspstrconsts:oistdactdataseteditheadline msgid "&Edit" -msgstr "" +msgstr "&Edita" #: objinspstrconsts:oistdactdatasetfirstheadline msgid "&First" -msgstr "" +msgstr "&Primer" #: objinspstrconsts:oistdacthelphelphelpheadline msgid "&Help on Help" -msgstr "" +msgstr "&Ajuda en l'ajuda" #: objinspstrconsts:oistdactdatasetinsertheadline msgid "&Insert" -msgstr "" +msgstr "&Insereix" #: objinspstrconsts:oistdactdatasetlastheadline msgid "&Last" -msgstr "" +msgstr "<im" #: objinspstrconsts:oisload msgid "&Load" -msgstr "Ca&rregar" +msgstr "Ca&rrega" #: objinspstrconsts:oistdactdatasetnextheadline msgid "&Next" -msgstr "" +msgstr "Sege&nt" #: objinspstrconsts:oisok msgid "&OK" @@ -80,31 +80,31 @@ msgstr "D'ac&ord" #: objinspstrconsts:oistdactfileopenheadline msgid "&Open..." -msgstr "" +msgstr "&Obre.." #: objinspstrconsts:oistdacteditpasteheadline msgid "&Paste" -msgstr "" +msgstr "&Enganxa" #: objinspstrconsts:oistdactdatasetpriorheadline msgid "&Prior" -msgstr "" +msgstr "&Passat" #: objinspstrconsts:oistdactdatasetrefreshheadline msgid "&Refresh" -msgstr "" +msgstr "&Refresca" #: objinspstrconsts:oissave msgid "&Save" -msgstr "&Guardar" +msgstr "&Desa" #: objinspstrconsts:oistdacthelptopicsearchheadline msgid "&Topic Search" -msgstr "" +msgstr "Cerca el con&tingut" #: objinspstrconsts:oistdacteditundoheadline msgid "&Undo" -msgstr "" +msgstr "De&sfs" #: objinspstrconsts:cactionlisteditorallcategory msgid "(All)" @@ -120,11 +120,11 @@ msgstr "Acci #: objinspstrconsts:oisactionlisteditor msgid "Action List Editor" -msgstr "Editor de llista d'accions" +msgstr "Editor de la llista d'accions" #: objinspstrconsts:sccsilbtnadd msgid "Add ..." -msgstr "Afegir ..." +msgstr "Afegeix ..." #: objinspstrconsts:oisall msgid "All" @@ -140,7 +140,7 @@ msgstr "Conjunt" #: objinspstrconsts:oisstdactionlisteditorclass msgid "Available Action Classes:" -msgstr "" +msgstr "Classes d'acci disponibles:" #: objinspstrconsts:oisboolean msgid "Boolean" @@ -148,19 +148,19 @@ msgstr "Boole #: objinspstrconsts:oishelpbrowsernotexecutable msgid "Browser %s%s%s not executable." -msgstr "Navegador %s%s%s no executable." +msgstr "El navegador %s%s%s no s executable." #: objinspstrconsts:oishelpbrowsernotfound msgid "Browser %s%s%s not found." -msgstr "Navegador %s%s%s no trobat." +msgstr "No s'ha trobat el navegador %s%s%s." #: objinspstrconsts:oisclear msgid "C&lear" -msgstr "Ne&tejar" +msgstr "Ne&teja" #: objinspstrconsts:oistdactdatasetcancel1hint msgid "Cancel" -msgstr "" +msgstr "Cancella" #: objinspstrconsts:oiscategory msgid "Category" @@ -176,95 +176,95 @@ msgstr "Classe" #: objinspstrconsts:sccsilbtnclear msgid "Clear" -msgstr "Netejar" +msgstr "Neteja" #: objinspstrconsts:oistdactcolorselecthint msgid "Color Select" -msgstr "" +msgstr "Selecciona el color" #: objinspstrconsts:oisconfirmdelete msgid "Confirm delete" -msgstr "Confirmar esborrar" +msgstr "Confirma l'eliminaci" #: objinspstrconsts:sccsilconfirme msgid "Confirme clear all images ?" -msgstr "Confirmar esborrar totes les imatges ?" +msgstr "Voleu confirmar la neteja de totes les imatges ?" #: objinspstrconsts:oistdacteditcopyshorthint msgid "Copy" -msgstr "" +msgstr "Copia" #: objinspstrconsts:oiscreatedefaultevent msgid "Create default event" -msgstr "Crear esdeveniment predeterminat" +msgstr "Crea l'esdeveniment predeterminat" #: objinspstrconsts:oistdacteditselectallshortcut msgid "Ctrl+A" -msgstr "" +msgstr "Ctrl+A" #: objinspstrconsts:oistdacteditcopyshortcut msgid "Ctrl+C" -msgstr "" +msgstr "Ctrl+C" #: objinspstrconsts:oistdactfileopenshortcut msgid "Ctrl+O" -msgstr "" +msgstr "Ctrl+O" #: objinspstrconsts:oistdacteditpasteshortcut msgid "Ctrl+V" -msgstr "" +msgstr "Ctrl+V" #: objinspstrconsts:oistdacteditcutshortcut msgid "Ctrl+X" -msgstr "" +msgstr "Ctrl+X" #: objinspstrconsts:oistdacteditundoshortcut msgid "Ctrl+Z" -msgstr "" +msgstr "Ctrl+Z" #: objinspstrconsts:oistdacteditcutheadline msgid "Cu&t" -msgstr "" +msgstr "&Talla" #: objinspstrconsts:oistdacteditcutshorthint msgid "Cut" -msgstr "" +msgstr "Talla" #: objinspstrconsts:cactionlisteditordatabasecategory msgid "Database" -msgstr "" +msgstr "Base de dades" #: objinspstrconsts:oistdacteditdeleteshortcut msgid "Del" -msgstr "" +msgstr "Del" #: objinspstrconsts:sccslvedtbtndel msgid "Delete" -msgstr "Esborrar" +msgstr "Elimina" #: objinspstrconsts:cactionlisteditordeleteactionhint msgid "Delete Action" -msgstr "" +msgstr "Elimina l'acci" #: objinspstrconsts:oisdeleteitem msgid "Delete item %s%s%s?" -msgstr "Esborrar element %s%s%s?" +msgstr "Voleu eliminar l'element %s%s%s?" #: objinspstrconsts:cactionlisteditordialogcategory msgid "Dialog" -msgstr "" +msgstr "Dileg" #: objinspstrconsts:oistdactfileexitheadline msgid "E&xit" -msgstr "" +msgstr "Su&rt" #: objinspstrconsts:cactionlisteditoreditcategory msgid "Edit" -msgstr "" +msgstr "Edita" #: objinspstrconsts:oiseditactionlist msgid "Edit action list..." -msgstr "Editar llista d'accions..." +msgstr "Edita la llista d'accions..." #: objinspstrconsts:oisenumeration msgid "Enumeration" @@ -272,19 +272,19 @@ msgstr "Enumeraci #: objinspstrconsts:oiserror msgid "Error" -msgstr "Error" +msgstr "S'ha produt un error" #: objinspstrconsts:oiserrorloadingimage msgid "Error loading image" -msgstr "Error carregant imatge" +msgstr "S'ha produt un error mentre es carregava l'imatge" #: objinspstrconsts:oiserrorloadingimage2 msgid "Error loading image %s%s%s:%s%s" -msgstr "Error carregant imatge %s%s%s:%s%s" +msgstr "S'ha produt un error mentre es carregava l'imatge %s%s%s:%s%s" #: objinspstrconsts:oishelperrorwhileexecuting msgid "Error while executing %s%s%s:%s%s" -msgstr "Error executant %s%s%s:%s%s" +msgstr "S'ha produt un error mentre s'executava %s%s%s:%s%s" #: objinspstrconsts:oisevents msgid "Events" @@ -292,19 +292,19 @@ msgstr "Esdeveniments" #: objinspstrconsts:oistdactfileexithint msgid "Exit" -msgstr "" +msgstr "Surt" #: objinspstrconsts:oisfavourites msgid "Favourites" -msgstr "" +msgstr "Favorits" #: objinspstrconsts:cactionlisteditorfilecategory msgid "File" -msgstr "" +msgstr "Fitxer" #: objinspstrconsts:oistdactdatasetfirsthint msgid "First" -msgstr "" +msgstr "Primer" #: objinspstrconsts:oisfloat msgid "Float" @@ -312,15 +312,15 @@ msgstr "Float" #: objinspstrconsts:oistdactfontedithint msgid "Font Select" -msgstr "" +msgstr "Selecciona la font" #: objinspstrconsts:cactionlisteditorhelpcategory msgid "Help" -msgstr "" +msgstr "Ajuda" #: objinspstrconsts:oistdacthelpcontentshint msgid "Help Contents" -msgstr "" +msgstr "Contingut de l'ajuda" #: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" @@ -332,39 +332,39 @@ msgstr "No s'ha trobat la base de dades de l'ajuda %s%s%s" #: objinspstrconsts:oishelphelpcontextnotfoundindatabase msgid "Help context %s not found in Database %s%s%s." -msgstr "El context d'ajuda %s no s'ha trobat en la base de dades %s%s%s." +msgstr "No s'ha trobat el context de l'ajuda %s en la base de dades %s%s%s." #: objinspstrconsts:oishelphelpcontextnotfound msgid "Help context %s not found." -msgstr "No s'ha trobat el context d'ajuda %s." +msgstr "No s'ha trobat el context de l'ajuda %s." #: objinspstrconsts:oishelphelpkeywordnotfoundindatabase msgid "Help keyword %s%s%s not found in Database %s%s%s." -msgstr "Paraula clau d'ajuda %s%s%s no trobada en base de dades %s%s%s." +msgstr "No s'ha trobat la paraula clau de l'ajuda %s%s%s en base de dades %s%s%s." #: objinspstrconsts:oishelphelpkeywordnotfound msgid "Help keyword %s%s%s not