From 4cf2555b46e74684a433e3679d360231c37ff5a5 Mon Sep 17 00:00:00 2001 From: vincents Date: Fri, 17 Feb 2006 21:33:19 +0000 Subject: [PATCH] updated Russian translations, removed *.ruwin.po and *.ruold.po from Maxim Ganetsky git-svn-id: trunk@8767 - --- .gitattributes | 12 - .../codetools/languages/codetools.ruold.po | 740 -- .../codetools/languages/codetools.ruwin.po | 740 -- components/synedit/languages/synedit.ruold.po | 212 - components/synedit/languages/synedit.ruwin.po | 212 - .../languages/synmacrorecorder.ruold.po | 16 - .../languages/synmacrorecorder.ruwin.po | 16 - languages/lazaruside.ru.po | 3583 +++---- languages/lazaruside.ruold.po | 8496 ----------------- languages/lazaruside.ruwin.po | 8496 ----------------- languages/objinspstrconsts.ru.po | 258 +- languages/objinspstrconsts.ruold.po | 833 -- languages/objinspstrconsts.ruwin.po | 824 -- lcl/languages/lcl.ruold.po | 632 -- lcl/languages/lcl.ruwin.po | 632 -- 15 files changed, 1927 insertions(+), 23775 deletions(-) delete mode 100644 components/codetools/languages/codetools.ruold.po delete mode 100644 components/codetools/languages/codetools.ruwin.po delete mode 100644 components/synedit/languages/synedit.ruold.po delete mode 100644 components/synedit/languages/synedit.ruwin.po delete mode 100644 components/synedit/languages/synmacrorecorder.ruold.po delete mode 100644 components/synedit/languages/synmacrorecorder.ruwin.po delete mode 100644 languages/lazaruside.ruold.po delete mode 100644 languages/lazaruside.ruwin.po delete mode 100644 languages/objinspstrconsts.ruold.po delete mode 100644 languages/objinspstrconsts.ruwin.po delete mode 100644 lcl/languages/lcl.ruold.po delete mode 100644 lcl/languages/lcl.ruwin.po diff --git a/.gitattributes b/.gitattributes index e01ae1ffc0..0d21badff5 100644 --- a/.gitattributes +++ b/.gitattributes @@ -81,8 +81,6 @@ components/codetools/languages/codetools.pliso.po svneol=native#text/plain components/codetools/languages/codetools.plwin.po svneol=native#text/plain components/codetools/languages/codetools.po svneol=native#text/plain components/codetools/languages/codetools.ru.po svneol=native#text/plain -components/codetools/languages/codetools.ruold.po svneol=native#text/plain -components/codetools/languages/codetools.ruwin.po svneol=native#text/plain components/codetools/languages/codetools.ua.po svneol=native#text/plain components/codetools/laz_dom.pas svneol=native#text/pascal components/codetools/laz_xmlcfg.pas svneol=native#text/pascal @@ -403,8 +401,6 @@ components/synedit/languages/synedit.pliso.po svneol=native#text/plain components/synedit/languages/synedit.plwin.po svneol=native#text/plain components/synedit/languages/synedit.po svneol=native#text/plain components/synedit/languages/synedit.ru.po svneol=native#text/plain -components/synedit/languages/synedit.ruold.po svneol=native#text/plain -components/synedit/languages/synedit.ruwin.po svneol=native#text/plain components/synedit/languages/synedit.ua.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.ca.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.de.po svneol=native#text/plain @@ -416,8 +412,6 @@ components/synedit/languages/synmacrorecorder.pliso.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.plwin.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.ru.po svneol=native#text/plain -components/synedit/languages/synmacrorecorder.ruold.po svneol=native#text/plain -components/synedit/languages/synmacrorecorder.ruwin.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.ua.po svneol=native#text/plain components/synedit/syncompletion.pas svneol=native#text/pascal components/synedit/synedit.inc svneol=native#text/pascal @@ -1623,8 +1617,6 @@ languages/lazaruside.pliso.po svneol=native#text/plain languages/lazaruside.plwin.po svneol=native#text/plain languages/lazaruside.po svneol=native#text/plain languages/lazaruside.ru.po svneol=native#text/plain -languages/lazaruside.ruold.po svneol=native#text/plain -languages/lazaruside.ruwin.po svneol=native#text/plain languages/lazaruside.ua.po svneol=native#text/plain languages/objinspstrconsts.ca.po svneol=native#text/plain languages/objinspstrconsts.de.po svneol=native#text/plain @@ -1640,8 +1632,6 @@ languages/objinspstrconsts.pliso.po svneol=native#text/plain languages/objinspstrconsts.plwin.po svneol=native#text/plain languages/objinspstrconsts.po svneol=native#text/plain languages/objinspstrconsts.ru.po svneol=native#text/plain -languages/objinspstrconsts.ruold.po svneol=native#text/plain -languages/objinspstrconsts.ruwin.po svneol=native#text/plain languages/objinspstrconsts.ua.po svneol=native#text/plain lcl/LAYOUT.txt svneol=native#text/plain lcl/actnlist.pas svneol=native#text/pascal @@ -2115,8 +2105,6 @@ lcl/languages/lcl.pliso.po svneol=native#text/plain lcl/languages/lcl.plwin.po svneol=native#text/plain lcl/languages/lcl.po svneol=native#text/plain lcl/languages/lcl.ru.po svneol=native#text/plain -lcl/languages/lcl.ruold.po svneol=native#text/plain -lcl/languages/lcl.ruwin.po svneol=native#text/plain lcl/languages/lcl.ua.po svneol=native#text/plain lcl/lazcwstring.pas svneol=native#text/plain lcl/lazlinkedlist.pas svneol=native#text/pascal diff --git a/components/codetools/languages/codetools.ruold.po b/components/codetools/languages/codetools.ruold.po deleted file mode 100644 index 2be0ed4aa7..0000000000 --- a/components/codetools/languages/codetools.ruold.po +++ /dev/null @@ -1,740 +0,0 @@ -#: codetoolsstrconsts:ctsothercompilerdefines -msgid "%s Compiler Defines" -msgstr "пРТЕДЕМЕОЙС ЛПНРЙМСФПТБ %s" - -#: codetoolsstrconsts:ctsnameddirectory -msgid "%s Directory" -msgstr "лБФБМПЗ %s" - -#: codetoolsstrconsts:ctsnamedproject -msgid "%s Project" -msgstr "рТПЕЛФ %s" - -#: codetoolsstrconsts:ctsstrexpectedbutatomfound -msgid "%s expected, but %s found" -msgstr "ПЦЙДБЕФУС %s, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsfilehascircularsymlink -msgid "%s has a circular symbolic link" -msgstr "%s УПДЕТЦЙФ ГЙЛМЙЮЕУЛХА УЙНЧПМЙЮЕУЛХА УУЩМЛХ" - -#: codetoolsstrconsts:ctsfileisnotexecutable -msgid "%s is not executable" -msgstr "%s - ОЕ ЙУРПМОСЕНЩК ЖБКМ" - -#: codetoolsstrconsts:ctsawithoutb -msgid "%s without %s" -msgstr "%s ВЕЪ %s" - -#: codetoolsstrconsts:ctsunknownmainfilename -msgid "(unknown mainfilename)" -msgstr "(ОЕЙЪЧЕУФОП ЙНС ЗМБЧОПЗП ЖБКМБ)" - -#: codetoolsstrconsts:ctsunknownsubdescriptor -msgid "(unknown subdescriptor %s)" -msgstr "(оЕЙЪЧЕУФОЩК УХВДЕУЛТЙРФПТ)" - -#: codetoolsstrconsts:ctspointhintprocstartat -msgid ". Hint: proc start at " -msgstr ". рПДУЛБЪЛБ: РТПГЕДХТБ ОБЮЙОБЕФУС Ч " - -#: codetoolsstrconsts:ctspointstartat -msgid ". start at " -msgstr ". ОБЮЙОБЕФУС Ч " - -#: codetoolsstrconsts:ctssemicolonafterpropspecmissing -msgid "; expected after \"%s\" property specifier, but %s found" -msgstr "; ПЦЙДБЕФУС РПУМЕ НПДЙЖЙЛБФПТБ УЧПКУФЧБ \"%s\", ОП ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsanoymdefinitionsarenotallowed -msgid "Anonymous %s definitions are not allowed" -msgstr "" - -#: codetoolsstrconsts:ctscpudirectory -msgid "CPU directory" -msgstr "" - -#: codetoolsstrconsts:ctsclasssnotfound -msgid "Class %s not found" -msgstr "лМБУУ %s ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctscommandlineparameters -msgid "Command line parameters" -msgstr "рБТБНЕФТЩ ЛПНБОДОПК УФТПЛЙ " - -#: codetoolsstrconsts:ctscommentendnotfound -msgid "Comment end not found" -msgstr "оЕ ОБКДЕО ЛПОЕГ ЛПННЕОФБТЙС" - -#: codetoolsstrconsts:ctscompiledsrcpath -msgid "Compiled SrcPath" -msgstr "рХФШ ЙУИ.ЛПНРЙМСФПТБ" - -#: codetoolsstrconsts:ctscompiler -msgid "Compiler" -msgstr "лПНРЙМСФПТ" - -#: codetoolsstrconsts:ctscomponentsdirectory -msgid "Components Directory" -msgstr "лБФБМПЗ ЛПНРПОЕОФПЧ" - -#: codetoolsstrconsts:ctscustomcomponentsdirectory -msgid "Custom Components Directory" -msgstr "лБФБМПЗ ЛПНРПОЕОФПЧ РПМШЪПЧБФЕМС" - -#: codetoolsstrconsts:ctsdebuggerdirectory -msgid "Debugger Directory" -msgstr "лБФБМПЗ ПФМБДЮЙЛБ" - -#: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem -msgid "Default ppc386 source Operating System" -msgstr "пРЕТБГЙПООБС УЙУФЕНБ ДМС ЙУИПДОЙЛБ РП ХНПМЮБОЙА ДМС ppc386" - -#: codetoolsstrconsts:ctsdefaultppc386source2operatingsystem -msgid "Default ppc386 source Operating System 2" -msgstr "" - -#: codetoolsstrconsts:ctsdefaultppc386symbol -msgid "Default ppc386 symbol" -msgstr "уЙНЧПМ ppc386 РП ХНПМЮБОЙА" - -#: codetoolsstrconsts:ctsdefaultppc386targetoperatingsystem -msgid "Default ppc386 target Operating System" -msgstr "пРЕТБГЙПООБС УЙУФЕНБ ДМС ЙУРПМОСЕНПЗП ЖБКМБ РП ХНПМЮБОЙА ДМС ppc386" - -#: codetoolsstrconsts:ctsdefaultppc386targetprocessor -msgid "Default ppc386 target processor" -msgstr "рТПГЕУУПТ ДМС ЙУРПМОСЕНПЗП ЖБКМБ РП ХНПМЮБОЙА ДМС ppc386" - -#: codetoolsstrconsts:ctsdefine -msgid "Define " -msgstr "пРТЕДЕМЙФШ " - -#: codetoolsstrconsts:ctsdefinemacroname -msgid "Define Macro %s" -msgstr "пРТЕДЕМЙФШ НБЛТПУ %s" - -#: codetoolsstrconsts:ctsdefinemacrocarbon1 -msgid "Define macro carbon1" -msgstr "" - -#: codetoolsstrconsts:ctsdefinemacrognome2 -msgid "Define macro gnome2" -msgstr "пРТЕДЕМЙФШ НБЛТПУ gnome2" - -#: codetoolsstrconsts:ctsdefinemacrogtk1 -msgid "Define macro gtk1" -msgstr "пРТЕДЕМЙФШ НБЛТПУ gtk1" - -#: codetoolsstrconsts:ctsdefinemacrogtk2 -msgid "Define macro gtk2" -msgstr "пРТЕДЕМЙФШ НБЛТПУ gtk2" - -#: codetoolsstrconsts:ctsdefinemacroqt1 -msgid "Define macro qt1" -msgstr "" - -#: codetoolsstrconsts:ctsdefinemacrowince1 -msgid "Define macro wince1" -msgstr "" - -#: codetoolsstrconsts:ctsdefineprocessortype -msgid "Define processor type" -msgstr "пРТЕДЕМЙФШ ФЙР РТПГЕУУПТБ" - -#: codetoolsstrconsts:ctsdefsforlazarussources -msgid "Definitions for the Lazarus Sources" -msgstr "пРЙУБОЙС ДМС ЙУИПДОЙЛПЧ Lazarus" - -#: codetoolsstrconsts:ctsdesignerdirectory -msgid "Designer Directory" -msgstr "лБФБМПЗ 'ДЙЪБКОЕТБ'" - -#: codetoolsstrconsts:ctsdesignerunitsdirectory -msgid "Designer Units" -msgstr "нПДХМЙ 'ДЙЪБКОЕТБ'" - -#: codetoolsstrconsts:ctsdoceditordirectory -msgid "Doc Editor Directory" -msgstr "лБФБМПЗ ТЕДБЛФПТБ ДПЛХНЕОФБГЙЙ" - -#: codetoolsstrconsts:ctsendofsourcenotfound -msgid "End of source not found" -msgstr "оЕ ОБКДЕОП ЛПОГБ ЙУИПДОЙЛБ" - -#: codetoolsstrconsts:ctsforward -msgid "Forward" -msgstr "" - -#: codetoolsstrconsts:ctsforwardclassdefinitionnotresolved -msgid "Forward class definition not resolved: %s" -msgstr "оЕ ОБКДЕОП ПРЙУБОЙЕ ТБОЕЕ ХРПНСОХФПЗП ЛМБУУБ: %s" - -#: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros -msgid "Free Pascal Compiler initial macros" -msgstr "нБЛТПУЩ ЙОЙГЙБМЙЪБГЙЙ ЛПНРЙМСФПТБ FreePascal" - -#: codetoolsstrconsts:ctsfreepascalcomponentlibrary -msgid "Free Pascal Component Library" -msgstr "вЙВМЙПФЕЛБ ЛПНРПОЕОФПЧ FreePascal" - -#: codetoolsstrconsts:ctsfreepascalsourcedir -msgid "Free Pascal Source Directory" -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FreePascal" - -#: codetoolsstrconsts:ctsfreepascalsourcesplusdesc -msgid "Free Pascal Sources, %s" -msgstr "йУИПДОЙЛЙ FreePascal, %s" - -#: codetoolsstrconsts:ctsidedirectory -msgid "IDE Directory" -msgstr "" - -#: codetoolsstrconsts:ctsideintfdirectory -msgid "IDEIntf Directory" -msgstr "лБФБМПЗ ЙОФЕТЖЕКУБ IDE" - -#: codetoolsstrconsts:ctsidentifieralreadydefined -msgid "Identifier %s already defined" -msgstr "йДЕОФЙЖЙЛБФПТ %s ХЦЕ ПРТЕДЕМЈО" - -#: codetoolsstrconsts:ctsiflclwidgettypeequalsgnome2 -msgid "If LCLWidgetType=gnome2 then" -msgstr "" - -#: codetoolsstrconsts:ctsiflclwidgettypeequalsgtk2 -msgid "If LCLWidgetType=gtk2 then" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotsrcos -msgid "If TargetOS<>SrcOS" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotsrcos2 -msgid "If TargetOS<>SrcOS2" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotwin32 -msgid "If TargetOS<>win32 then" -msgstr "" - -#: codetoolsstrconsts:ctsincludecircledetected -msgid "Include circle detected" -msgstr "пВОБТХЦЕОП ГЙЛМЙЮЕУЛПЕ ЧЛМАЮЕОЙЕ" - -#: codetoolsstrconsts:ctsinstalldirectory -msgid "Install Directory" -msgstr "" - -#: codetoolsstrconsts:ctsinstallerdirectories -msgid "Installer directories" -msgstr "" - -#: codetoolsstrconsts:ctsjitformdirectory -msgid "JITForm Directory" -msgstr "лБФБМПЗ JITForm" - -#: codetoolsstrconsts:ctslazarussources -msgid "Lazarus Sources" -msgstr "йУИПДОЙЛЙ lazarus" - -#: codetoolsstrconsts:ctsnestedcommentson -msgid "Nested Comments On" -msgstr "чЛМ. ЧМПЦЕООЩЕ ЛПННЕОФБТЙЙ" - -#: codetoolsstrconsts:ctsnoscanneravailable -msgid "No scanner available" -msgstr "оЕФ ДПУФХРОЩИ 'УЛБОЕТПЧ'" - -#: codetoolsstrconsts:ctsnoscannerfound -msgid "No scanner found for \"%s\". If this is an include file, please open the main source first." -msgstr "оЕ ОБКДЕОП 'УЛБОЕТБ' ДМС \"%s\". еУМЙ ЬФП - ЧЛМАЮБЕНЩК ЖБКМ, ПФЛТПКФЕ УОБЮБМБ ЗМБЧОЩК ЙУИПДОЙЛ." - -#: codetoolsstrconsts:ctspackagedirectories -msgid "Package directories" -msgstr "лБФБМПЗЙ РБЛЕФПЧ" - -#: codetoolsstrconsts:ctspackagerdirectory -msgid "Packager Directory" -msgstr "лБФБМПЗ НЕОЕДЦЕТБ РБЛЕФПЧ" - -#: codetoolsstrconsts:ctspackagerregistrationdirectory -msgid "Packager Registration Directory" -msgstr "лБФБМПЗ ТЕЗЙУФТБГЙЙ НЕОЕДЦЕТБ РБЛЕФПЧ" - -#: codetoolsstrconsts:ctspackagerunitsdirectory -msgid "Packager Units Directory" -msgstr "лБФБМПЗ НПДХМЕК НЕОЕДЦЕТБ РБЛЕФПЧ" - -#: codetoolsstrconsts:ctspositionnotinsource -msgid "Position not in source" -msgstr "" - -#: codetoolsstrconsts:ctsresetalldefines -msgid "Reset all defines" -msgstr "уВТПУЙФШ ЧУЕ ПРТЕДЕМЕОЙС" - -#: codetoolsstrconsts:ctsruntimelibrary -msgid "Runtime library" -msgstr "вЙВМЙПФЕЛБ ЧТЕНЕОЙ ЙУРПМОЕОЙС" - -#: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits -msgid "Source filenames for the standard fpc units" -msgstr "йНЕОБ ЖБКМПЧ ЙУИПДОЙЛПЧ ДМС УФБОДБТФОЩИ НПДХМЕК fpc" - -#: codetoolsstrconsts:ctssrcpathinitialization -msgid "SrcPath Initialization" -msgstr "йОЙГЙБМЙЪБГЙС РХФЕК ЙУИПДОЙЛПЧ" - -#: codetoolsstrconsts:ctssyntaxerrorinexpr -msgid "Syntax Error in expression \"%s\"" -msgstr "пЫЙВЛБ УЙОФБЛУЙУБ Ч ЧЩТБЦЕОЙЙ \"%s\"" - -#: codetoolsstrconsts:ctstermnotsimple -msgid "Term has no simple type" -msgstr "пРТЕДЕМЕОЙЕ ОЕ ЙНЕЕФ РТПУФПЗП ФЙРБ" - -#: codetoolsstrconsts:ctstoolsdirectory -msgid "Tools Directory" -msgstr "лБФБМПЗ ЙОУФТХНЕОФПЧ" - -#: codetoolsstrconsts:ctsunitpathinitialization -msgid "UnitPath Initialization" -msgstr "йОЙГЙБМЙЪБГЙС РХФЕК НПДХМЕК" - -#: codetoolsstrconsts:ctsunknownfunction -msgid "Unknown function %s" -msgstr "оЕЙЪЧЕУФОБС ЖХОЛГЙС %s" - -#: codetoolsstrconsts:ctsunparsed -msgid "Unparsed" -msgstr "оЕ ПВТБВПФБОП" - -#: codetoolsstrconsts:ctsutilsdirectories -msgid "Utils directories" -msgstr "лБФБМПЗЙ ХФЙМЙФ" - -#: codetoolsstrconsts:ctswidgetdirectory -msgid "Widget Directory" -msgstr "лБФБМПЗ ЬМЕНЕОФПЧ ХРТБЧМЕОЙС" - -#: codetoolsstrconsts:ctswordnotfound -msgid "\"%s\" not found" -msgstr "\"%s\" ОЕ ОБКДЕОП" - -#: codetoolsstrconsts:ctsclassofdefinitionnotresolved -msgid "\"class of\" definition not resolved: %s" -msgstr "оЕ ОБКДЕОП ТБОЕЕ ХРПНСОХФПЕ \"class of\": %s" - -#: codetoolsstrconsts:ctsendforclassnotfound -msgid "\"end\" for class/object not found" -msgstr "ОЕ ОБКДЕОП \"end\" ДМС ЛМБУУБ/ПВЯЕЛФБ" - -#: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink -msgid "a directory component in %s does not exist or is a dangling symlink" -msgstr "ЛПНРПОЕОФ ЛБФБМПЗБ Ч %s ОЕ УХЭЕУФЧХЕФ, ЙМЙ ПО - РПЧТЕЦДЈООБС УУЩМЛБ" - -#: codetoolsstrconsts:ctsdircomponentisnotdir -msgid "a directory component in %s is not a directory" -msgstr "ЛПНРПОЕОФ ЛБФБМПЗБ Ч %s - ОЕ ЛБФБМПЗ" - -#: codetoolsstrconsts:ctsaddsdirtosourcepath -msgid "adds %s to SrcPath" -msgstr "ДПВБЧМСЕФ %s Ч РХФЙ ЙУИПДОЙЛПЧ" - -#: codetoolsstrconsts:ctsanlclproject -msgid "an LCL project" -msgstr "РТПЕЛФ LCL" - -#: codetoolsstrconsts:ctsancestorisnotproperty -msgid "ancestor of untyped property is not a property" -msgstr "РТЕДПЛ ОЕФЙРЙЪЙТПЧБООПЗП УЧПКУФЧБ ОЕ СЧМСЕФУС УЧПКУФЧПН" - -#: codetoolsstrconsts:ctsbasetypeofnotfound -msgid "base type of \"%s\" not found" -msgstr "ПУОПЧОПК ФЙР \"%s\" ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctsbinaryoperator -msgid "binary operator" -msgstr "ВЙОБТОЩК ПРЕТБФПТ" - -#: codetoolsstrconsts:ctsbracketnotfound -msgid "bracket %s not found" -msgstr "УЛПВЛБ %s ОЕ ОБКДЕОБ" - -#: codetoolsstrconsts:ctsbracketcloseexpectedbutatomfound -msgid "bracket close expected, but %s found" -msgstr "ПЦЙДБЕФУС ЪБЛТЩЧБАЭБС УЛПВЛБ, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsbracketopenexpectedbutatomfound -msgid "bracket open expected, but %s found" -msgstr "ПЦЙДБЕФУС ПФЛТЩЧБАЭБС УЛПВЛБ, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctscircleindefinitions -msgid "circle in definitions" -msgstr "ГЙЛМ Ч ПРТЕДЕМЕОЙСИ" - -#: codetoolsstrconsts:ctsclassnotfound -msgid "class %s%s%s not found" -msgstr "ЛМБУУ %s%s%s ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctsclassidentifierexpected -msgid "class identifier expected" -msgstr "ПЦЙДБЕФУС ЙДЕОФЙЖЙЛБФПТ ЛМБУУБ" - -#: codetoolsstrconsts:ctsclassnodewithoutparentnode -msgid "class node without parent node" -msgstr "ПРЙУБОЙЕ ЛМБУУБ ВЕЪ РТЕДЛБ" - -#: codetoolsstrconsts:ctsclasswithoutname -msgid "class without name" -msgstr "ЛМБУУ ВЕЪ ЙНЕОЙ" - -#: codetoolsstrconsts:ctsconstant -msgid "constant" -msgstr "ЛПОУФБОФБ" - -#: codetoolsstrconsts:ctscursorposoutsideofcode -msgid "cursor pos outside of code" -msgstr "РПЪЙГЙС ЛХТУПТБ ЧОЕ ЛПДБ" - -#: codetoolsstrconsts:ctsdefaultclassancestortobjectnotfound -msgid "default class ancestor TObject not found" -msgstr "ЛМБУУ-РТЕДПЛ РП ХНПМЮБОЙА - TObject - ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctsdefaultinterfaceancestoriinterfacenotfound -msgid "default interface ancestor IInterface not found" -msgstr "ЙОФЕТЖЕКУ-РТЕДПЛ РП ХНПМЮБОЙА - IInterface - ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctsdefaultparameterexpectedbutatomfound -msgid "default parameter expected, but %s found" -msgstr "ПЦЙДБЕФУС РБТБНЕФТ РП ХНПМЮБОЙА, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsdefaultpropertynotfound -msgid "default property not found" -msgstr "УЧПКУФЧП РП ХНПМЮБОЙА ОЕ ОБКДЕОП" - -#: codetoolsstrconsts:ctsdefaultspecifierredefined -msgid "default specifier redefined" -msgstr "РЕТЕПРТЕДЕМЈО НПДЙЖЙЛБФПТ default (РП ХНПМЮБОЙА)" - -#: codetoolsstrconsts:ctsduplicateidentifier -msgid "duplicate identifier: %s" -msgstr "ДХВМЙТХЕФУС ЙДЕОФЙЖЙЛБФПТ: %s" - -#: codetoolsstrconsts:ctselse -msgid "else" -msgstr "" - -#: codetoolsstrconsts:ctsendforrecordnotfound -msgid "end for record not found" -msgstr "ЛПОЕГ ЪБРЙУЙ ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies -msgid "error during creation of new proc bodies" -msgstr "ПЫЙВЛБ РТЙ УПЪДБОЙЙ ОПЧЩИ ФЕМ РТПГЕДХТ" - -#: codetoolsstrconsts:ctserrorduringinsertingnewclassparts -msgid "error during inserting new class parts" -msgstr "ПЫЙВЛБ РТЙ ЧУФБЧЛЕ ОПЧЩИ ЮБУФЕК ЛМБУУБ" - -#: codetoolsstrconsts:ctserrorindirectiveexpression -msgid "error in directive expression" -msgstr "ПЙЫВЛБ Ч ЧЩТБЦЕОЙЙ ДЙТЕЛФЙЧЩ" - -#: codetoolsstrconsts:ctserrorinparamlist -msgid "error in paramlist" -msgstr "ПЫЙВЛБ Ч УРЙУЛЕ РБТБНЕФТПЧ" - -#: codetoolsstrconsts:ctsexecuteaccessdeniedforfile -msgid "execute access denied for %s" -msgstr "ОЕФ ДПУФХРБ ДМС ЧЩРПМОЕОЙС %s" - -#: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound -msgid "expected end., but %s found" -msgstr "ПЦЙДБЕФУС end., Б ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries -msgid "exports clause only allowed in libraries" -msgstr "" - -#: codetoolsstrconsts:ctsexprtypemustbeclassorrecord -msgid "expression type must be class or record type" -msgstr "ФЙР ЧЩТБЦЕОЙС ДПМЦЕО ВЩФШ ПВЯЕЛФПН ЙМЙ ЪБРЙУША" - -#: codetoolsstrconsts:ctsfiledoesnotexists -msgid "file \"%s\" does not exist" -msgstr "ЖБКМ \"%s\" ОЕ УХЭЕУФЧХЕФ" - -#: codetoolsstrconsts:ctsfileisreadonly -msgid "file is read only" -msgstr "ЖБКМ ФПМШЛП ДМС ЮФЕОЙС" - -#: codetoolsstrconsts:ctsgnomeintfdirectory -msgid "gnome interface directory" -msgstr "ЛБФБМПЗ ЙОФЕТЖЕКУБ gnome" - -#: codetoolsstrconsts:ctsgtk2intfdirectory -msgid "gtk2 interface directory" -msgstr "ЛБФБМПЗ ЙОФЕТЖЕКУБ gtk2" - -#: codetoolsstrconsts:ctsidentifier -msgid "identifier" -msgstr "ЙДЕОФЙЖЙЛБФПТ" - -#: codetoolsstrconsts:ctsidentexpectedbutatomfound -msgid "identifier expected, but %s found" -msgstr "ПЦЙДБЕФУС ЙДЕОФЙЖЙЛБФПТ, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsidentexpectedbutkeywordfound -msgid "identifier expected, but keyword %s found" -msgstr "ПЦЙДБЕФУС ЙДЕОФЙЖЙЛБФПТ, ОБКДЕОП ЛМАЮЕЧПЕ УМПЧП %s" - -#: codetoolsstrconsts:ctsidentifiernotfound -msgid "identifier not found: %s" -msgstr "ОЕ ОБКДЕО ЙДЕОФЙЖЙЛБФПТ: %s" - -#: codetoolsstrconsts:ctsillegalcircleinusedunits -msgid "illegal circle using unit: %s" -msgstr "ОЕЧЕТОПЕ ГЙЛМЙЮЕУЛПЕ ЙУРПМШЪПЧБОЙЕ НПДХМС: %s" - -#: codetoolsstrconsts:ctsillegalqualifier -msgid "illegal qualifier %s found" -msgstr "ПВОБТХЦЕО ОЕЛПТТЕЛФОЩК ХЛБЪБФЕМШ %s" - -#: codetoolsstrconsts:ctsimplementationnodenotfound -msgid "implementation node not found" -msgstr "УМПЧП implementation ОЕ ОБКДЕОП" - -#: codetoolsstrconsts:ctsincludedirectoriesplusdirs -msgid "include directories: %s" -msgstr "ЛБФБМПЗЙ ЧЛМАЮЕОЙК: %s" - -#: codetoolsstrconsts:ctsincludefilenotfound -msgid "include file not found \"%s\"" -msgstr "ЖБКМ ЧЛМАЮЕОЙС ОЕ ОБКДЕО \"%s\"" - -#: codetoolsstrconsts:ctsincompatibletypesgotexpected -msgid "incompatibles types: expected \"%s\" but got \"%s\"" -msgstr "ОЕУПЧНЕУФЙНЩЕ ФЙРЩ: ПЦЙДБМУС \"%s\", РПМХЮЙМЙ \"%s\"" - -#: codetoolsstrconsts:ctsindexparameterexpectedbutatomfound -msgid "index parameter expected, but %s found" -msgstr "ПЦЙДБЕФУС РБТБНЕФТ ЙОДЕЛУБ, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsindexspecifierredefined -msgid "index specifier redefined" -msgstr "НПДЙЖЙЛБФПТ ЙОДЕЛУБ РЕТЕПРТЕДЕМЕОП" - -#: codetoolsstrconsts:ctsinheritedkeywordonlyallowedinmethods -msgid "inherited keyword only allowed in methods" -msgstr "ЛМАЮЕЧПЕ УМПЧП inherited (ХОБУМЕДПЧБОП) ТБЪТЕЫЕОП ФПМШЛП Ч НЕФПДБИ" - -#: codetoolsstrconsts:ctsinsufficientmemory -msgid "insufficient memory" -msgstr "НБМП РБНСФЙ" - -#: codetoolsstrconsts:ctsintfdirectory -msgid "interface directory" -msgstr "ЛБФБМПЗ ЙОФЕТЖЕКУБ" - -#: codetoolsstrconsts:ctsinterfacesectionnotfound -msgid "interface section not found" -msgstr "ТБЪДЕМ ПРЙУБОЙК (interface) ОЕ ОБКДЕО" - -#: codetoolsstrconsts:ctsinvalidclassname2 -msgid "invalid class name %s%s%s" -msgstr "ОЕРТБЧЙМШОПЕ ЙНС ЛМБУУБ %s%s%s" - -#: codetoolsstrconsts:ctsinvalidclassname -msgid "invalid class name=%s%s%s" -msgstr "ОЕРТБЧЙМШОПЕ ЙНС ЛМБУУБ=%s%s%s" - -#: codetoolsstrconsts:ctsinvalidflagvaluefordirective -msgid "invalid flag value \"%s\" for directive %s" -msgstr "ОЕЧЕТОПЕ ЪОБЮЕОЙЕ ЖМБЗБ \"%s\" ДМС ДЙТЕЛФЙЧЩ %s" - -#: codetoolsstrconsts:ctsinvalidmode -msgid "invalid mode \"%s\"" -msgstr "ОЕЧЕТОЩК ТЕЦЙН \"%s\"" - -#: codetoolsstrconsts:ctsinvalidsubrange -msgid "invalid subrange" -msgstr "ОЕЧЕТОЩК РПДДЙБРБЪПО" - -#: codetoolsstrconsts:ctsinvalidtype -msgid "invalid type" -msgstr "ОЕЧЕТОЩК ФЙР" - -#: codetoolsstrconsts:ctsinvalidvariablename -msgid "invalid variable name %s%s%s" -msgstr "ОЕРТБЧЙМШОПЕ ЙНС РЕТЕНЕООПК %s%s%s" - -#: codetoolsstrconsts:ctsinvalidvariabletype -msgid "invalid variable type %s%s%s" -msgstr "ОЕРТБЧЙМШОЩК ФЙР РЕТЕНЕООПК %s%s%s" - -#: codetoolsstrconsts:ctskeyword -msgid "keyword" -msgstr "ЛМАЮЕЧПЕ УМПЧП" - -#: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound -msgid "keyword (e.g. %s) expected, but %s found" -msgstr "ЛМАЮЕЧПЕ УМПЧП (ОБРТ., %s) ПЦЙДБЕФУС, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctskeywordin -msgid "keyword \"in\"" -msgstr "ЛМАЮЕЧПЕ УМПЧП \"in\"" - -#: codetoolsstrconsts:ctslazarusmaindirectory -msgid "lazarus main directory" -msgstr "ЗМБЧОЩК ЛБФБМПЗ lazarus" - -#: codetoolsstrconsts:ctsmethodname -msgid "method name" -msgstr "ЙНС НЕФПДБ" - -#: codetoolsstrconsts:ctsmethodtypedefinitionnotfound -msgid "method type definition not found" -msgstr "ОЕ ОБКДЕОП ПРЙУБОЙЕ ФЙРБ НЕФПДБ" - -#: codetoolsstrconsts:ctsmissingpointafterend -msgid "missing . after end" -msgstr "ПФУХФУФЧХЕФ ФПЮЛБ (.) РПУМЕ end" - -#: codetoolsstrconsts:ctsmissingenumlist -msgid "missing enum list" -msgstr "ПФУХФУФЧХЕФ УРЙУПЛ РЕТЕЮЙУМЕОЙС" - -#: codetoolsstrconsts:ctsmissingtypeidentifier -msgid "missing type identifier" -msgstr "ПФУХФУФЧХЕФ ЙДЕОФЙЖЙЛБФПТ ФЙРБ" - -#: codetoolsstrconsts:ctsnewprocbodynotfound -msgid "new proc body not found" -msgstr "ФЕМП ОПЧПК РТПГЕДХТЩ ОЕ ОБКДЕОП" - -#: codetoolsstrconsts:ctsnocontextnodefoundatcursor -msgid "no context node found at cursor" -msgstr "ОЕ ОБКДЕОП ЛПОФЕЛУФОПЗП ЬМЕНЕОФБ Х ЛХТУПТБ" - -#: codetoolsstrconsts:ctsnopascalcodefound -msgid "no pascal code found (first token is %s)" -msgstr "ОЕ ОБКДЕОП ЛПДБ РБУЛБМС (РЕТЧЩК ЬМЕНЕОФ - %s)" - -#: codetoolsstrconsts:ctsnonodefoundatcursor -msgid "no pascal node found at cursor (i.e. in unparsed code)" -msgstr "ОЕ ОБКДЕОП ЪБРЙУЕК РБУЛБМС Х ЛХТУПТБ (Ф.Е. ОЕПВТБВБФЩЧБЕНЩК ЛПД)" - -#: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice -msgid "nodefault specifier defined twice" -msgstr "НПДЙЖЙЛБФПТ nodefault ПРТЕДЕМЈО ДЧБЦДЩ" - -#: codetoolsstrconsts:ctsoldmethodnotfound -msgid "old method not found: %s" -msgstr "ОЕ ОБКДЕО УФБТЩК НЕФПД: %s" - -#: codetoolsstrconsts:ctsprocedureorfunction -msgid "procedure or function" -msgstr "РТПГЕДХТБ ЙМЙ ЖХОЛГЙС" - -#: codetoolsstrconsts:ctsprocessorspecific -msgid "processor specific" -msgstr "УРЕГЙЖЙЮОЩК ДМС РТПГЕУУПТБ" - -#: codetoolsstrconsts:ctspropertyspecifieralreadydefined -msgid "property specifier already defined: %s" -msgstr "НПДЙЖЙЛБФПТ УЧПКУФЧБ ХЦЕ ПРТЕДЕМЕОП: %s" - -#: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound -msgid "property type expected, but %s found" -msgstr "ПЦЙДБЕФУС ФЙР УЧПКУФЧБ, ОБКДЕОП %s" - -#: codetoolsstrconsts:ctsqualifierexpectedbutatomfound -msgid "qualifier expected but %s found" -msgstr "ПЦЙДБМБУШ УУЩМЛБ, ОП ОБКДЕОП %s" - -#: codetoolsstrconsts:ctssemicolonnotfound -msgid "semicolon not found" -msgstr "ФПЮЛБ У ЪБРСФПК ОЕ ОБКДЕОБ" - -#: codetoolsstrconsts:ctssetsincpathto -msgid "sets IncPath to %s" -msgstr "ХУФБОБЧМЙЧБЕФ РХФЙ ЧЛМАЮЕОЙК Ч %s" - -#: codetoolsstrconsts:ctssetssrcpathto -msgid "sets SrcPath to %s" -msgstr "ХУФБОБЧМЙЧБЕФ РХФЙ ЙУИПДОЙЛПЧ Ч %s" - -#: codetoolsstrconsts:ctssourceisnotunit -msgid "source is not unit" -msgstr "ЙУИПДОЙЛ - ОЕ НПДХМШ" - -#: codetoolsstrconsts:ctssourcenotfoundunit -msgid "source not found: unit %s" -msgstr "ЙУИПДОЙЛ ОЕ ОБКДЕО?: НПДХМШ %s" - -#: codetoolsstrconsts:ctssrcpathforcompiledunits -msgid "src path for compiled units" -msgstr "РХФШ ЙУИПДОЙЛПЧ ДМС УПВТБООЩИ НПДХМЕК" - -#: codetoolsstrconsts:ctsstringconstant -msgid "string constant" -msgstr "УФТПЛПЧБС ЛПОУФБОФБ" - -#: codetoolsstrconsts:ctstypeidentifier -msgid "type identifier" -msgstr "ЙДЕОФЙЖЙЛБФПТ ФЙРБ" - -#: codetoolsstrconsts:ctstypesectionofclassnotfound -msgid "type section of class not found" -msgstr "УЕЛГЙС ФЙРБ ЛМБУУБ ОЕ ОБКДЕОБ" - -#: codetoolsstrconsts:ctsunabletoapplychanges -msgid "unable to apply changes" -msgstr "ОЕ НПЗХ РТЙНЕОЙФШ ЙЪНЕОЕОЙС" - -#: codetoolsstrconsts:ctsunabletocompleteproperty -msgid "unable to complete property" -msgstr "ОЕ НПЗХ ЪБЧЕТЫЙФШ УЧПКУФЧП" - -#: codetoolsstrconsts:ctsidentexpectedbuteoffound -msgid "unexpected end of file (identifier expected)" -msgstr "ОЕПЦЙДБООЩК ЛПОЕГ ЖБКМБ (ЙДЕОФЙЖЙЛБФПТ ПЦЙДБЕФУС)" - -#: codetoolsstrconsts:ctsunexpectedendofsource -msgid "unexpected end of source" -msgstr "ОЕПЦЙДБООЩК ЛПОЕГ ЙУИПДОЙЛБ" - -#: codetoolsstrconsts:ctsunexpectedkeyword -msgid "unexpected keyword \"%s\"" -msgstr "ОЕПЦЙДБООПЕ ЛМАЮЕЧПЕ УМПЧП \"%s\"" - -#: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards -msgid "unexpected keyword \"%s\" found while reading blocks backwards" -msgstr "ПВОБТХЦЕОП ОЕПЦЙДБООПЕ ЛМАЮЕЧПЕ УМПЧП \"%s\" РТЙ ЮФЕОЙЙ ВМПЛПЧ Ч ПВТБФОПН РПТСДЛЕ" - -#: codetoolsstrconsts:ctsunexpectedkeywordinasmblock -msgid "unexpected keyword \"%s\" in asm block found" -msgstr "ПВОБТХЦЕОП ОЕПЦЙДБООПЕ ЛМАЮЕЧПЕ УМПЧП \"%s\" Ч ВМПЛЕ БУУЕНВМЕТБ" - -#: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock -msgid "unexpected keyword \"%s\" in begin..end found" -msgstr "ПВОБТХЦЕОП ОЕПЦЙДБООПЕ ЛМАЮЕЧПЕ УМПЧП \"%s\" Ч ПРЕТБФПТОЩИ УЛПВЛБИ (begin...end)" - -#: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound -msgid "unexpected subrange operator '..' found" -msgstr "ПВОБТХЦЕО ОЕПЦЙДБООЩК ПРЕТБФПТ РПДДЙБРБЪПОБ '..'" - -#: codetoolsstrconsts:ctsunitnotfound -msgid "unit not found: %s" -msgstr "ОЕ ОБКДЕО НПДХМШ: %s" - -#: codetoolsstrconsts:ctsunknownsectionkeyword -msgid "unknown section keyword %s found" -msgstr "ПВОБТХЦЕОП ОЕЙЪЧЕУФОПЕ ЛМАЮЕЧПЕ УМПЧП УЕЛГЙЙ %s" - -#: codetoolsstrconsts:ctsusedunitisnotapascalunit -msgid "used unit is not a pascal unit" -msgstr "ЙУРПМШЪХЕНЩК НПДХМШ - ОЕ РБУЛБМЕЧУЛЙК" - diff --git a/components/codetools/languages/codetools.ruwin.po b/components/codetools/languages/codetools.ruwin.po deleted file mode 100644 index 9403ea9f21..0000000000 --- a/components/codetools/languages/codetools.ruwin.po +++ /dev/null @@ -1,740 +0,0 @@ -#: codetoolsstrconsts:ctsothercompilerdefines -msgid "%s Compiler Defines" -msgstr "Определения компилятора %s" - -#: codetoolsstrconsts:ctsnameddirectory -msgid "%s Directory" -msgstr "Каталог %s" - -#: codetoolsstrconsts:ctsnamedproject -msgid "%s Project" -msgstr "Проект %s" - -#: codetoolsstrconsts:ctsstrexpectedbutatomfound -msgid "%s expected, but %s found" -msgstr "ожидается %s, найдено %s" - -#: codetoolsstrconsts:ctsfilehascircularsymlink -msgid "%s has a circular symbolic link" -msgstr "%s содержит циклическую символическую ссылку" - -#: codetoolsstrconsts:ctsfileisnotexecutable -msgid "%s is not executable" -msgstr "%s - не исполняемый файл" - -#: codetoolsstrconsts:ctsawithoutb -msgid "%s without %s" -msgstr "%s без %s" - -#: codetoolsstrconsts:ctsunknownmainfilename -msgid "(unknown mainfilename)" -msgstr "(неизвестно имя главного файла)" - -#: codetoolsstrconsts:ctsunknownsubdescriptor -msgid "(unknown subdescriptor %s)" -msgstr "(Неизвестный субдескриптор)" - -#: codetoolsstrconsts:ctspointhintprocstartat -msgid ". Hint: proc start at " -msgstr ". Подсказка: процедура начинается в " - -#: codetoolsstrconsts:ctspointstartat -msgid ". start at " -msgstr ". начинается в " - -#: codetoolsstrconsts:ctssemicolonafterpropspecmissing -msgid "; expected after \"%s\" property specifier, but %s found" -msgstr "; ожидается после модификатора свойства \"%s\", но найдено %s" - -#: codetoolsstrconsts:ctsanoymdefinitionsarenotallowed -msgid "Anonymous %s definitions are not allowed" -msgstr "" - -#: codetoolsstrconsts:ctscpudirectory -msgid "CPU directory" -msgstr "" - -#: codetoolsstrconsts:ctsclasssnotfound -msgid "Class %s not found" -msgstr "Класс %s не найден" - -#: codetoolsstrconsts:ctscommandlineparameters -msgid "Command line parameters" -msgstr "Параметры командной строки " - -#: codetoolsstrconsts:ctscommentendnotfound -msgid "Comment end not found" -msgstr "Не найден конец комментария" - -#: codetoolsstrconsts:ctscompiledsrcpath -msgid "Compiled SrcPath" -msgstr "Путь исх.компилятора" - -#: codetoolsstrconsts:ctscompiler -msgid "Compiler" -msgstr "Компилятор" - -#: codetoolsstrconsts:ctscomponentsdirectory -msgid "Components Directory" -msgstr "Каталог компонентов" - -#: codetoolsstrconsts:ctscustomcomponentsdirectory -msgid "Custom Components Directory" -msgstr "Каталог компонентов пользователя" - -#: codetoolsstrconsts:ctsdebuggerdirectory -msgid "Debugger Directory" -msgstr "Каталог отладчика" - -#: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem -msgid "Default ppc386 source Operating System" -msgstr "Операционная система для исходника по умолчанию для ppc386" - -#: codetoolsstrconsts:ctsdefaultppc386source2operatingsystem -msgid "Default ppc386 source Operating System 2" -msgstr "" - -#: codetoolsstrconsts:ctsdefaultppc386symbol -msgid "Default ppc386 symbol" -msgstr "Символ ppc386 по умолчанию" - -#: codetoolsstrconsts:ctsdefaultppc386targetoperatingsystem -msgid "Default ppc386 target Operating System" -msgstr "Операционная система для исполняемого файла по умолчанию для ppc386" - -#: codetoolsstrconsts:ctsdefaultppc386targetprocessor -msgid "Default ppc386 target processor" -msgstr "Процессор для исполняемого файла по умолчанию для ppc386" - -#: codetoolsstrconsts:ctsdefine -msgid "Define " -msgstr "Определить " - -#: codetoolsstrconsts:ctsdefinemacroname -msgid "Define Macro %s" -msgstr "Определить макрос %s" - -#: codetoolsstrconsts:ctsdefinemacrocarbon1 -msgid "Define macro carbon1" -msgstr "" - -#: codetoolsstrconsts:ctsdefinemacrognome2 -msgid "Define macro gnome2" -msgstr "Определить макрос gnome2" - -#: codetoolsstrconsts:ctsdefinemacrogtk1 -msgid "Define macro gtk1" -msgstr "Определить макрос gtk1" - -#: codetoolsstrconsts:ctsdefinemacrogtk2 -msgid "Define macro gtk2" -msgstr "Определить макрос gtk2" - -#: codetoolsstrconsts:ctsdefinemacroqt1 -msgid "Define macro qt1" -msgstr "" - -#: codetoolsstrconsts:ctsdefinemacrowince1 -msgid "Define macro wince1" -msgstr "" - -#: codetoolsstrconsts:ctsdefineprocessortype -msgid "Define processor type" -msgstr "Определить тип процессора" - -#: codetoolsstrconsts:ctsdefsforlazarussources -msgid "Definitions for the Lazarus Sources" -msgstr "Описания для исходников Lazarus" - -#: codetoolsstrconsts:ctsdesignerdirectory -msgid "Designer Directory" -msgstr "Каталог 'дизайнера'" - -#: codetoolsstrconsts:ctsdesignerunitsdirectory -msgid "Designer Units" -msgstr "Модули 'дизайнера'" - -#: codetoolsstrconsts:ctsdoceditordirectory -msgid "Doc Editor Directory" -msgstr "Каталог редактора документации" - -#: codetoolsstrconsts:ctsendofsourcenotfound -msgid "End of source not found" -msgstr "Не найдено конца исходника" - -#: codetoolsstrconsts:ctsforward -msgid "Forward" -msgstr "" - -#: codetoolsstrconsts:ctsforwardclassdefinitionnotresolved -msgid "Forward class definition not resolved: %s" -msgstr "Не найдено описание ранее упомянутого класса: %s" - -#: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros -msgid "Free Pascal Compiler initial macros" -msgstr "Макросы инициализации компилятора FreePascal" - -#: codetoolsstrconsts:ctsfreepascalcomponentlibrary -msgid "Free Pascal Component Library" -msgstr "Библиотека компонентов FreePascal" - -#: codetoolsstrconsts:ctsfreepascalsourcedir -msgid "Free Pascal Source Directory" -msgstr "Каталог исходников FreePascal" - -#: codetoolsstrconsts:ctsfreepascalsourcesplusdesc -msgid "Free Pascal Sources, %s" -msgstr "Исходники FreePascal, %s" - -#: codetoolsstrconsts:ctsidedirectory -msgid "IDE Directory" -msgstr "" - -#: codetoolsstrconsts:ctsideintfdirectory -msgid "IDEIntf Directory" -msgstr "Каталог интерфейса IDE" - -#: codetoolsstrconsts:ctsidentifieralreadydefined -msgid "Identifier %s already defined" -msgstr "Идентификатор %s уже определён" - -#: codetoolsstrconsts:ctsiflclwidgettypeequalsgnome2 -msgid "If LCLWidgetType=gnome2 then" -msgstr "" - -#: codetoolsstrconsts:ctsiflclwidgettypeequalsgtk2 -msgid "If LCLWidgetType=gtk2 then" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotsrcos -msgid "If TargetOS<>SrcOS" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotsrcos2 -msgid "If TargetOS<>SrcOS2" -msgstr "" - -#: codetoolsstrconsts:ctsiftargetosisnotwin32 -msgid "If TargetOS<>win32 then" -msgstr "" - -#: codetoolsstrconsts:ctsincludecircledetected -msgid "Include circle detected" -msgstr "Обнаружено циклическое включение" - -#: codetoolsstrconsts:ctsinstalldirectory -msgid "Install Directory" -msgstr "" - -#: codetoolsstrconsts:ctsinstallerdirectories -msgid "Installer directories" -msgstr "" - -#: codetoolsstrconsts:ctsjitformdirectory -msgid "JITForm Directory" -msgstr "Каталог JITForm" - -#: codetoolsstrconsts:ctslazarussources -msgid "Lazarus Sources" -msgstr "Исходники lazarus" - -#: codetoolsstrconsts:ctsnestedcommentson -msgid "Nested Comments On" -msgstr "Вкл. вложенные комментарии" - -#: codetoolsstrconsts:ctsnoscanneravailable -msgid "No scanner available" -msgstr "Нет доступных 'сканеров'" - -#: codetoolsstrconsts:ctsnoscannerfound -msgid "No scanner found for \"%s\". If this is an include file, please open the main source first." -msgstr "Не найдено 'сканера' для \"%s\". Если это - включаемый файл, откройте сначала главный исходник." - -#: codetoolsstrconsts:ctspackagedirectories -msgid "Package directories" -msgstr "Каталоги пакетов" - -#: codetoolsstrconsts:ctspackagerdirectory -msgid "Packager Directory" -msgstr "Каталог менеджера пакетов" - -#: codetoolsstrconsts:ctspackagerregistrationdirectory -msgid "Packager Registration Directory" -msgstr "Каталог регистрации менеджера пакетов" - -#: codetoolsstrconsts:ctspackagerunitsdirectory -msgid "Packager Units Directory" -msgstr "Каталог модулей менеджера пакетов" - -#: codetoolsstrconsts:ctspositionnotinsource -msgid "Position not in source" -msgstr "" - -#: codetoolsstrconsts:ctsresetalldefines -msgid "Reset all defines" -msgstr "Сбросить все определения" - -#: codetoolsstrconsts:ctsruntimelibrary -msgid "Runtime library" -msgstr "Библиотека времени исполнения" - -#: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits -msgid "Source filenames for the standard fpc units" -msgstr "Имена файлов исходников для стандартных модулей fpc" - -#: codetoolsstrconsts:ctssrcpathinitialization -msgid "SrcPath Initialization" -msgstr "Инициализация путей исходников" - -#: codetoolsstrconsts:ctssyntaxerrorinexpr -msgid "Syntax Error in expression \"%s\"" -msgstr "Ошибка синтаксиса в выражении \"%s\"" - -#: codetoolsstrconsts:ctstermnotsimple -msgid "Term has no simple type" -msgstr "Определение не имеет простого типа" - -#: codetoolsstrconsts:ctstoolsdirectory -msgid "Tools Directory" -msgstr "Каталог инструментов" - -#: codetoolsstrconsts:ctsunitpathinitialization -msgid "UnitPath Initialization" -msgstr "Инициализация путей модулей" - -#: codetoolsstrconsts:ctsunknownfunction -msgid "Unknown function %s" -msgstr "Неизвестная функция %s" - -#: codetoolsstrconsts:ctsunparsed -msgid "Unparsed" -msgstr "Не обработано" - -#: codetoolsstrconsts:ctsutilsdirectories -msgid "Utils directories" -msgstr "Каталоги утилит" - -#: codetoolsstrconsts:ctswidgetdirectory -msgid "Widget Directory" -msgstr "Каталог элементов управления" - -#: codetoolsstrconsts:ctswordnotfound -msgid "\"%s\" not found" -msgstr "\"%s\" не найдено" - -#: codetoolsstrconsts:ctsclassofdefinitionnotresolved -msgid "\"class of\" definition not resolved: %s" -msgstr "Не найдено ранее упомянутое \"class of\": %s" - -#: codetoolsstrconsts:ctsendforclassnotfound -msgid "\"end\" for class/object not found" -msgstr "не найдено \"end\" для класса/объекта" - -#: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink -msgid "a directory component in %s does not exist or is a dangling symlink" -msgstr "компонент каталога в %s не существует, или он - повреждённая ссылка" - -#: codetoolsstrconsts:ctsdircomponentisnotdir -msgid "a directory component in %s is not a directory" -msgstr "компонент каталога в %s - не каталог" - -#: codetoolsstrconsts:ctsaddsdirtosourcepath -msgid "adds %s to SrcPath" -msgstr "добавляет %s в пути исходников" - -#: codetoolsstrconsts:ctsanlclproject -msgid "an LCL project" -msgstr "проект LCL" - -#: codetoolsstrconsts:ctsancestorisnotproperty -msgid "ancestor of untyped property is not a property" -msgstr "предок нетипизированного свойства не является свойством" - -#: codetoolsstrconsts:ctsbasetypeofnotfound -msgid "base type of \"%s\" not found" -msgstr "основной тип \"%s\" не найден" - -#: codetoolsstrconsts:ctsbinaryoperator -msgid "binary operator" -msgstr "бинарный оператор" - -#: codetoolsstrconsts:ctsbracketnotfound -msgid "bracket %s not found" -msgstr "скобка %s не найдена" - -#: codetoolsstrconsts:ctsbracketcloseexpectedbutatomfound -msgid "bracket close expected, but %s found" -msgstr "ожидается закрывающая скобка, найдено %s" - -#: codetoolsstrconsts:ctsbracketopenexpectedbutatomfound -msgid "bracket open expected, but %s found" -msgstr "ожидается открывающая скобка, найдено %s" - -#: codetoolsstrconsts:ctscircleindefinitions -msgid "circle in definitions" -msgstr "цикл в определениях" - -#: codetoolsstrconsts:ctsclassnotfound -msgid "class %s%s%s not found" -msgstr "класс %s%s%s не найден" - -#: codetoolsstrconsts:ctsclassidentifierexpected -msgid "class identifier expected" -msgstr "ожидается идентификатор класса" - -#: codetoolsstrconsts:ctsclassnodewithoutparentnode -msgid "class node without parent node" -msgstr "описание класса без предка" - -#: codetoolsstrconsts:ctsclasswithoutname -msgid "class without name" -msgstr "класс без