found." -msgstr "Paraula clau d'ajuda %s%s%s no trobada." +msgstr "No s'ha trobat la paraula clau de l'ajuda %s%s%s." #: objinspstrconsts:oishelphelpnodehasnohelpdatabase msgid "Help node %s%s%s has no Help Database" -msgstr "El node d'ajuda %s%s%s no t base de dades d'ajuda" +msgstr "El node de l'ajuda %s%s%s no t base de dades de l'ajuda" #: objinspstrconsts:oistdacthelphelphelphint msgid "Help on help" -msgstr "" +msgstr "Ajuda de l'ajuda" #: objinspstrconsts:sccslvedtimgindexcaption msgid "Image index" -msgstr "ndex d'imatges" +msgstr "ndex de les imatges" #: objinspstrconsts:sccsiledtcaption msgid "Image list editor" -msgstr "Editor de llista d'imatges" +msgstr "Editor de la llista de les imatges" #: objinspstrconsts:oistdactdatasetinserthint msgid "Insert" -msgstr "" +msgstr "Insereix" #: objinspstrconsts:oisint64 msgid "Int64" @@ -380,11 +380,11 @@ msgstr "Interface" #: objinspstrconsts:sccslvedtlabcaption msgid "Label" -msgstr "Etiqueta" +msgstr "Label" #: objinspstrconsts:oistdactdatasetlasthint msgid "Last" -msgstr "" +msgstr "ltim" #: objinspstrconsts:sccslvedtcaption msgid "ListView editor" @@ -392,7 +392,7 @@ msgstr "Editor de ListView" #: objinspstrconsts:oisloadimagedialog msgid "Load Image Dialog" -msgstr "Carregar dileg d'imatge" +msgstr "Carrega el dileg de l'imatge" #: objinspstrconsts:oismethod msgid "Method" @@ -400,11 +400,11 @@ msgstr "M #: objinspstrconsts:cactionlisteditormovedownaction msgid "Move Down" -msgstr "" +msgstr "Mou avall" #: objinspstrconsts:cactionlisteditormoveupaction msgid "Move Up" -msgstr "" +msgstr "Mou amunt" #: objinspstrconsts:sccslvedtbtnadd msgid "New" @@ -412,19 +412,19 @@ msgstr "Nou" #: objinspstrconsts:cactionlisteditornewaction msgid "New Action" -msgstr "" +msgstr "Nova acci" #: objinspstrconsts:cactionlisteditornewstdaction msgid "New Standard Action" -msgstr "" +msgstr "Nova acci normalitzada" #: objinspstrconsts:oistdactdatasetnexthint msgid "Next" -msgstr "" +msgstr "Segent" #: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" -msgstr "No s'ha trobat navegador HTML.%sSi us plau, defineix-ne un a Ajuda -> Configurar Ajuda -> Visors" +msgstr "No s'ha trobat el navegador de l'HTML.%sSi us plau, definiu-ne un a Ajuda -> Configura Ajuda -> Visors" #: objinspstrconsts:oishelpnohelpfoundforsource msgid "No help found for line %d, column %d of %s." @@ -436,31 +436,31 @@ msgstr "Objecte" #: objinspstrconsts:oisobjectinspector msgid "Object Inspector" -msgstr "Inspector d'objectes" +msgstr "Inspector dels objectes" #: objinspstrconsts:oistdactfileopenhint msgid "Open" -msgstr "" +msgstr "Obre" #: objinspstrconsts:oistdactdatasetpostheadline msgid "P&ost" -msgstr "" +msgstr "Envi&a" #: objinspstrconsts:cactionlisteditorpaneldescrriptions msgid "Panel Descriptions" -msgstr "" +msgstr "Descipcions del tauler" #: objinspstrconsts:oistdacteditpasteshorthint msgid "Paste" -msgstr "" +msgstr "Enganxa" #: objinspstrconsts:oistdactdatasetposthint msgid "Post" -msgstr "" +msgstr "Envia" #: objinspstrconsts:oistdactdatasetpriorhint msgid "Prior" -msgstr "" +msgstr "Passat" #: objinspstrconsts:oisproperties msgid "Properties" @@ -472,55 +472,55 @@ msgstr "Registre" #: objinspstrconsts:oistdactdatasetrefreshhint msgid "Refresh" -msgstr "" +msgstr "Refresca" #: objinspstrconsts:oistdactfilesaveasheadline msgid "Save &As..." -msgstr "" +msgstr "&Anomena i desa.." #: objinspstrconsts:oistdactfilesaveashint msgid "Save As" -msgstr "" +msgstr "Anomena i desa" #: objinspstrconsts:oistdacteditselectallheadline msgid "Select &All" -msgstr "" +msgstr "Seleccion&a-ho tot" #: objinspstrconsts:oistdactcolorselect1headline msgid "Select &Color..." -msgstr "" +msgstr "Selecciona el &color" #: objinspstrconsts:oistdactfonteditheadline msgid "Select &Font..." -msgstr "" +msgstr "Selecciona la &font" #: objinspstrconsts:oistdacteditselectallshorthint msgid "Select All" -msgstr "" +msgstr "Selecciona-ho tot" #: objinspstrconsts:oisselectafile msgid "Select a file" -msgstr "Seleccionar un fitxer" +msgstr "Selecciona un fitxer" #: objinspstrconsts:oisset msgid "Set" -msgstr "Ficar" +msgstr "Fica" #: objinspstrconsts:oissettodefaultvalue msgid "Set to default value" -msgstr "Ficar a valor predeterminat" +msgstr "Fica a valor predeterminat" #: objinspstrconsts:oissettodefault msgid "Set to default: %s" -msgstr "Ficar a predeterminat: %s" +msgstr "Fica a predeterminat: %s" #: objinspstrconsts:oissort msgid "Sort" -msgstr "Classificar" +msgstr "Classifica" #: objinspstrconsts:oisstdactionlisteditor msgid "Standard Action Classes" -msgstr "" +msgstr "Classes d'acci normalitzades" #: objinspstrconsts:oisstring msgid "String" @@ -528,23 +528,23 @@ msgstr "Cadena" #: objinspstrconsts:cesstringgrideditor2 msgid "StringGrid Editor" -msgstr "Editor de Cadena De la Graella" +msgstr "Editor de la cadena de la graella" #: objinspstrconsts:cesstringgrideditor msgid "StringGrid Editor ..." -msgstr "Editor de Cadena de la Graella ..." +msgstr "Editor de la cadena de la graella ..." #: objinspstrconsts:oisstringseditordialog msgid "Strings Editor Dialog" -msgstr "Dileg editor de cadenes" +msgstr "Dileg editor de les cadenes" #: objinspstrconsts:sccslvedtbtnaddsub msgid "Sub item" -msgstr "Sot-element" +msgstr "Subelement" #: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile msgid "The help database %s%s%s was unable to find file %s%s%s." -msgstr "La base de dades de l'ajuda %s%s%s no pot trobat el fitxer %s%s%s." +msgstr "La base de dades de l'ajuda %s%s%s no ha trobat el fitxer %s%s%s." #: objinspstrconsts:oishelpthemacrosinbrowserparamswillbereplacedbytheurl msgid "The macro %s in BrowserParams will be replaced by the URL." @@ -552,15 +552,15 @@ msgstr "La macroinstrucci #: objinspstrconsts:cactionlisteditorpaneltoolbar msgid "Toolbar" -msgstr "" +msgstr "Barra d'eines" #: objinspstrconsts:oistdacthelptopicsearchhint msgid "Topic Search" -msgstr "" +msgstr "Cerca el contingut" #: objinspstrconsts:oistdacteditundoshorthint msgid "Undo" -msgstr "" +msgstr "Desfs" #: objinspstrconsts:oisunknown msgid "Unknown" diff --git a/lcl/languages/lcl.ca.po b/lcl/languages/lcl.ca.po index ab5d750618..711c306351 100644 --- a/lcl/languages/lcl.ca.po +++ b/lcl/languages/lcl.ca.po @@ -16,15 +16,15 @@ msgstr " Av #: lclstrconsts:rswarningunreleaseddcsdump msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" -msgstr " Avs: hi ha %d DCs no llenats, informaci detallada segueix:" +msgstr " Avs: hi ha %d DCs no llenats, tot seguit es mostra informaci detallada:" #: lclstrconsts:rswarningunreleasedgdiobjectsdump msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:" -msgstr " Avs: Hi ha %d GDIObjects no llenats, informaci detallada segueix:" +msgstr " Avs: Hi ha %d GDIObjects no llenats, tot seguit es mostra informaci detallada:" #: lclstrconsts:rswarningunremovedpaintmessages msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left." -msgstr "Avs: S'han deixat %s enllaos a missatge LM_PAINT/LM_GtkPAINT, sense esborrar" +msgstr "Avs: S'han deixat %s enllaos a missatge LM_PAINT/LM_GtkPAINT, sense eliminar" #: lclstrconsts:rsindexoutofbounds msgid "%s Index %d out of bounds 0-%d" @@ -40,7 +40,7 @@ msgstr "&Tot" #: lclstrconsts:rsmbclose msgid "&Close" -msgstr "&Tancar" +msgstr "Tan&ca" #: lclstrconsts:rsmbhelp msgid "&Help" @@ -48,7 +48,7 @@ msgstr "&Ajuda" #: lclstrconsts:rsmbignore msgid "&Ignore" -msgstr "&Ignorar" +msgstr "&Ignora" #: lclstrconsts:rsmbno msgid "&No" @@ -56,7 +56,7 @@ msgstr "&No" #: lclstrconsts:rsmbok