имени" - -#: codetoolsstrconsts:ctsconstant -msgid "constant" -msgstr "константа" - -#: codetoolsstrconsts:ctscursorposoutsideofcode -msgid "cursor pos outside of code" -msgstr "позиция курсора вне кода" - -#: codetoolsstrconsts:ctsdefaultclassancestortobjectnotfound -msgid "default class ancestor TObject not found" -msgstr "класс-предок по умолчанию - TObject - не найден" - -#: codetoolsstrconsts:ctsdefaultinterfaceancestoriinterfacenotfound -msgid "default interface ancestor IInterface not found" -msgstr "интерфейс-предок по умолчанию - IInterface - не найден" - -#: codetoolsstrconsts:ctsdefaultparameterexpectedbutatomfound -msgid "default parameter expected, but %s found" -msgstr "ожидается параметр по умолчанию, найдено %s" - -#: codetoolsstrconsts:ctsdefaultpropertynotfound -msgid "default property not found" -msgstr "свойство по умолчанию не найдено" - -#: codetoolsstrconsts:ctsdefaultspecifierredefined -msgid "default specifier redefined" -msgstr "переопределён модификатор default (по умолчанию)" - -#: codetoolsstrconsts:ctsduplicateidentifier -msgid "duplicate identifier: %s" -msgstr "дублируется идентификатор: %s" - -#: codetoolsstrconsts:ctselse -msgid "else" -msgstr "" - -#: codetoolsstrconsts:ctsendforrecordnotfound -msgid "end for record not found" -msgstr "конец записи не найден" - -#: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies -msgid "error during creation of new proc bodies" -msgstr "ошибка при создании новых тел процедур" - -#: codetoolsstrconsts:ctserrorduringinsertingnewclassparts -msgid "error during inserting new class parts" -msgstr "ошибка при вставке новых частей класса" - -#: codetoolsstrconsts:ctserrorindirectiveexpression -msgid "error in directive expression" -msgstr "оишбка в выражении директивы" - -#: codetoolsstrconsts:ctserrorinparamlist -msgid "error in paramlist" -msgstr "ошибка в списке параметров" - -#: codetoolsstrconsts:ctsexecuteaccessdeniedforfile -msgid "execute access denied for %s" -msgstr "нет доступа для выполнения %s" - -#: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound -msgid "expected end., but %s found" -msgstr "ожидается end., а найдено %s" - -#: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries -msgid "exports clause only allowed in libraries" -msgstr "" - -#: codetoolsstrconsts:ctsexprtypemustbeclassorrecord -msgid "expression type must be class or record type" -msgstr "тип выражения должен быть объектом или записью" - -#: codetoolsstrconsts:ctsfiledoesnotexists -msgid "file \"%s\" does not exist" -msgstr "файл \"%s\" не существует" - -#: codetoolsstrconsts:ctsfileisreadonly -msgid "file is read only" -msgstr "файл только для чтения" - -#: codetoolsstrconsts:ctsgnomeintfdirectory -msgid "gnome interface directory" -msgstr "каталог интерфейса gnome" - -#: codetoolsstrconsts:ctsgtk2intfdirectory -msgid "gtk2 interface directory" -msgstr "каталог интерфейса gtk2" - -#: codetoolsstrconsts:ctsidentifier -msgid "identifier" -msgstr "идентификатор" - -#: codetoolsstrconsts:ctsidentexpectedbutatomfound -msgid "identifier expected, but %s found" -msgstr "ожидается идентификатор, найдено %s" - -#: codetoolsstrconsts:ctsidentexpectedbutkeywordfound -msgid "identifier expected, but keyword %s found" -msgstr "ожидается идентификатор, найдено ключевое слово %s" - -#: codetoolsstrconsts:ctsidentifiernotfound -msgid "identifier not found: %s" -msgstr "не найден идентификатор: %s" - -#: codetoolsstrconsts:ctsillegalcircleinusedunits -msgid "illegal circle using unit: %s" -msgstr "неверное циклическое использование модуля: %s" - -#: codetoolsstrconsts:ctsillegalqualifier -msgid "illegal qualifier %s found" -msgstr "обнаружен некорректный указатель %s" - -#: codetoolsstrconsts:ctsimplementationnodenotfound -msgid "implementation node not found" -msgstr "слово implementation не найдено" - -#: codetoolsstrconsts:ctsincludedirectoriesplusdirs -msgid "include directories: %s" -msgstr "каталоги включений: %s" - -#: codetoolsstrconsts:ctsincludefilenotfound -msgid "include file not found \"%s\"" -msgstr "файл включения не найден \"%s\"" - -#: codetoolsstrconsts:ctsincompatibletypesgotexpected -msgid "incompatibles types: expected \"%s\" but got \"%s\"" -msgstr "несовместимые типы: ожидался \"%s\", получили \"%s\"" - -#: codetoolsstrconsts:ctsindexparameterexpectedbutatomfound -msgid "index parameter expected, but %s found" -msgstr "ожидается параметр индекса, найдено %s" - -#: codetoolsstrconsts:ctsindexspecifierredefined -msgid "index specifier redefined" -msgstr "модификатор индекса переопределено" - -#: codetoolsstrconsts:ctsinheritedkeywordonlyallowedinmethods -msgid "inherited keyword only allowed in methods" -msgstr "ключевое слово inherited (унаследовано) разрешено только в методах" - -#: codetoolsstrconsts:ctsinsufficientmemory -msgid "insufficient memory" -msgstr "мало памяти" - -#: codetoolsstrconsts:ctsintfdirectory -msgid "interface directory" -msgstr "каталог интерфейса" - -#: codetoolsstrconsts:ctsinterfacesectionnotfound -msgid "interface section not found" -msgstr "раздел описаний (interface) не найден" - -#: codetoolsstrconsts:ctsinvalidclassname2 -msgid "invalid class name %s%s%s" -msgstr "неправильное имя класса %s%s%s" - -#: codetoolsstrconsts:ctsinvalidclassname -msgid "invalid class name=%s%s%s" -msgstr "неправильное имя класса=%s%s%s" - -#: codetoolsstrconsts:ctsinvalidflagvaluefordirective -msgid "invalid flag value \"%s\" for directive %s" -msgstr "неверное значение флага \"%s\" для директивы %s" - -#: codetoolsstrconsts:ctsinvalidmode -msgid "invalid mode \"%s\"" -msgstr "неверный режим \"%s\"" - -#: codetoolsstrconsts:ctsinvalidsubrange -msgid "invalid subrange" -msgstr "неверный поддиапазон" - -#: codetoolsstrconsts:ctsinvalidtype -msgid "invalid type" -msgstr "неверный тип" - -#: codetoolsstrconsts:ctsinvalidvariablename -msgid "invalid variable name %s%s%s" -msgstr "неправильное имя переменной %s%s%s" - -#: codetoolsstrconsts:ctsinvalidvariabletype -msgid "invalid variable type %s%s%s" -msgstr "неправильный тип переменной %s%s%s" - -#: codetoolsstrconsts:ctskeyword -msgid "keyword" -msgstr "ключевое слово" - -#: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound -msgid "keyword (e.g. %s) expected, but %s found" -msgstr "ключевое слово (напр., %s) ожидается, найдено %s" - -#: codetoolsstrconsts:ctskeywordin -msgid "keyword \"in\"" -msgstr "ключевое слово \"in\"" - -#: codetoolsstrconsts:ctslazarusmaindirectory -msgid "lazarus main directory" -msgstr "главный каталог lazarus" - -#: codetoolsstrconsts:ctsmethodname -msgid "method name" -msgstr "имя метода" - -#: codetoolsstrconsts:ctsmethodtypedefinitionnotfound -msgid "method type definition not found" -msgstr "не найдено описание типа метода" - -#: codetoolsstrconsts:ctsmissingpointafterend -msgid "missing . after end" -msgstr "отсутствует точка (.) после end" - -#: codetoolsstrconsts:ctsmissingenumlist -msgid "missing enum list" -msgstr "отсутствует список перечисления" - -#: codetoolsstrconsts:ctsmissingtypeidentifier -msgid "missing type identifier" -msgstr "отсутствует идентификатор типа" - -#: codetoolsstrconsts:ctsnewprocbodynotfound -msgid "new proc body not found" -msgstr "тело новой процедуры не найдено" - -#: codetoolsstrconsts:ctsnocontextnodefoundatcursor -msgid "no context node found at cursor" -msgstr "не найдено контекстного элемента у курсора" - -#: codetoolsstrconsts:ctsnopascalcodefound -msgid "no pascal code found (first token is %s)" -msgstr "не найдено кода паскаля (первый элемент - %s)" - -#: codetoolsstrconsts:ctsnonodefoundatcursor -msgid "no pascal node found at cursor (i.e. in unparsed code)" -msgstr "не найдено записей паскаля у курсора (т.е. необрабатываемый код)" - -#: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice -msgid "nodefault specifier defined twice" -msgstr "модификатор nodefault определён дважды" - -#: codetoolsstrconsts:ctsoldmethodnotfound -msgid "old method not found: %s" -msgstr "не найден старый метод: %s" - -#: codetoolsstrconsts:ctsprocedureorfunction -msgid "procedure or function" -msgstr "процедура или функция" - -#: codetoolsstrconsts:ctsprocessorspecific -msgid "processor specific" -msgstr "специфичный для процессора" - -#: codetoolsstrconsts:ctspropertyspecifieralreadydefined -msgid "property specifier already defined: %s" -msgstr "модификатор свойства уже определено: %s" - -#: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound -msgid "property type expected, but %s found" -msgstr "ожидается тип свойства, найдено %s" - -#: codetoolsstrconsts:ctsqualifierexpectedbutatomfound -msgid "qualifier expected but %s found" -msgstr "ожидалась ссылка, но найдено %s" - -#: codetoolsstrconsts:ctssemicolonnotfound -msgid "semicolon not found" -msgstr "точка с запятой не найдена" - -#: codetoolsstrconsts:ctssetsincpathto -msgid "sets IncPath to %s" -msgstr "устанавливает пути включений в %s" - -#: codetoolsstrconsts:ctssetssrcpathto -msgid "sets SrcPath to %s" -msgstr "устанавливает пути исходников в %s" - -#: codetoolsstrconsts:ctssourceisnotunit -msgid "source is not unit" -msgstr "исходник - не модуль" - -#: codetoolsstrconsts:ctssourcenotfoundunit -msgid "source not found: unit %s" -msgstr "исходник не найден?: модуль %s" - -#: codetoolsstrconsts:ctssrcpathforcompiledunits -msgid "src path for compiled units" -msgstr "путь исходников для собранных модулей" - -#: codetoolsstrconsts:ctsstringconstant -msgid "string constant" -msgstr "строковая константа" - -#: codetoolsstrconsts:ctstypeidentifier -msgid "type identifier" -msgstr "идентификатор типа" - -#: codetoolsstrconsts:ctstypesectionofclassnotfound -msgid "type section of class not found" -msgstr "секция типа класса не найдена" - -#: codetoolsstrconsts:ctsunabletoapplychanges -msgid "unable to apply changes" -msgstr "не могу применить изменения" - -#: codetoolsstrconsts:ctsunabletocompleteproperty -msgid "unable to complete property" -msgstr "не могу завершить свойство" - -#: codetoolsstrconsts:ctsidentexpectedbuteoffound -msgid "unexpected end of file (identifier expected)" -msgstr "неожиданный конец файла (идентификатор ожидается)" - -#: codetoolsstrconsts:ctsunexpectedendofsource -msgid "unexpected end of source" -msgstr "неожиданный конец исходника" - -#: codetoolsstrconsts:ctsunexpectedkeyword -msgid "unexpected keyword \"%s\"" -msgstr "неожиданное ключевое слово \"%s\"" - -#: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards -msgid "unexpected keyword \"%s\" found while reading blocks backwards" -msgstr "обнаружено неожиданное ключевое слово \"%s\" при чтении блоков в обратном порядке" - -#: codetoolsstrconsts:ctsunexpectedkeywordinasmblock -msgid "unexpected keyword \"%s\" in asm block found" -msgstr "обнаружено неожиданное ключевое слово \"%s\" в блоке ассемблера" - -#: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock -msgid "unexpected keyword \"%s\" in begin..end found" -msgstr "обнаружено неожиданное ключевое слово \"%s\" в операторных скобках (begin...end)" - -#: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound -msgid "unexpected subrange operator '..' found" -msgstr "обнаружен неожиданный оператор поддиапазона '..'" - -#: codetoolsstrconsts:ctsunitnotfound -msgid "unit not found: %s" -msgstr "не найден модуль: %s" - -#: codetoolsstrconsts:ctsunknownsectionkeyword -msgid "unknown section keyword %s found" -msgstr "обнаружено неизвестное ключевое слово секции %s" - -#: codetoolsstrconsts:ctsusedunitisnotapascalunit -msgid "used unit is not a pascal unit" -msgstr "используемый модуль - не паскалевский" - diff --git a/components/synedit/languages/synedit.ruold.po b/components/synedit/languages/synedit.ruold.po deleted file mode 100644 index fc461d8dd2..0000000000 --- a/components/synedit/languages/synedit.ruold.po +++ /dev/null @@ -1,212 +0,0 @@ -#: syneditstrconst:syns_scrollinfofmt -msgid "%d - %d" -msgstr "%d - %d" - -#: syneditstrconst:syns_filterasm68hc11 -msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" -msgstr "жБКМЩ БУУЕНВМЕТБ 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" - -#: syneditstrconst:syns_shortcutnone -msgid "" -msgstr "<ОЕФ>" - -#: syneditstrconst:syns_filterawk -msgid "AWK Script (*.awk)|*.awk" -msgstr "уЛТЙРФЩ AWK (*.awk)|*.awk" - -#: syneditstrconst:syns_filterbaan -msgid "Baan 4GL Files (*.cln)|*.cln" -msgstr "жБКМЩ Baan 4GL (*.cln)|*.cln" - -#: syneditstrconst:syns_filterdfm -msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm" -msgstr "жБКМЩ ЖПТН Borland (*.dfm;*.xfm)|*.dfm;*.xfm" - -#: syneditstrconst:syns_filtercpp -msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" -msgstr "" - -#: syneditstrconst:syns_filtercaclipper -msgid "CA-Clipper Files (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" -msgstr "жБКМЩ CA-Clipper (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" - -#: syneditstrconst:syns_filtercorbaidl -msgid "CORBA IDL files (*.idl)|*.idl" -msgstr "жБКМЩ CORBA IDL (*.idl)|*.idl" - -#: syneditstrconst:syns_filtercpm -msgid "CPM reports (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" -msgstr "пФЮЈФЩ CPM (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" - -#: syneditstrconst:syns_filtercache -msgid "Cache Files (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" -msgstr "жБКМЩ ЛЬЫБ (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" - -#: syneditstrconst:syns_filtercss -msgid "Cascading Stylesheets (*.css)|*.css" -msgstr "Cascading Stylesheets (*.css)|*.css" - -#: syneditstrconst:syns_filteradsp21xx -msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" -msgstr "жБКМЩ DSP (*.dsp,*.inc)|*.DSP;*.INC" - -#: syneditstrconst:syns_filterfortran -msgid "Fortran Files (*.for)|*.for" -msgstr "жБКМЩ ЖПТФТБОБ (*.for)|*.for" - -#: syneditstrconst:syns_filterfoxpro -msgid "Foxpro Files (*.prg)|*.prg" -msgstr "жБКМЩ Foxpro (*.prg)|*.prg" - -#: syneditstrconst:syns_filtergembase -msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM" -msgstr "жБКМЩ GEMBASE (*.dml,*.gem)|*.DML;*.GEM" - -#: syneditstrconst:syns_filtergws -msgid "GW-TEL Script Files (*.gws)|*.gws" -msgstr "уЛТЙРФЩ GW-TEL (*.gws)|*.gws" - -#: syneditstrconst:syns_filtergalaxy -msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" -msgstr "жБКМЩ Galaxy (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" - -#: syneditstrconst:syns_filterhp -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" -msgstr "" - -#: syneditstrconst:syns_filterhp48 -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" -msgstr "жБКМЩ HP48 (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" - -#: syneditstrconst:syns_exporterformathtml -msgid "HTML" -msgstr "HTML" - -#: syneditstrconst:syns_filterhtml -msgid "HTML Document (*.htm,*.html)|*.htm;*.html" -msgstr "дПЛХНЕОФ HTML (*.htm,*.html)|*.htm;*.html" - -#: syneditstrconst:syns_filterini -msgid "INI Files (*.ini)|*.ini" -msgstr "INI-ЖБКМЩ (*.ini)|*.ini" - -#: syneditstrconst:syns_filterinno -msgid "Inno Setup Script Files (*.iss)|*.iss" -msgstr "хУФБОПЧПЮОЩЕ УЛТЙРФЩ Inno (*.iss)|*.iss" - -#: syneditstrconst:syns_filterjava -msgid "Java Files (*.java)|*.java" -msgstr "жБКМЩ Java (*.java)|*.java" - -#: syneditstrconst:syns_filterjscript -msgid "Javascript Files (*.js)|*.js" -msgstr "жБКМЩ Javascript (*.js)|*.js" - -#: syneditstrconst:syns_filterkix -msgid "KiXtart scripts (*.kix)|*.kix" -msgstr "уЛТЙРФЩ KiXtart (*.kix)|*.kix" - -#: syneditstrconst:syns_filterlfm -msgid "Lazarus Form Files (*.lfm)|*.lfm" -msgstr "жБКМЩ ЖПТН Lazarus (*.lfm)|*.lfm" - -#: syneditstrconst:syns_filterbatch -msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" -msgstr "рБЛЕФОЩЕ ЖБКМЩ MS-DOS (*.bat;*.cmd)|*.bat;*.cmd" - -#: syneditstrconst:syns_filtermodelica -msgid "Modelica Files (*.mo)|*.mo" -msgstr "жБКМЩ Modelica (*.mo)|*.mo" - -#: syneditstrconst:syns_filtermodula3 -msgid "Modula-3 Files (*.m3)|*.m3" -msgstr "жБКМЩ нПДХМБ-3 (*.m3)|*.m3" - -#: syneditstrconst:syns_filtersyngenmsgfiles -msgid "Msg files (*.msg)|*.msg" -msgstr "жБКМЩ Msg (*.msg)|*.msg" - -#: syneditstrconst:syns_filterphp -msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" -msgstr "жБКМЩ PHP (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" - -#: syneditstrconst:syns_previewscrollinfofmt -msgid "Page: %d" -msgstr "уФТБОЙГБ: %d" - -#: syneditstrconst:syns_filterpascal -msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" -msgstr "жБКМЩ РБУЛБМС (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" - -#: syneditstrconst:syns_filterperl -msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" -msgstr "жБКМЩ Perl (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" - -#: syneditstrconst:syns_filterprogress -msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" -msgstr "жБКМЩ Progress (*.w,*.p,*.i)|*.w;*.p;*.i" - -#: syneditstrconst:syns_filterpython -msgid "Python Files (*.py)|*.py" -msgstr "жБКМЩ Python (*.py)|*.py" - -#: syneditstrconst:syns_exporterformatrtf -msgid "RTF" -msgstr "RTF" - -#: syneditstrconst:syns_filterrtf -msgid "Rich Text Format (*.rtf)|*.rtf" -msgstr "фЕЛУФ Ч ЖПТНБФЕ RTF (*.rtf)|*.rtf" - -#: syneditstrconst:syns_filtersql -msgid "SQL Files (*.sql)|*.sql" -msgstr "жБКМЩ SQL (*.sql)|*.sql" - -#: syneditstrconst:syns_filtersdd -msgid "Semanta DD files (*.sdd)|*.sdd" -msgstr "жБКМЩ Semanta DD (*.sdd)|*.sdd" - -#: syneditstrconst:syns_eduplicateshortcut -msgid "Shortcut already exists" -msgstr "лПНВЙОБГЙС ХЦЕ УХЭЕУФЧХЕФ" - -#: syneditstrconst:syns_filtersml -msgid "Standard ML Files (*.sml)|*.sml" -msgstr "Standard ML Files (*.sml)|*.sml" - -#: syneditstrconst:syns_filtertcltk -msgid "Tcl/Tk Files (*.tcl)|*.tcl" -msgstr "жБКМЩ Tcl/Tk (*.tcl)|*.tcl" - -#: syneditstrconst:syns_filtertex -msgid "TeX Files (*.tex)|*.tex" -msgstr "" - -#: syneditstrconst:syns_duplicateshortcutmsg -msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" -msgstr "лПНВЙОБГЙС \"%s\" ХЦЕ РТЙУЧПЕОБ ДТХЗПК ЛПНБОДЕ ТЕДБЛФПТБ. (%s)" - -#: syneditstrconst:syns_scrollinfofmttop -msgid "Top Line: %d" -msgstr "чЕТИОСС УФТПЛБ: %d" - -#: syneditstrconst:syns_filterunixshellscript -msgid "UNIX Shell Scripts (*.sh)|*.sh" -msgstr "" - -#: syneditstrconst:syns_filtervbscript -msgid "VBScript Files (*.vbs)|*.vbs" -msgstr "жБКМЩ VBScript (*.vbs)|*.vbs" - -#: syneditstrconst:syns_filtervisualbasic -msgid "Visual Basic Files (*.bas)|*.bas" -msgstr "жБКМЩ Visual Basic (*.bas)|*.bas" - -#: syneditstrconst:syns_filterxml -msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" -msgstr "дПЛХНЕОФЩ XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" - -#: syneditstrconst:syns_filterx86asm -msgid "x86 Assembly Files (*.asm)|*.ASM" -msgstr "жБКМЩ БУУЕНВМЕТБ x86 (*.asm)|*.ASM" - diff --git a/components/synedit/languages/synedit.ruwin.po b/components/synedit/languages/synedit.ruwin.po deleted file mode 100644 index 6798ae3495..0000000000 --- a/components/synedit/languages/synedit.ruwin.po +++ /dev/null @@ -1,212 +0,0 @@ -#: syneditstrconst:syns_scrollinfofmt -msgid "%d - %d" -msgstr "%d - %d" - -#: syneditstrconst:syns_filterasm68hc11 -msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" -msgstr "Файлы ассемблера 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" - -#: syneditstrconst:syns_shortcutnone -msgid "" -msgstr "<нет>" - -#: syneditstrconst:syns_filterawk -msgid "AWK Script (*.awk)|*.awk" -msgstr "Скрипты AWK (*.awk)|*.awk" - -#: syneditstrconst:syns_filterbaan -msgid "Baan 4GL Files (*.cln)|*.cln" -msgstr "Файлы Baan 4GL (*.cln)|*.cln" - -#: syneditstrconst:syns_filterdfm -msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm" -msgstr "Файлы форм Borland (*.dfm;*.xfm)|*.dfm;*.xfm" - -#: syneditstrconst:syns_filtercpp -msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" -msgstr "" - -#: syneditstrconst:syns_filtercaclipper -msgid "CA-Clipper Files (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" -msgstr "Файлы CA-Clipper (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" - -#: syneditstrconst:syns_filtercorbaidl -msgid "CORBA IDL files (*.idl)|*.idl" -msgstr "Файлы CORBA IDL (*.idl)|*.idl" - -#: syneditstrconst:syns_filtercpm -msgid "CPM reports (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" -msgstr "Отчёты CPM (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" - -#: syneditstrconst:syns_filtercache -msgid "Cache Files (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" -msgstr "Файлы кэша (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" - -#: syneditstrconst:syns_filtercss -msgid "Cascading Stylesheets (*.css)|*.css" -msgstr "Cascading Stylesheets (*.css)|*.css" - -#: syneditstrconst:syns_filteradsp21xx -msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" -msgstr "Файлы DSP (*.dsp,*.inc)|*.DSP;*.INC" - -#: syneditstrconst:syns_filterfortran -msgid "Fortran Files (*.for)|*.for" -msgstr "Файлы фортрана (*.for)|*.for" - -#: syneditstrconst:syns_filterfoxpro -msgid "Foxpro Files (*.prg)|*.prg" -msgstr "Файлы Foxpro (*.prg)|*.prg" - -#: syneditstrconst:syns_filtergembase -msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM" -msgstr "Файлы GEMBASE (*.dml,*.gem)|*.DML;*.GEM" - -#: syneditstrconst:syns_filtergws -msgid "GW-TEL Script Files (*.gws)|*.gws" -msgstr "Скрипты GW-TEL (*.gws)|*.gws" - -#: syneditstrconst:syns_filtergalaxy -msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" -msgstr "Файлы Galaxy (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" - -#: syneditstrconst:syns_filterhp -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" -msgstr "" - -#: syneditstrconst:syns_filterhp48 -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" -msgstr "Файлы HP48 (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" - -#: syneditstrconst:syns_exporterformathtml -msgid "HTML" -msgstr "HTML" - -#: syneditstrconst:syns_filterhtml -msgid "HTML Document (*.htm,*.html)|*.htm;*.html" -msgstr "Документ HTML (*.htm,*.html)|*.htm;*.html" - -#: syneditstrconst:syns_filterini -msgid "INI Files (*.ini)|*.ini" -msgstr "INI-файлы (*.ini)|*.ini" - -#: syneditstrconst:syns_filterinno -msgid "Inno Setup Script Files (*.iss)|*.iss" -msgstr "Установочные скрипты Inno (*.iss)|*.iss" - -#: syneditstrconst:syns_filterjava -msgid "Java Files (*.java)|*.java" -msgstr "Файлы Java (*.java)|*.java" - -#: syneditstrconst:syns_filterjscript -msgid "Javascript Files (*.js)|*.js" -msgstr "Файлы Javascript (*.js)|*.js" - -#: syneditstrconst:syns_filterkix -msgid "KiXtart scripts (*.kix)|*.kix" -msgstr "Скрипты KiXtart (*.kix)|*.kix" - -#: syneditstrconst:syns_filterlfm -msgid "Lazarus Form Files (*.lfm)|*.lfm" -msgstr "Файлы форм Lazarus (*.lfm)|*.lfm" - -#: syneditstrconst:syns_filterbatch -msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" -msgstr "Пакетные файлы MS-DOS (*.bat;*.cmd)|*.bat;*.cmd" - -#: syneditstrconst:syns_filtermodelica -msgid "Modelica Files (*.mo)|*.mo" -msgstr "Файлы Modelica (*.mo)|*.mo" - -#: syneditstrconst:syns_filtermodula3 -msgid "Modula-3 Files (*.m3)|*.m3" -msgstr "Файлы Модула-3 (*.m3)|*.m3" - -#: syneditstrconst:syns_filtersyngenmsgfiles -msgid "Msg files (*.msg)|*.msg" -msgstr "Файлы Msg (*.msg)|*.msg" - -#: syneditstrconst:syns_filterphp -msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" -msgstr "Файлы PHP (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" - -#: syneditstrconst:syns_previewscrollinfofmt -msgid "Page: %d" -msgstr "Страница: %d" - -#: syneditstrconst:syns_filterpascal -msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" -msgstr "Файлы паскаля (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" - -#: syneditstrconst:syns_filterperl -msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" -msgstr "Файлы Perl (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" - -#: syneditstrconst:syns_filterprogress -msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" -msgstr "Файлы Progress (*.w,*.p,*.i)|*.w;*.p;*.i" - -#: syneditstrconst:syns_filterpython -msgid "Python Files (*.py)|*.py" -msgstr "Файлы Python (*.py)|*.py" - -#: syneditstrconst:syns_exporterformatrtf -msgid "RTF" -msgstr "RTF" - -#: syneditstrconst:syns_filterrtf -msgid "Rich Text Format (*.rtf)|*.rtf" -msgstr "Текст в формате RTF (*.rtf)|*.rtf" - -#: syneditstrconst:syns_filtersql -msgid "SQL Files (*.sql)|*.sql" -msgstr "Файлы SQL (*.sql)|*.sql" - -#: syneditstrconst:syns_filtersdd -msgid "Semanta DD files (*.sdd)|*.sdd" -msgstr "Файлы Semanta DD (*.sdd)|*.sdd" - -#: syneditstrconst:syns_eduplicateshortcut -msgid "Shortcut already exists" -msgstr "Комбинация уже существует" - -#: syneditstrconst:syns_filtersml -msgid "Standard ML Files (*.sml)|*.sml" -msgstr "Standard ML Files (*.sml)|*.sml" - -#: syneditstrconst:syns_filtertcltk -msgid "Tcl/Tk Files (*.tcl)|*.tcl" -msgstr "Файлы Tcl/Tk (*.tcl)|*.tcl" - -#: syneditstrconst:syns_filtertex -msgid "TeX Files (*.tex)|*.tex" -msgstr "" - -#: syneditstrconst:syns_duplicateshortcutmsg -msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" -msgstr "Комбинация \"%s\" уже присвоена другой команде редактора. (%s)" - -#: syneditstrconst:syns_scrollinfofmttop -msgid "Top Line: %d" -msgstr "Верхняя строка: %d" - -#: syneditstrconst:syns_filterunixshellscript -msgid "UNIX Shell Scripts (*.sh)|*.sh" -msgstr "" - -#: syneditstrconst:syns_filtervbscript -msgid "VBScript Files (*.vbs)|*.vbs" -msgstr "Файлы VBScript (*.vbs)|*.vbs" - -#: syneditstrconst:syns_filtervisualbasic -msgid "Visual Basic Files (*.bas)|*.bas" -msgstr "Файлы Visual Basic (*.bas)|*.bas" - -#: syneditstrconst:syns_filterxml -msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" -msgstr "Документы XML (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" - -#: syneditstrconst:syns_filterx86asm -msgid "x86 Assembly Files (*.asm)|*.ASM" -msgstr "Файлы ассемблера x86 (*.asm)|*.ASM" - diff --git a/components/synedit/languages/synmacrorecorder.ruold.po b/components/synedit/languages/synmacrorecorder.ruold.po deleted file mode 100644 index f8f9351fd4..0000000000 --- a/components/synedit/languages/synmacrorecorder.ruold.po +++ /dev/null @@ -1,16 +0,0 @@ -#: synmacrorecorder:scannotpause -msgid "Can only pause when recording" -msgstr "" - -#: synmacrorecorder:scannotresume -msgid "Can only resume when paused" -msgstr "" - -#: synmacrorecorder:scannotplay -msgid "Cannot playback macro when recording" -msgstr "" - -#: synmacrorecorder:scannotrecord -msgid "Cannot record macro when recording" -msgstr "" - diff --git a/components/synedit/languages/synmacrorecorder.ruwin.po b/components/synedit/languages/synmacrorecorder.ruwin.po deleted file mode 100644 index f8f9351fd4..0000000000 --- a/components/synedit/languages/synmacrorecorder.ruwin.po +++ /dev/null @@ -1,16 +0,0 @@ -#: synmacrorecorder:scannotpause -msgid "Can only pause when recording" -msgstr "" - -#: synmacrorecorder:scannotresume -msgid "Can only resume when paused" -msgstr "" - -#: synmacrorecorder:scannotplay -msgid "Cannot playback macro when recording" -msgstr "" - -#: synmacrorecorder:scannotrecord -msgid "Cannot record macro when recording" -msgstr "" - diff --git a/languages/lazaruside.ru.po b/languages/lazaruside.ru.po index aa96bf85f9..3585aa2b90 100644 --- a/languages/lazaruside.ru.po +++ b/languages/lazaruside.ru.po @@ -1,3 +1,14 @@ +msgid "" +msgstr "" +"Last-Translator: Maxim Ganetsky \n" +"Project-Id-Version: lazaruside\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2006-02-11 20:14+0300\n" +"Language-Team: \n" +"MIME-Version: 1.0\n" + #: lazarusidestrconsts:srkmcommand1 msgid " command1 \"" msgstr " команда1 \"" @@ -10,14 +21,18 @@ msgstr " команда2 \"" msgid " A token %s%s%s already exists! " msgstr "Элемент %s%s%s уже существует! " -#: lazarusidestrconsts:srkmalreadyconnected -msgid " The key \"%s\" is already connected to \"%s\"." -msgstr "Клавика \"%s\" уже сопоставлена СЃ \"%s\"." - #: lazarusidestrconsts:srkmconflicw msgid " conflicts with " msgstr " конфликтует СЃ " +#: lazarusidestrconsts:srkmalreadyconnected +msgid " The key \"%s\" is already connected to \"%s\"." +msgstr "Клавиша \"%s\" уже сопоставлена СЃ \"%s\"." + +#: lazarusidestrconsts:lisnewproject +msgid "%s - (new project)" +msgstr "%s - (новый проект)" + #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" msgstr "%s (компилирую ...)" @@ -26,13 +41,9 @@ msgstr "%s (компилирую ...)" msgid "%s (debugging ...)" msgstr "%s (идёт отладка ...)" -#: lazarusidestrconsts:lisnewproject -msgid "%s - (new project)" -msgstr "%s - (новый проект)" - #: lazarusidestrconsts:lislazarusversionstring msgid "%s beta" -msgstr "" +msgstr "%s бета" #: lazarusidestrconsts:lisuidbytes msgid "%s bytes" @@ -40,7 +51,7 @@ msgstr "%s байт" #: lazarusidestrconsts:liscodetoolsdefsdirectory msgid "%s directory" -msgstr "%s - это каталог" +msgstr "Каталог %s" #: lazarusidestrconsts:lisisalreadypartoftheproject msgid "%s is already part of the Project." @@ -64,7 +75,7 @@ msgstr "%s%s%s - некорректное название модуля" #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." -msgstr "" +msgstr "%s%sНажмите OK если уверены." #: lazarusidestrconsts:lispkgsysfilename msgid "%s%sFile Name: %s%s%s" @@ -72,20 +83,20 @@ msgstr "%s%sРРјСЏ файла: %s%s%s" #: lazarusidestrconsts:lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" -msgstr "" +msgstr "%s%sНевозможно изменить класс %s РЅР° %s" #: lazarusidestrconsts:lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sРРјСЏ модуля: %s%s%s" -#: lazarusidestrconsts:lispckeditpage -msgid "%s, Page: %s" -msgstr "%s, Страница: %s" - #: lazarusidestrconsts:liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "%s, автосоздан" +#: lazarusidestrconsts:lispckeditpage +msgid "%s, Page: %s" +msgstr "%s, Страница: %s" + #: lazarusidestrconsts:liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "%s, связан СЃ проектом" @@ -212,19 +223,23 @@ msgstr "&РћРєРЅР°" #: lazarusidestrconsts:liscefilter msgid "(Filter)" -msgstr "" +msgstr "(Фильтр)" #: lazarusidestrconsts:dlgbaknosubdirectory msgid "(no subdirectory)" -msgstr "" +msgstr "(нет подкаталога)" #: lazarusidestrconsts:listmunknownmacro msgid "(unknown macro: %s)" msgstr "(неизвестный макрос: %s)" -#: lazarusidestrconsts:lislazdocnotagcaption -msgid "" -msgstr "" +#: lazarusidestrconsts:dlgdoesnotexist +msgid "\" does not exist." +msgstr "\" РЅРµ существует." + +#: lazarusidestrconsts:uefilerotext2 +msgid "\" is not writable." +msgstr "\" РЅРµ для записи." #: lazarusidestrconsts:lisa2pchooseanexistingfile msgid "" @@ -234,6 +249,10 @@ msgstr "<выберите существующий файл>" msgid "" msgstr "<РќРµ выбрано переменных>" +#: lazarusidestrconsts:lislazdocnotagcaption +msgid "" +msgstr "<НЕТ>" + #: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "%s РЅРµ может содержать компоненты TControl.%sР’ него можно помещать только невизуальные компоненты." @@ -244,7 +263,7 @@ msgstr "Файл %s%s%s уже существует.%s Заменить?" #: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" -msgstr "Модуль паскаля должен иметь расширение .pp или .pas" +msgstr "Модуль Паскаля должен иметь расширение .pp или .pas" #: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." @@ -252,7 +271,7 @@ msgstr "Требуемый пакет РЅРµ найден. РЎРј. диаграмм #: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." -msgstr "" +msgstr "Файл простой программы РЅР° Паскале.%sМожет использоваться для тестирования наспех.%sЛучше создайте новый проект." #: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." @@ -260,27 +279,31 @@ msgstr "Нормальный инструмент обязательно РґРѕР» #: lazarusidestrconsts:lispdabort msgid "Abort" -msgstr "" - -#: lazarusidestrconsts:lismenuabortbuild -msgid "Abort Build" -msgstr "Прервать СЃР±РѕСЂРєСѓ" +msgstr "Прервать" #: lazarusidestrconsts:lisabortall msgid "Abort all" -msgstr "" +msgstr "Прервать РІСЃРµ" #: lazarusidestrconsts:lisabortallloading msgid "Abort all loading" msgstr "" +#: lazarusidestrconsts:srkmecabortbuild +msgid "abort build" +msgstr "прервать СЃР±РѕСЂРєСѓ" + +#: lazarusidestrconsts:lismenuabortbuild +msgid "Abort Build" +msgstr "Прервать СЃР±РѕСЂРєСѓ" + #: lazarusidestrconsts:lisabortloadingproject msgid "Abort loading project" -msgstr "" +msgstr "Прервать загрузку проекта" #: lazarusidestrconsts:lismenutemplateabout msgid "About" -msgstr "Рћ " +msgstr "Рћ проекте" #: lazarusidestrconsts:lismenuaboutlazarus msgid "About Lazarus" @@ -310,22 +333,6 @@ msgstr "Добавить %s Рє проекту?" msgid "Add &Watch At Cursor" msgstr "Добавить &наблюдение Сѓ РєСѓСЂСЃРѕСЂР°" -#: lazarusidestrconsts:lisa2paddfile -msgid "Add File" -msgstr "Добавить файл" - -#: lazarusidestrconsts:lisa2paddfiles -msgid "Add Files" -msgstr "Добавить файлы" - -#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist -msgid "Add LFM, LRS files, if they exist" -msgstr "Добавить LFM, LRS файлы, если есть" - -#: lazarusidestrconsts:lisa2paddunit -msgid "Add Unit" -msgstr "Добавить модуль" - #: lazarusidestrconsts:lismenuaddcurunittopkg msgid "Add active unit to a package" msgstr "Добавить активный модуль Рє проекту" @@ -334,6 +341,10 @@ msgstr "Добавить активный модуль Рє проекту" msgid "Add an item" msgstr "Добавить элемент" +#: lazarusidestrconsts:srkmecaddbreakpoint +msgid "add break point" +msgstr "добавить точку останова" + #: lazarusidestrconsts:lismenuaddbreakpoint msgid "Add breakpoint" msgstr "Добавить точку останова" @@ -350,6 +361,10 @@ msgstr "Добавить файл редактора Рє Проекту" msgid "Add editor files" msgstr "Добавить файлы редактора" +#: lazarusidestrconsts:lisa2paddfile +msgid "Add File" +msgstr "Добавить файл" + #: lazarusidestrconsts:lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Добавить файл Рє пакету" @@ -362,6 +377,10 @@ msgstr "Добавить файл Рє проекту" msgid "Add files" msgstr "Добавить файлы" +#: lazarusidestrconsts:lisa2paddfiles +msgid "Add Files" +msgstr "Добавить файлы" + #: lazarusidestrconsts:lisa2paddfilestopackage msgid "Add files to package" msgstr "Добавить файлы Рє пакету" @@ -374,9 +393,13 @@ msgstr "Добавить точку перехода" msgid "Add jump point to history" msgstr "Добавить точку перехода РІ историю" +#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist +msgid "Add LFM, LRS files, if they exist" +msgstr "Добавить LFM, LRS файлы, если есть" + #: lazarusidestrconsts:lislazdocaddlinkbutton msgid "Add link" -msgstr "" +msgstr "Добавить ссылку" #: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" @@ -384,7 +407,7 @@ msgstr "Добавить параметры Рє зависимым пакетам #: lazarusidestrconsts:lislazdocaddpathbutton msgid "Add path" -msgstr "" +msgstr "Добавить путь" #: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" @@ -402,10 +425,18 @@ msgstr "Добавить Рє пакету" msgid "Add to project" msgstr "Добавить Рє проекту" +#: lazarusidestrconsts:lisa2paddunit +msgid "Add Unit" +msgstr "Добавить модуль" + #: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "" +#: lazarusidestrconsts:srkmecaddwatch +msgid "add watch" +msgstr "добавить наблюдение" + #: lazarusidestrconsts:lismenuaddwatch msgid "Add watch ..." msgstr "Добавить наблюдение..." @@ -414,10 +445,6 @@ msgstr "Добавить наблюдение..." msgid "Add..." msgstr "Добав." -#: lazarusidestrconsts:dlgadditionalsrcpath -msgid "Additional Source search path for all projects (.pp;.pas)" -msgstr "Дополнительные пути РёСЃС…РѕРґРЅРёРєРѕРІ для всех проектов (.pp;.pas)" - #: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Дополнительные параметры компилятора, унаследованные РѕС‚ пакетов" @@ -426,6 +453,10 @@ msgstr "Дополнительные параметры компилятора, msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Дополнительные файлы для РїРѕРёСЃРєР° (напр. /path/*.pas;/path2/*.pp)" +#: lazarusidestrconsts:dlgadditionalsrcpath +msgid "Additional Source search path for all projects (.pp;.pas)" +msgstr "Дополнительные пути РёСЃС…РѕРґРЅРёРєРѕРІ для всех проектов (.pp;.pas)" + #: lazarusidestrconsts:dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Выровнять верхнюю строку РїРѕ комментарию" @@ -438,21 +469,21 @@ msgstr "Выравнивание" msgid "Alignment" msgstr "Выравнивание" -#: lazarusidestrconsts:lisallfiles -msgid "All Files" -msgstr "Р’СЃРµ файлы" - #: lazarusidestrconsts:dlgallfiles msgid "All files" msgstr "Р’СЃРµ файлы" +#: lazarusidestrconsts:lisallfiles +msgid "All Files" +msgstr "Р’СЃРµ файлы" + #: lazarusidestrconsts:lisedtdefallpackages msgid "All packages" msgstr "Р’СЃРµ пакеты" #: lazarusidestrconsts:lisedtdefsallprojects msgid "All projects" -msgstr "" +msgstr "Р’СЃРµ проекты" #: lazarusidestrconsts:dlglabelgoto msgid "Allow LABEL and GOTO" @@ -470,17 +501,21 @@ msgstr "РџРѕ алфавиту" msgid "Alt" msgstr "Alt" -#: lazarusidestrconsts:dlgaltsetclmode -msgid "Alt-Key sets column mode" -msgstr "РљРЅРѕРїРєР° Alt - режим колонок" - #: lazarusidestrconsts:srkmalternkey msgid "Alternative Key" msgstr "Альтернативная клавиша" +#: lazarusidestrconsts:dlgaltsetclmode +msgid "Alt-Key sets column mode" +msgstr "РљРЅРѕРїРєР° Alt - режим колонок" + #: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" -msgstr "" +msgstr "Собирать всегда (даже РїСЂРё отсутствии изменений)" + +#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile +msgid "Ambiguous additional compiler config file" +msgstr "Найден дополнительный файл настроек компилятора СЃ тем же именем" #: lazarusidestrconsts:lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" @@ -490,18 +525,6 @@ msgstr "Неясный тип предка" msgid "Ambiguous Class Name" msgstr "Неясное РёРјСЏ класса" -#: lazarusidestrconsts:lisa2pambiguousunitname -msgid "Ambiguous Unit Name" -msgstr "Двусмысленное РёРјСЏ модуля" - -#: lazarusidestrconsts:lisambiguousunitfound -msgid "Ambiguous Unit found" -msgstr "Найден модуль СЃ тем же именем" - -#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile -msgid "Ambiguous additional compiler config file" -msgstr "Найден дополнительный файл настроек компилятора СЃ тем же именем" - #: lazarusidestrconsts:dlgambigfileact msgid "Ambiguous file action:" msgstr "Неясное действие СЃ файлом:" @@ -518,6 +541,14 @@ msgstr "Найден неправильный файл: %s%s%s%sРћРЅ может msgid "Ambiguous files found" msgstr "Найдены разные файлы" +#: lazarusidestrconsts:lisambiguousunitfound +msgid "Ambiguous Unit found" +msgstr "Найден модуль СЃ тем же именем" + +#: lazarusidestrconsts:lisa2pambiguousunitname +msgid "Ambiguous Unit Name" +msgstr "Двусмысленное РёРјСЏ модуля" + #: lazarusidestrconsts:lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Найдены модули СЃ одинаково опознаваемыми именами" @@ -538,6 +569,10 @@ msgstr "Добавить Рє секции" msgid "Application" msgstr "Приложение" +#: lazarusidestrconsts:srvk_apps +msgid "application key" +msgstr "клавиша приложения" + #: lazarusidestrconsts:dlgapplicationsettings msgid "Application Settings" msgstr "Параметры приложения" @@ -558,14 +593,14 @@ msgstr "Применить" msgid "Arabic" msgstr "Арабский" -#: lazarusidestrconsts:dlgcoasis -msgid "As-Is" -msgstr "Как-есть" - #: lazarusidestrconsts:lissortselascending msgid "Ascending" msgstr "Наследуемый" +#: lazarusidestrconsts:dlgcoasis +msgid "As-Is" +msgstr "Как-есть" + #: lazarusidestrconsts:dlgenvask msgid "Ask" msgstr "Спросить" @@ -602,6 +637,14 @@ msgstr "Автосоздаваемые элементы РЅРµ РјРѕРіСѓС‚ реда msgid "Auto indent" msgstr "Автовыделение" +#: lazarusidestrconsts:lisoipautoinstalldynamic +msgid "auto install dynamic" +msgstr "автоустановить динамически" + +#: lazarusidestrconsts:lisoipautoinstallstatic +msgid "auto install static" +msgstr "автоустановить статически" + #: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Пересобрать РїСЂРё пересборке всех" @@ -628,7 +671,7 @@ msgstr "Автоматически (или английский)" #: lazarusidestrconsts:lisautomaticfeatures msgid "Automatic features" -msgstr "" +msgstr "Автоматические функции" #: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" @@ -660,7 +703,7 @@ msgstr "РћРґРёРЅ назад" #: lazarusidestrconsts:dlgbackcolor msgid "Background" -msgstr "" +msgstr "Фон" #: lazarusidestrconsts:srvk_back msgid "Backspace" @@ -692,7 +735,7 @@ msgstr "Блок" #: lazarusidestrconsts:dlgblockindent msgid "Block indent" -msgstr "" +msgstr "Отступ блока" #: lazarusidestrconsts:dlgedbold msgid "Bold" @@ -714,10 +757,6 @@ msgstr "" msgid "Bracket highlighting" msgstr "Подсветка СЃРєРѕР±РѕРє" -#: lazarusidestrconsts:lismenubeaklinesinselection -msgid "Break Lines in selection" -msgstr "Разрыв строк РІ выделенном" - #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" msgstr "Разорвать строку, сдвинуть РєСѓСЂСЃРѕСЂ" @@ -726,6 +765,10 @@ msgstr "Разорвать строку, сдвинуть РєСѓСЂСЃРѕСЂ" msgid "Break line, leave cursor" msgstr "Разорвать строку, оставить РєСѓСЂСЃРѕСЂ" +#: lazarusidestrconsts:lismenubeaklinesinselection +msgid "Break Lines in selection" +msgstr "Разрыв строк РІ выделенном" + #: lazarusidestrconsts:lismenuviewbreakpoints