msgid "&OK" -msgstr "D'ac&Ord" +msgstr "D'ac&ord" #: lclstrconsts:rsmbretry msgid "&Retry" @@ -68,55 +68,55 @@ msgstr "&S #: lclstrconsts:rsfileinfofilenotfound msgid "(file not found: \"%s\")" -msgstr "(fitxer no trobat: \"%s\")" +msgstr "(no s'ha trobat el fitxer: \"%s\")" #: lclstrconsts:rsgtkoptionclass msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." -msgstr "--class nomdeclasse Seguint les convencions Xt, la classe d'un programa s el nom del programa amb el primer carcter amb majscules. Per exemple, el nom de classe pel gimp s \"Gimp\". Si s'especifica --class, la classe del programa s'ha de ficar a \"classname\"." +msgstr "--class classname Seguint les convencions Xt, la classe d'un programa s el nom del programa amb el primer carcter amb majscules. Per exemple, el nom de classe pel gimp s \"Gimp\". Si s'especifica --class, la classe del programa s'ha de ficar a \"classname\"." #: lclstrconsts:rsgtkoptiondisplay msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." -msgstr "--display h:s:d Connectar al servidor X especificat, on \"h\" s el nom de l'ordinador central, \"s\" el nmero del servidor (generalment 0), i \"d\" el nmero de pantalla (generalment oms). Si --display no est especificat, s'utilitza la variable d'entorn DISPLAY" +msgstr "--display h:s:d Connecta al servidor X especificat, on \"h\" s el nom de l'ordinador central, \"s\" el nmero del servidor (generalment 0), i \"d\" el nmero de pantalla (generalment oms). Si no s'especifica --display, s'utilitza la variable d'entorn DISPLAY" #: lclstrconsts:rsgoptionfatalwarnings msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." -msgstr "--g-fatal-warnings Avisos i error generats per Gtk+/GDK aturaran la aplicaci." +msgstr "--g-fatal-warnings Avisos i error generats per Gtk+/GDK aturen l'aplicaci." #: lclstrconsts:rsgdkoptiondebug msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." -msgstr "--gdk-debug senyaladors Activar missatges de seguiment/depuraci especfics de GDK" +msgstr "--gdk-debug flags Activa els missatges de seguiment/depuraci especfics del GDK" #: lclstrconsts:rsgdkoptionnodebug msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages." -msgstr "--gdk-no-debug senyaladors Desactivar missatges de seguiment/depuraci especfics de GDK" +msgstr "--gdk-no-debug flags Desactiva els missatges de seguiment/depuraci especfics del GDK" #: lclstrconsts:rsgtkoptiondebug msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages." -msgstr "--gtk-debug senyaladors Activar missatges de seguiment/depuraci especfics de Gtk+" +msgstr "--gtk-debug flags Activa els missatges de seguiment/depuraci especfics del Gtk+" #: lclstrconsts:rsgtkoptionmodule msgid "--gtk-module module Load the specified module at startup." -msgstr "--gtk-module mdul Carregar el mdul especificat a l'inici" +msgstr "--gtk-module module Carrega el mdul especificat a l'inici" #: lclstrconsts:rsgtkoptionnodebug msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." -msgstr "--gtk-no-debug assenyaladors Desactivar missatges de seguiment/depuraci especfics de Gtk+" +msgstr "--gtk-no-debug flags Desactiva els missatges de seguiment/depuraci especfics del Gtk+" #: lclstrconsts:rsgtkoptionnotransient msgid "--lcl-no-transient Do not set transient order for modal forms" -msgstr "--lcl-no-transient No ficar ordre temporal per formes modals" +msgstr "--lcl-no-transient No fiquis l'ordre temporal per les formes modals" #: lclstrconsts:rsgtkoptionname msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStr(0)." -msgstr "--name programa Ficar el nom del programa a \"programa\". Si no s'especifica, el nom del programa ser ParamStr(0)" +msgstr "--name programe Fica el nom del programa a \"programa\". Si no s'especifica, el nom del programa ser ParamStr(0)" #: lclstrconsts:rsgtkoptionnoxshm msgid "--no-xshm Disable use of the X Shared Memory Extension." -msgstr "--no-xshm Deshabilitar l's de l'Extensi de Memria Compartida" +msgstr "--no-xshm Deshabilita l's de l'Extensi de Memria Compartida" #: lclstrconsts:rsgtkoptionsync msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." -msgstr "--sync Cridar XSyncronize (display, True) desprs d'establir la connexi amb el servidor X. Aix fa la depuraci del protocol X, ms fcil, per que els errors de X es reben immediatament." +msgstr "--sync Crida XSyncronize (display, True) desprs d'establir la connexi amb el servidor X. Aix fa la depuraci del protocol X, ms fcil, per que els errors de X es reben immediatament." #: lclstrconsts:rsacontrolcannothaveitselfasparent msgid "A control can't have itself as parent" @@ -124,11 +124,11 @@ msgstr "Un control no es pot tenir a ell mateix com a pare" #: lclstrconsts:rsmbabort msgid "Abort" -msgstr "Avortar" +msgstr "Avorta" #: lclstrconsts:ifsvk_accept msgid "Accept" -msgstr "Acceptar" +msgstr "Accepta" #: lclstrconsts:rsallfiles msgid "All files (%s)|%s|%s" @@ -148,11 +148,11 @@ msgstr "Calculadora" #: lclstrconsts:rscannotfocus msgid "Can not focus" -msgstr "No puc focalitzar" +msgstr "No es pot focalitzar" #: lclstrconsts:rsmbcancel msgid "Cancel" -msgstr "Cancellar" +msgstr "Cancella" #: lclstrconsts:scannotfocus msgid "Cannot focus a disabled or invisible window" @@ -168,7 +168,7 @@ msgstr "Maj #: lclstrconsts:ifsvk_clear msgid "Clear" -msgstr "Netejar" +msgstr "Neteja" #: lclstrconsts:rsmtconfirmation msgid "Confirmation" @@ -180,19 +180,19 @@ msgstr "Control" #: lclstrconsts:ifsvk_convert msgid "Convert" -msgstr "Convertir" +msgstr "Converteix" #: lclstrconsts:rscreatinggdbcatchableerror msgid "Creating gdb catchable error:" -msgstr "Error creant capturables gdb" +msgstr "S'ha produt un error mentre es creaven els capturables gdb" #: lclstrconsts:rsmtcustom msgid "Custom" -msgstr "Personalitzar" +msgstr "Personalitzat" #: lclstrconsts:ifsvk_delete msgid "Delete" -msgstr "Esborrar" +msgstr "Elimina" #: lclstrconsts:rsfddirectorymustexist msgid "Directory must exist" @@ -208,7 +208,7 @@ msgstr "Men #: lclstrconsts:rserrorinlcl msgid "ERROR in LCL: " -msgstr "Error a la LCL" +msgstr "S'ha produt un error a la LCL" #: lclstrconsts:ifsvk_end msgid "End" @@ -216,27 +216,27 @@ msgstr "Final" #: lclstrconsts:rsmterror msgid "Error" -msgstr "Error" +msgstr "S'ha produt un error" #: lclstrconsts:rserrorcreatingdevicecontext msgid "Error creating device context for %s.%s" -msgstr "Error creant context de dispositiu per %s.%s" +msgstr "S'ha produt un error mentre es creava el context de dispositiu per %s.%s" #: lclstrconsts:rserroroccurredinataddressframe msgid "Error occurred in %s at %sAddress %s%s Frame %s" -msgstr "Hi ha un error a %s %s adrea %s%s marc %s" +msgstr "S'ha produt un error a %s %s adrea %s%s marc %s" #: lclstrconsts:rserrorreadingproperty msgid "Error reading %s%s%s: %s" -msgstr "Error llegint %s%s%s: %s" +msgstr "S'ha produt un error mentre es llegia %s%s%s: %s" #: lclstrconsts:rswin32error msgid "Error:" -msgstr "Error" +msgstr "S'ha produt un error:" #: lclstrconsts:ifsvk_escape msgid "Escape" -msgstr "Escapar" +msgstr "Escapament" #: lclstrconsts:rsexception msgid "Exception" @@ -244,7 +244,7 @@ msgstr "Excepci #: lclstrconsts:ifsvk_execute msgid "Execute" -msgstr "Executar" +msgstr "Executa" #: lclstrconsts:rsfileinformation msgid "File information" @@ -252,7 +252,7 @@ msgstr "Informaci #: lclstrconsts:rsfdfilereadonlytitle msgid "File is not writable" -msgstr "No es pot escriure el fitxer" +msgstr "No es pot escriure en el fitxer" #: lclstrconsts:rsfdfilemustexist msgid "File must exist" @@ -276,11 +276,11 @@ msgstr "FixedRows no pot ser >= RowCount" #: lclstrconsts:rsformstreamingerror msgid "Form streaming \"%s\" error: %s" -msgstr "Afluent de formes \"%s\" error: %s" +msgstr "S'ha produt un error en l'afluent de les formes \"%s\": %s" #: lclstrconsts:rsgridfiledoesnotexists msgid "Grid file doesn't exists" -msgstr "El fitxer de la graella no existeix" +msgstr "No existeix el fitxer de la graella" #: lclstrconsts:rsgroupindexcannotbelessthanprevious msgid "GroupIndex cannot be less than a previous menu item's GroupIndex" @@ -312,7 +312,7 @@ msgstr "Informaci #: lclstrconsts:ifsvk_insert msgid "Insert" -msgstr "Inserir" +msgstr "Insereix" #: lclstrconsts:rsinvaliddate msgid "Invalid Date : %s" @@ -320,39 +320,39 @@ msgstr "" #: lclstrconsts:rsinvaliddaterangehint msgid "Invalid Date: %s. Must be between %s and %s" -msgstr "" +msgstr "La data %s no s vlida. Ha d'estar entre %s i %s" #: lclstrconsts:sinvalidindex msgid "Invalid ImageList Index" -msgstr "ndex de ImageList no vlid" +msgstr "L'ndex de ImageList no s vlid" #: lclstrconsts:sinvalidactioncreation msgid "Invalid action creation" -msgstr "Acci de creaci no vlida" +msgstr "L'acci de creaci no s vlida" #: lclstrconsts:sinvalidactionenumeration msgid "Invalid action enumeration" -msgstr "Acci d'enumeraci no vlida" +msgstr "L'acci d'enumeraci no s vlida" #: lclstrconsts:sinvalidactionregistration msgid "Invalid action registration" -msgstr "Enregistrament d'acci no vlid" +msgstr "L'enregistrament de l'acci no s vlid" #: lclstrconsts:sinvalidactionunregistration msgid "Invalid action unregistration" -msgstr "Des-enregistrament d'acci no vlid" +msgstr "El des-enregistrament de l'acci no s vlid" #: lclstrconsts:sinvalidimagesize msgid "Invalid image size" -msgstr "Tamany d'imatge no vlid" +msgstr "El tamany de l'imatge no s vlid" #: lclstrconsts:rsinvalidpropertyvalue msgid "Invalid property value" -msgstr "Valor de propietat no vlid" +msgstr "El valor de la propietat no s vlid" #: lclstrconsts:rsinvalidstreamformat msgid "Invalid stream format" -msgstr "Format d'afluent no vlid" +msgstr "El format de l'afluent no s vlid" #: lclstrconsts:ifsvk_junja msgid "Junja" @@ -380,7 +380,7 @@ msgstr "Men #: lclstrconsts:smenuindexerror msgid "Menu index out of range" -msgstr "ndex de men fora d'abast" +msgstr "ndex del men fora d'abast" #: lclstrconsts:smenuitemisnil msgid "MenuItem is nil" @@ -412,7 +412,7 @@ msgstr "No hi ha forma MDI present." #: lclstrconsts:rsnointerfaceobject msgid "No interface object. Plz check if the unit \"interfaces\" was added to the programs uses clause." -msgstr "No hi ha objecte d'interfcie. Si us plau, comprova si la unitat \"interfaces\" ha estat afegida a la clusula Uses" +msgstr "No hi ha objecte d'interfcie. Si us plau, comproveu si la unitat \"interfaces\" s'ha afegit a la clusula Uses" #: lclstrconsts:snotimers msgid "No timers available" @@ -424,7 +424,7 @@ msgstr "No a tot" #: lclstrconsts:ifsvk_nonconvert msgid "Nonconvert" -msgstr "No convertir" +msgstr "No converteixis" #: lclstrconsts:rsnotavalidgridfile msgid "Not a valid grid file" @@ -440,11 +440,11 @@ msgstr "Teclat Num #: lclstrconsts:rsfdopenfile msgid "Open existing file" -msgstr "Obrir fitxer existent" +msgstr "Obre el fitxer existent" #: lclstrconsts:rsfdoverwritefile msgid "Overwrite file ?" -msgstr "Sobre-escriure el fitxer ?" +msgstr "Voleu sobreescriure el fitxer ?" #: lclstrconsts:rsfdpathmustexist msgid "Path must exist" @@ -456,7 +456,7 @@ msgstr "Tecla de pausa" #: lclstrconsts:ifsvk_print msgid "Print" -msgstr "Imprimir" +msgstr "Imprimeix" #: lclstrconsts:ifsvk_prior msgid "Prior" @@ -464,11 +464,11 @@ msgstr "Anterior" #: lclstrconsts:rspropertydoesnotexist msgid "Property %s does not exist" -msgstr "La propietat %s no existeix" +msgstr "No existeix la propietat %s" #: lclstrconsts:lislclresourcesnotfound msgid "Resource %s not found" -msgstr "Recurs %s no trobat" +msgstr "No s'ha trobat el recurs %s" #: lclstrconsts:ifsvk_return msgid "Return" @@ -480,35 +480,35 @@ msgstr "Dret" #: lclstrconsts:rsfdfilesaveas msgid "Save file as" -msgstr "Guardar fitxer com a " +msgstr "Anomena i desa el fitxer " #: lclstrconsts:ifsvk_scroll msgid "Scroll" -msgstr "Desplaar" +msgstr "Desplaa" #: lclstrconsts:rsscrollbaroutofrange msgid "ScrollBar property out of range" -msgstr "Propietat de la barra desplaadora fora d'abast" +msgstr "La propietat de la barra desplaadora est fora d'abast" #: lclstrconsts:ifsvk_select msgid "Select" -msgstr "Seleccionar" +msgstr "Selecciona" #: lclstrconsts:rsfdselectdirectory msgid "Select Directory" -msgstr "Seleccionar directori" +msgstr "Selecciona el directori" #: lclstrconsts:rspickdate msgid "Select a date" -msgstr "Seleccionar una data" +msgstr "Selecciona una data" #: lclstrconsts:rsselectfonttitle msgid "Select a font" -msgstr "Seleccionar una font" +msgstr "Selecciona una font" #: lclstrconsts:rsselectcolortitle msgid "Select color" -msgstr "Seleccionar color" +msgstr "Selecciona el color" #: lclstrconsts:ifsvk_shift msgid "Shift" @@ -532,23 +532,23 @@ msgstr "Tabulador" #: lclstrconsts:rsfddirectorynotexist msgid "The directory \"%s\" does not exist." -msgstr "El directori \"%s\" no existeix." +msgstr "No existeix el directori \"%s\"." #: lclstrconsts:rsfdfilealreadyexists msgid "The file \"%s\" already exists.\015Overwrite ?" -msgstr "El fitxer \"%s\" ja existeix. \015Sobre-escriure ?" +msgstr "Ja existeix el fitxer \"%s\". \015El voleu sobreescriure ?" #: lclstrconsts:rsfdfilenotexist msgid "The file \"%s\" does not exist." -msgstr "El fitxer \"%s\" no existeix" +msgstr "No existeix el fitxer \"%s\"" #: lclstrconsts:rsfdfilereadonly msgid "The file \"%s\" is not writable." -msgstr "No es pot escriure el fitxer \"%s\"" +msgstr "No es pot escriure en el fitxer \"%s\"" #: lclstrconsts:rsfdpathnoexist msgid "The path \"%s\" does not exist." -msgstr "La trajectria \"%s\" no existeix." +msgstr "No exiteix la trajectria \"%s\"." #: lclstrconsts:rsunabletoloaddefaultfont msgid "Unable to load default font" @@ -560,15 +560,15 @@ msgstr "Desconegut" #: lclstrconsts:rsunknownpictureextension msgid "Unknown picture extension" -msgstr "Extensi d'imatge desconeguda" +msgstr "L'extensi de la imatge s desconeguda" #: lclstrconsts:rsunsupportedbitmapformat msgid "Unsupported bitmap format." -msgstr "Mapa de bits no suportat" +msgstr "El mapa de bits no est suportat" #: lclstrconsts:rsunsupportedclipboardformat msgid "Unsupported clipboard format: %s" -msgstr "Format de porta-retalls no suportat: %s" +msgstr "El format del porta-retalls no est suportat: %s" #: lclstrconsts:ifsvk_up msgid "Up" @@ -592,7 +592,7 @@ msgstr "tecla d'aplicaci #: lclstrconsts:rsinvalidformobjectstream msgid "invalid Form object stream" -msgstr "afluent d'objecte de forma no vlid" +msgstr "l'afluent de l'objecte de la forma no s vlid" #: lclstrconsts:ifsvk_lwin msgid "left windows key" diff --git a/localize.sh b/localize.sh index e637abffde..7a04e57a8e 100644 --- a/localize.sh +++ b/localize.sh @@ -24,7 +24,7 @@ fi IDE_RST=`find . -name lazarusidestrconsts.rst | xargs ls -1t | head -1`; rstconv -i $IDE_RST -o languages/lazaruside.po ./tools/updatepofiles languages/lazaruside.po -for lang in ca de es esutf fi fiwin fr he it itiso pl pliso plwin ru ruwin ruutf ; do +for lang in ca de es esutf fi fiwin fr he it itiso nl pl pliso plwin ru ruwin ruutf ; do msgfmt languages/lazaruside.$lang.po -o languages/lazaruside.$lang.mo done