msgid "BreakPoints" msgstr "Точки останова" @@ -754,6 +797,14 @@ msgstr "РћР±Р·РѕСЂ..." msgid "Build" msgstr "РЎР±РѕСЂРєР°" +#: lazarusidestrconsts:lismenubuildall +msgid "Build all" +msgstr "Собрать РІСЃРµ" + +#: lazarusidestrconsts:srkmecbuildall +msgid "build all files of program/project" +msgstr "собрать РІСЃРµ файлы программы/проекта" + #: lazarusidestrconsts:lisbuildcodetools msgid "Build CodeTools" msgstr "Собрать CodeTools" @@ -770,6 +821,10 @@ msgstr "Собрать компоненты (SynEdit, CodeTools)" msgid "Build Examples" msgstr "Собрать примеры" +#: lazarusidestrconsts:srkmecbuildfile +msgid "build file" +msgstr "собрать файл" + #: lazarusidestrconsts:lismenubuildfile msgid "Build File" msgstr "Собрать файл" @@ -790,14 +845,22 @@ msgstr "Собрать JIT Form" msgid "Build JITForm" msgstr "Собрать JITForm" -#: lazarusidestrconsts:lisbuildlcl -msgid "Build LCL" -msgstr "Собрать LCL" +#: lazarusidestrconsts:srkmecbuildlazarus +msgid "Build lazarus" +msgstr "Собрать lazarus" #: lazarusidestrconsts:lismenubuildlazarus msgid "Build Lazarus" msgstr "Собрать Lazarus" +#: lazarusidestrconsts:lisbuildlcl +msgid "Build LCL" +msgstr "Собрать LCL" + +#: lazarusidestrconsts:lisbuildnewproject +msgid "Build new project" +msgstr "Собрать новый проект" + #: lazarusidestrconsts:lisbuildnumber msgid "Build Number" msgstr "Номер СЃР±РѕСЂРєРё" @@ -806,6 +869,10 @@ msgstr "Номер СЃР±РѕСЂРєРё" msgid "Build Package Registration" msgstr "Зарегистрировать пакет" +#: lazarusidestrconsts:srkmecbuild +msgid "build program/project" +msgstr "собрать программу/проект" + #: lazarusidestrconsts:lisbuildstarter msgid "Build Starter" msgstr "Собрать Загрузчик" @@ -814,18 +881,6 @@ msgstr "Собрать Загрузчик" msgid "Build SynEdit" msgstr "Собрать SynEdit" -#: lazarusidestrconsts:lismenubuildall -msgid "Build all" -msgstr "Собрать РІСЃРµ" - -#: lazarusidestrconsts:srkmecbuildlazarus -msgid "Build lazarus" -msgstr "Собрать lazarus" - -#: lazarusidestrconsts:lisbuildnewproject -msgid "Build new project" -msgstr "Собрать новый проект" - #: lazarusidestrconsts:dlgcmacro msgid "C Style Macros (global)" msgstr "Макросы стиля C (глобально)" @@ -838,22 +893,18 @@ msgstr "Операторы стиля C (*=, +=, /= and -=)" msgid "C++ Styled INLINE" msgstr "INLINE стиля C++" -#: lazarusidestrconsts:lismenuinsertcvskeyword -msgid "CVS keyword" -msgstr "Ключ CVS" - #: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Вызвать процедуру %sRegister%s выбранного модуля" -#: lazarusidestrconsts:lismenuviewcallstack -msgid "Call Stack" -msgstr "Стек вызовов" - #: lazarusidestrconsts:liscocallon msgid "Call on:" msgstr "Вызов:" +#: lazarusidestrconsts:lismenuviewcallstack +msgid "Call Stack" +msgstr "Стек вызовов" + #: lazarusidestrconsts:liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "РќРµ РјРѕРіСѓ скопировать компонент верхнего СѓСЂРѕРІРЅСЏ." @@ -876,11 +927,11 @@ msgstr "Отмена" #: lazarusidestrconsts:liscancelloadingunit msgid "Cancel loading unit" -msgstr "" +msgstr "Отменить загрузку модуля" #: lazarusidestrconsts:liscancelrenaming msgid "Cancel renaming" -msgstr "" +msgstr "Отменить переименование" #: lazarusidestrconsts:lisaboutnocontributors msgid "Cannot find contributors list." @@ -896,20 +947,20 @@ msgstr "Заглавный" #: lazarusidestrconsts:dlgcaretskipsselection msgid "Caret skips selection" -msgstr "" +msgstr "РљСѓСЂСЃРѕСЂ пропускает выделенное" #: lazarusidestrconsts:lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "Нечувствительный Рє регистру" -#: lazarusidestrconsts:dlgcasesensitive -msgid "Case Sensitive" -msgstr "РЎ учетом регистра" - #: lazarusidestrconsts:lisfindfilecasesensitive msgid "Case sensitive" msgstr "РЎ учётом регистра" +#: lazarusidestrconsts:dlgcasesensitive +msgid "Case Sensitive" +msgstr "РЎ учетом регистра" + #: lazarusidestrconsts:rslanguagecatalan msgid "Catalan" msgstr "Каталанский" @@ -934,14 +985,14 @@ msgstr "Рзменить" msgid "Change Class" msgstr "Рзменить класс" -#: lazarusidestrconsts:lismenuinsertchangelogentry -msgid "ChangeLog entry" -msgstr "Элемент ChangeLog" - #: lazarusidestrconsts:lisdiskdiffchangedfiles msgid "Changed files:" msgstr "Рзменённые файлы:" +#: lazarusidestrconsts:lismenuinsertchangelogentry +msgid "ChangeLog entry" +msgstr "Элемент ChangeLog" + #: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Рзменение имени пакета или версии нарушит зависимости. Рзменить ли эти зависимости?%sВыберите Да для замены всех перечисленных зависимостей.%sРџСЂРѕРїСѓСЃРє - для разрыва зависимостей Рё продолжения." @@ -954,46 +1005,22 @@ msgstr "РЎРёРјРІРѕР»" msgid "Character Map" msgstr "Таблица символов" -#: lazarusidestrconsts:lismenuchecklfm -msgid "Check LFM file in editor" -msgstr "Проверить файл LFM РІ редакторе" - #: lazarusidestrconsts:lischeckchangesondiskwithloading msgid "Check changes on disk with loading" -msgstr "" +msgstr "Проверять изменения РЅР° РґРёСЃРєРµ РїСЂРё загрузке" #: lazarusidestrconsts:dlgcheckconsistency msgid "Check consistency" msgstr "Целостность?" +#: lazarusidestrconsts:lismenuchecklfm +msgid "Check LFM file in editor" +msgstr "Проверить файл LFM РІ редакторе" + #: lazarusidestrconsts:dlgcochecks msgid "Checks:" msgstr "Проверка:" -#: lazarusidestrconsts:lischoosedelphiproject -msgid "Choose Delphi project (*.dpr)" -msgstr "Выберите проект Delphi (*.dpr)" - -#: lazarusidestrconsts:lischoosedelphiunit -msgid "Choose Delphi unit (*.pas)" -msgstr "Выберите модуль Delphi (*.pas)" - -#: lazarusidestrconsts:lisctdefchoosedirectory -msgid "Choose Directory" -msgstr "Выберите каталог" - -#: lazarusidestrconsts:lischoosefpcsourcedir -msgid "Choose FPC source directory" -msgstr "Выберите каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" - -#: lazarusidestrconsts:lischooselazarussourcedirectory -msgid "Choose Lazarus Directory" -msgstr "Выберите каталог Lazarus" - -#: lazarusidestrconsts:lisedoptschoosescheme -msgid "Choose Scheme" -msgstr "Выбрать схему" - #: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "Выберите базовый класс для избранного свойства %s%s%s." @@ -1014,10 +1041,30 @@ msgstr "Выберите РёРјСЏ компилятора (%s)" msgid "Choose debugger filename" msgstr "Выберите РёРјСЏ отладчика" +#: lazarusidestrconsts:lischoosedelphiproject +msgid "Choose Delphi project (*.dpr)" +msgstr "Выберите проект Delphi (*.dpr)" + +#: lazarusidestrconsts:lischoosedelphiunit +msgid "Choose Delphi unit (*.pas)" +msgstr "Выберите модуль Delphi (*.pas)" + #: lazarusidestrconsts:lischoosedirectory msgid "Choose directory" msgstr "Выбор каталога" +#: lazarusidestrconsts:lisctdefchoosedirectory +msgid "Choose Directory" +msgstr "Выберите каталог" + +#: lazarusidestrconsts:lischoosefpcsourcedir +msgid "Choose FPC source directory" +msgstr "Выберите каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" + +#: lazarusidestrconsts:lischooselazarussourcedirectory +msgid "Choose Lazarus Directory" +msgstr "Выберите каталог Lazarus" + #: lazarusidestrconsts:lischoosemakepath msgid "Choose make path" msgstr "Выберите путь make" @@ -1038,6 +1085,10 @@ msgstr "Выберите РѕРґРёРЅ РёР· этих элементов для СЃРѕР· msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Выберите РёСЃС…РѕРґРЅРёРє программы (*.pp,*.pas,*.lpr)" +#: lazarusidestrconsts:lisedoptschoosescheme +msgid "Choose Scheme" +msgstr "Выбрать схему" + #: lazarusidestrconsts:lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Выберите структуру для заключения РІ неё выделения" @@ -1074,14 +1125,6 @@ msgstr "Р’ РїРѕСЂСЏРґРєРµ классов" msgid "Class part insert policy" msgstr "Политика вставки частей класса" -#: lazarusidestrconsts:liscldircleandirectory -msgid "Clean Directory" -msgstr "Очистить каталог" - -#: lazarusidestrconsts:liscleanlazarussource -msgid "Clean Lazarus Source" -msgstr "Очистить РёСЃС…РѕРґРЅРёРєРё Lazarus" - #: lazarusidestrconsts:lislazbuildcleanall msgid "Clean all" msgstr "Очистить РІСЃС‘" @@ -1090,13 +1133,21 @@ msgstr "Очистить РІСЃС‘" msgid "Clean directory" msgstr "Очистить каталог" +#: lazarusidestrconsts:liscldircleandirectory +msgid "Clean Directory" +msgstr "Очистить каталог" + +#: lazarusidestrconsts:liscleanlazarussource +msgid "Clean Lazarus Source" +msgstr "Очистить РёСЃС…РѕРґРЅРёРєРё Lazarus" + #: lazarusidestrconsts:liscldircleansubdirectories msgid "Clean sub directories" msgstr "Очистить подкаталоги" #: lazarusidestrconsts:liscleanupunitpath msgid "Clean up unit path?" -msgstr "" +msgstr "Очистить путь Рє модулям?" #: lazarusidestrconsts:lislazbuildcleanbuild msgid "Clean+Build" @@ -1134,17 +1185,9 @@ msgstr "Создание РєРѕРґР°" msgid "Code Explorer" msgstr "Обозреватель РєРѕРґР°" -#: lazarusidestrconsts:lismenueditcodetemplates -msgid "Code Templates" -msgstr "Шаблоны РєРѕРґР°" - -#: lazarusidestrconsts:dlgcodetoolstab -msgid "Code Tools" -msgstr "CodeTools" - #: lazarusidestrconsts:dlgusecodefolding msgid "Code folding (experimental)" -msgstr "" +msgstr "Сворачивание РєРѕРґР° (экспериметальное)" #: lazarusidestrconsts:dlgedcodeparams msgid "Code parameters" @@ -1158,13 +1201,33 @@ msgstr "Завершение шаблонов РєРѕРґР°" msgid "Code templates" msgstr "Шаблоны РєРѕРґР°" +#: lazarusidestrconsts:lismenueditcodetemplates +msgid "Code Templates" +msgstr "Шаблоны РєРѕРґР°" + +#: lazarusidestrconsts:dlgcodetoolstab +msgid "Code Tools" +msgstr "CodeTools" + #: lazarusidestrconsts:lisceocodeexplorer msgid "CodeExplorer Options" -msgstr "" +msgstr "Опции Обозревателя РљРѕРґР°" + +#: lazarusidestrconsts:srkmcatcodetools +msgid "CodeTools commands" +msgstr "Команды CodeTools" + +#: lazarusidestrconsts:srkmeccodetoolsdefinesed +msgid "Codetools defines editor" +msgstr "Редактор определений CodeTools" + +#: lazarusidestrconsts:lismenucodetoolsdefineseditor +msgid "CodeTools defines editor" +msgstr "Настройки редактора CodeTools" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" -msgstr "" +msgstr "Редактор Определений CodeTools" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" @@ -1174,29 +1237,17 @@ msgstr "Просмотр настроек CodeTools" msgid "CodeTools Directory Values" msgstr "Параметры каталогов CodeTools" -#: lazarusidestrconsts:dlgcodetoolsopts -msgid "CodeTools Options" -msgstr "Настройки CodeTools" - -#: lazarusidestrconsts:srkmcatcodetools -msgid "CodeTools commands" -msgstr "Команды CodeTools" - -#: lazarusidestrconsts:lismenucodetoolsdefineseditor -msgid "CodeTools defines editor" -msgstr "Настройки редактора CodeTools" +#: lazarusidestrconsts:srkmeccodetoolsoptions +msgid "Codetools options" +msgstr "Настройки Codetools" #: lazarusidestrconsts:lismenucodetoolsoptions msgid "CodeTools options" msgstr "Настройки CodeTools" -#: lazarusidestrconsts:srkmeccodetoolsdefinesed -msgid "Codetools defines editor" -msgstr "" - -#: lazarusidestrconsts:srkmeccodetoolsoptions -msgid "Codetools options" -msgstr "Настройки Codetools" +#: lazarusidestrconsts:dlgcodetoolsopts +msgid "CodeTools Options" +msgstr "Настройки CodeTools" #: lazarusidestrconsts:lismenucollectpofil msgid "Collect .po files" @@ -1210,6 +1261,14 @@ msgstr "Колонка" msgid "Color" msgstr "Цвет" +#: lazarusidestrconsts:dlglefttopclr +msgid "color for left, top" +msgstr "цвет слева сверху" + +#: lazarusidestrconsts:dlgrightbottomclr +msgid "color for right, bottom" +msgstr "цвет справа СЃРЅРёР·Сѓ" + #: lazarusidestrconsts:dlgclrscheme msgid "Color Scheme:" msgstr "Цветовая схема:" @@ -1232,7 +1291,7 @@ msgstr "Команда" #: lazarusidestrconsts:liscommandafter msgid "Command after" -msgstr "" +msgstr "Команда после" #: lazarusidestrconsts:liscommandafterinvalid msgid "Command after invalid" @@ -1274,14 +1333,14 @@ msgstr "Компиляция" msgid "Compile" msgstr "Компилировать" -#: lazarusidestrconsts:liscompileidewithoutlinking -msgid "Compile IDE (without linking)" -msgstr "Компиляция IDE (без СЃР±РѕСЂРєРё)" - #: lazarusidestrconsts:lispckeditcompileeverything msgid "Compile everything?" msgstr "Собрать РІСЃС‘?" +#: lazarusidestrconsts:liscompileidewithoutlinking +msgid "Compile IDE (without linking)" +msgstr "Компиляция IDE (без СЃР±РѕСЂРєРё)" + #: lazarusidestrconsts:lispckeditcompilepackage msgid "Compile package" msgstr "Собрать пакет" @@ -1294,6 +1353,18 @@ msgstr "добавление CompiledSrcPath" msgid "Compiler" msgstr "Компилятор" +#: lazarusidestrconsts:liscompilererror +msgid "Compiler error" +msgstr "Ошибка компилятора" + +#: lazarusidestrconsts:liscompilerfilename +msgid "Compiler filename" +msgstr "РРјСЏ файла компилятора" + +#: lazarusidestrconsts:srkmeccompileroptions +msgid "compiler options" +msgstr "параметры компилятора" + #: lazarusidestrconsts:dlgcompileroptions msgid "Compiler Options" msgstr "Опции компилятора" @@ -1310,26 +1381,22 @@ msgstr "Параметры компилятора для проекта: %s" msgid "Compiler Options..." msgstr "Параметры компилятора..." -#: lazarusidestrconsts:liscompilererror -msgid "Compiler error" -msgstr "Ошибка компилятора" - -#: lazarusidestrconsts:liscompilerfilename -msgid "Compiler filename" -msgstr "РРјСЏ файла компилятора" +#: lazarusidestrconsts:liscodetoolsdefscompilerpath +msgid "compiler path" +msgstr "путь Рє компилятору" #: lazarusidestrconsts:dlgfpcpath msgid "Compiler path (%s)" msgstr "Путь компилятора (%s)" -#: lazarusidestrconsts:lismenucompletecode -msgid "Complete Code" -msgstr "Завершить РєРѕРґ" - #: lazarusidestrconsts:srkmeccompletecode msgid "Complete code" msgstr "Завершить РєРѕРґ" +#: lazarusidestrconsts:lismenucompletecode +msgid "Complete Code" +msgstr "Завершить РєРѕРґ" + #: lazarusidestrconsts:dlgcompleteproperties msgid "Complete properties" msgstr "Завершать свойства" @@ -1350,6 +1417,10 @@ msgstr "РРјСЏ компонента %s%s%s - некорректный идент msgid "Components menu commands" msgstr "Команды компонентов меню" +#: lazarusidestrconsts:srkmecconfigbuildfile +msgid "config build file" +msgstr "файл настроек СЃР±РѕСЂРєРё" + #: lazarusidestrconsts:dlgconfigfiles msgid "Config Files:" msgstr "Файлы настроек:" @@ -1358,18 +1429,14 @@ msgstr "Файлы настроек:" msgid "Configure %sBuild Lazarus%s" msgstr "Настроить %sСобрать Lazarus%s" -#: lazarusidestrconsts:lismenuconfigbuildfile -msgid "Configure Build+Run File" -msgstr "Настроить Собрать+Запустить Файл" - -#: lazarusidestrconsts:lismenuconfigurehelp -msgid "Configure Help" -msgstr "Настроить Справку" - #: lazarusidestrconsts:lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" msgstr "Настроить \"Собрать Lazarus\"" +#: lazarusidestrconsts:lismenuconfigbuildfile +msgid "Configure Build+Run File" +msgstr "Настроить Собрать+Запустить Файл" + #: lazarusidestrconsts:lismenuconfigcustomcomps msgid "Configure custom components" msgstr "Настроить компоненты пользователя" @@ -1378,13 +1445,17 @@ msgstr "Настроить компоненты пользователя" msgid "Configure custom tools ..." msgstr "Настроить инструменты пользователя" +#: lazarusidestrconsts:lismenuconfigurehelp +msgid "Configure Help" +msgstr "Настроить Справку" + #: lazarusidestrconsts:lismenueditinstallpkgs msgid "Configure installed packages" msgstr "Настроить установленные пакеты" #: lazarusidestrconsts:lislazbuildconfirmbuild msgid "Confirm Before ReBuild Lazarus" -msgstr "" +msgstr "Спросить перед пересборкой Lazarus" #: lazarusidestrconsts:lisconfirmchanges msgid "Confirm changes" @@ -1416,11 +1487,11 @@ msgstr "Справка, зависимая РѕС‚ контекста" #: lazarusidestrconsts:liscontinue msgid "Continue" -msgstr "" +msgstr "Продолжить" #: lazarusidestrconsts:liscontinuewithoutloadingform msgid "Continue without loading form" -msgstr "" +msgstr "Продолжить, РЅРµ загружая форму" #: lazarusidestrconsts:liscontributors msgid "Contributors" @@ -1434,22 +1505,18 @@ msgstr "Элемент управления" msgid "Control needs parent" msgstr "Элемент управления требует \"родителя\"" -#: lazarusidestrconsts:lismakeresstrconversionoptions -msgid "Conversion Options" -msgstr "Настройки преобразований" - #: lazarusidestrconsts:lisconversionerror msgid "Conversion error" msgstr "Ошибка преобразования" +#: lazarusidestrconsts:lismakeresstrconversionoptions +msgid "Conversion Options" +msgstr "Настройки преобразований" + #: lazarusidestrconsts:srvk_convert msgid "Convert" msgstr "Преобразовать" -#: lazarusidestrconsts:lismenuconvertdfmtolfm -msgid "Convert DFM file to LFM" -msgstr "Преобразовать DFM РІ LFM" - #: lazarusidestrconsts:lismenuconvertdelphiproject msgid "Convert Delphi Project to Lazarus Project" msgstr "Преобразовать проект Delphi РІ проект Lazarus" @@ -1458,6 +1525,10 @@ msgstr "Преобразовать проект Delphi РІ проект Lazarus" msgid "Convert Delphi unit to Lazarus unit" msgstr "Преобразовать модуль Delphi РІ Lazarus" +#: lazarusidestrconsts:lismenuconvertdfmtolfm +msgid "Convert DFM file to LFM" +msgstr "Преобразовать DFM РІ LFM" + #: lazarusidestrconsts:liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Преобразовать элемент" @@ -1470,13 +1541,9 @@ msgstr "Преобразовать РўРђР‘ РІ пробелы РІ выделенн msgid "Copy" msgstr "Копировать" -#: lazarusidestrconsts:liscopyerror -msgid "Copy Error" -msgstr "Ошибка копирования" - #: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" -msgstr "" +msgstr "Копировать РІСЃРµ (Рё скрытые тоже) сообщения РІ буфер обмена" #: lazarusidestrconsts:liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" @@ -1486,13 +1553,17 @@ msgstr "Скопировать РІСЃРµ сообщения РІ буфер" msgid "Copy error" msgstr "Ошибка копирования" +#: lazarusidestrconsts:liscopyerror +msgid "Copy Error" +msgstr "Ошибка копирования" + #: lazarusidestrconsts:lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Скопировать выбранные компоненты РІ буфер" #: lazarusidestrconsts:liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" -msgstr "" +msgstr "Копировать выделенные сообщения РІ буфер обмена" #: lazarusidestrconsts:srkmeccopy msgid "Copy selection to clipboard" @@ -1508,7 +1579,7 @@ msgstr "Копирование всей формы РЅРµ реализовано." #: lazarusidestrconsts:lisgplnotice msgid "Copyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" +msgstr "Авторское право (C) <РіРѕРґ> <РёРјСЏ автора> %sДанная программа является свободным программным обеспечением. Р’С‹ вправе распространять ее Рё/или модифицировать РІ соответствии СЃ условиями версии 2 либо РїРѕ вашему выбору СЃ условиями более поздней версии Стандартной Общественной Лицензии GNU, опубликованной Free Software Foundation. %sРњС‹ распространяем эту программу РІ надежде РЅР° то, что РѕРЅР° будет вам полезной, однако РќР• ПРЕДОСТАВЛЯЕМ РќРђ НЕЕ РќРРљРђРљРРҐ ГАРАНТРР™, РІ том числе ГАРАНТРРТОВАРНОГО РЎРћРЎРўРћРЇРќРРЇ ПРРПРОДАЖЕ Рё РџР РГОДНОСТРДЛЯ РСПОЛЬЗОВАНРРЇ Р’ КОНКРЕТНЫХ ЦЕЛЯХ. Для получения более РїРѕРґСЂРѕР±РЅРѕР№ информации ознакомьтесь СЃРѕ Стандартной Общественной Лицензией GNU. %sРљРѕРїРёСЏ Стандартной Общественной Лицензии GNU доступна РїРѕ адресу . Р’С‹ также можете получить её, написав РІРѕ Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." #: lazarusidestrconsts:lislgplnotice msgid "Copyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." @@ -1526,6 +1597,58 @@ msgstr "Создать" msgid "Create .po files" msgstr "Создать файлы .po" +#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained +msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." +msgstr "Создать РЅРѕРІРѕРµ приложение cgi.%sФайл программы поддерживается Lazarus" + +#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype +msgid "Create a new editor file.%sChoose a type." +msgstr "Создать новый файл редактора.%s Выберите тип." + +#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile +msgid "Create a new empty text file." +msgstr "Создать новый пустой текстовый файл." + +#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication +msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." +msgstr "Создать РЅРѕРІРѕРµ графическое приложение.%sЭта программа поддерживается Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit +msgid "Create a new pascal unit." +msgstr "Создать модуль Паскаля." + +#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram +msgid "Create a new program." +msgstr "Создать программу." + +#: lazarusidestrconsts:lisnewdlgcreateanewprogram +msgid "Create a new program.%sThe program file is maintained by Lazarus." +msgstr "Создать программу.%sФайл программы поддерживается Lazarus." + +#: lazarusidestrconsts:lisnpcreateanewproject +msgid "Create a new project" +msgstr "Создать новый проект" + +#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype +msgid "Create a new project.%sChoose a type." +msgstr "Создать проект.%sВыберите тип." + +#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun +msgid "Create a new standard package.%sA package is a collection of units and components." +msgstr "Создать стандартный пакет%sПакет - это набор модулей Рё компонентов." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule +msgid "Create a new unit with a datamodule." +msgstr "Создать модуль СЃ модулем данных." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform +msgid "Create a new unit with a LCL form." +msgstr "Создать модуль СЃ формой LCL." + +#: lazarusidestrconsts:liscreateaprojectfirst +msgid "Create a project first!" +msgstr "Создайте сперва проект!" + #: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "Создать настройки для %s Каталога" @@ -1552,68 +1675,16 @@ msgstr "Создать макросы FPC Рё пути Рє каталогу РїСЂРѕ #: lazarusidestrconsts:lispckeditcreatemakefile msgid "Create Makefile" -msgstr "" +msgstr "Создать Makefile" + +#: lazarusidestrconsts:lisa2pcreatenewfile +msgid "Create new file" +msgstr "Создать новый файл" #: lazarusidestrconsts:lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "Создать подменю" -#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained -msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "Создать РЅРѕРІРѕРµ приложение cgi.%sФайл программы поддерживается Lazarus" - -#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype -msgid "Create a new editor file.%sChoose a type." -msgstr "Создать новый файл редактора.%s Выберите тип." - -#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile -msgid "Create a new empty text file." -msgstr "Создать новый пустой текстовый файл." - -#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication -msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "Создать РЅРѕРІРѕРµ графическое приложение.%sЭта программа поддерживается Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "Создать модуль паскаля." - -#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram -msgid "Create a new program." -msgstr "Создать программу." - -#: lazarusidestrconsts:lisnewdlgcreateanewprogram -msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "Создать программу.%sФайл программы поддерживается Lazarus." - -#: lazarusidestrconsts:lisnpcreateanewproject -msgid "Create a new project" -msgstr "Создать новый проект" - -#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype -msgid "Create a new project.%sChoose a type." -msgstr "Создать проект.%sВыберите тип." - -#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun -msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "Создать стандартный пакет%sПакет - это набор модулей Рё компонентов." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform -msgid "Create a new unit with a LCL form." -msgstr "Создать модуль СЃ формой LCL." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule -msgid "Create a new unit with a datamodule." -msgstr "Создать модуль СЃ модулем данных." - -#: lazarusidestrconsts:liscreateaprojectfirst -msgid "Create a project first!" -msgstr "Создайте сперва проект!" - -#: lazarusidestrconsts:lisa2pcreatenewfile -msgid "Create new file" -msgstr "" - #: lazarusidestrconsts:dlgruberbandcreationcolor msgid "Creation" msgstr "Создание" @@ -1622,6 +1693,10 @@ msgstr "Создание" msgid "Ctrl" msgstr "Ctrl" +#: lazarusidestrconsts:lismenuinsertdatetime +msgid "Current date and time" +msgstr "Текущие дата Рё время" + #: lazarusidestrconsts:lisedtdefcurrentproject msgid "Current Project" msgstr "Текущий проект" @@ -1630,10 +1705,6 @@ msgstr "Текущий проект" msgid "Current Project Directory" msgstr "Каталог текущего проекта" -#: lazarusidestrconsts:lismenuinsertdatetime -msgid "Current date and time" -msgstr "Текущие дата Рё время" - #: lazarusidestrconsts:lismenuinsertusername msgid "Current username" msgstr "Текущее РёРјСЏ пользователя" @@ -1658,21 +1729,17 @@ msgstr "Р СЏРґ РєСѓСЂСЃРѕСЂР° РІ этом редакторе" msgid "Custom" msgstr "Пользовательский" +#: lazarusidestrconsts:liskeycatcustom +msgid "Custom commands" +msgstr "Команды пользователя" + #: lazarusidestrconsts:lismakeresstrcustomidentifier msgid "Custom Identifier" msgstr "Пользовательский ID" -#: lazarusidestrconsts:liscustomprogram -msgid "Custom Program" -msgstr "Программа пользователя" - -#: lazarusidestrconsts:liscustomprogramafreepascalprogram -msgid "Custom Program%sA freepascal program." -msgstr "Программа пользователя%sПрограмма РЅР° языке FreePascal" - -#: lazarusidestrconsts:liskeycatcustom -msgid "Custom commands" -msgstr "Команды пользователя" +#: lazarusidestrconsts:liscustomoptions +msgid "custom options" +msgstr "опции пользователя" #: lazarusidestrconsts:liscustomoptions2 msgid "Custom options" @@ -1682,6 +1749,14 @@ msgstr "Параметры пользователя" msgid "Custom position" msgstr "Пользовательская позиция" +#: lazarusidestrconsts:liscustomprogram +msgid "Custom Program" +msgstr "Программа пользователя" + +#: lazarusidestrconsts:liscustomprogramafreepascalprogram +msgid "Custom Program%sA freepascal program." +msgstr "Программа пользователя%sПрограмма РЅР° языке FreePascal" + #: lazarusidestrconsts:srkmeccustomtool msgid "Custom tool %d" msgstr "Рнструмент пользователя %d" @@ -1698,6 +1773,10 @@ msgstr "Вырезать выбранные компоненты РІ буфер" msgid "Cut selection to clipboard" msgstr "Вырезать выделение РІ буфер" +#: lazarusidestrconsts:lismenuinsertcvskeyword +msgid "CVS keyword" +msgstr "Ключ CVS" + #: lazarusidestrconsts:lishlpoptsdatabases msgid "Databases" msgstr "Базы данных" @@ -1716,11 +1795,7 @@ msgstr "Вывод отладчика" #: lazarusidestrconsts:lismenudebugwindows msgid "Debug windows" -msgstr "РћРєРЅРѕ отладки..." - -#: lazarusidestrconsts:lismendebuggeroptions -msgid "Debugger Options" -msgstr "Параметры отладчика" +msgstr "РћРєРЅР° отладки" #: lazarusidestrconsts:lisdebuggererror msgid "Debugger error" @@ -1734,6 +1809,10 @@ msgstr "Ошибка отладчика%sРћРї, отладчик находитс msgid "Debugger invalid" msgstr "Неправильный отладчик" +#: lazarusidestrconsts:lismendebuggeroptions +msgid "Debugger Options" +msgstr "Параметры отладчика" + #: lazarusidestrconsts:dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Дополнения Рє путям отладчика (нет):" @@ -1750,17 +1829,21 @@ msgstr "Отладка:" msgid "Default" msgstr "РџРѕ умолчанию" +#: lazarusidestrconsts:liscodefault +msgid "default (%s)" +msgstr "РїРѕ умолчанию (%s)" + #: lazarusidestrconsts:dlgdefaulteditorfont msgid "Default editor font" msgstr "Шрифт редактора РїРѕ умолчанию" #: lazarusidestrconsts:dlgpasext msgid "Default pascal extension" -msgstr "Стандартное расширение паскаля" +msgstr "Стандартное расширение Паскаля" #: lazarusidestrconsts:dlgdefvaluecolor msgid "Default value" -msgstr "" +msgstr "Значение РїРѕ умолчанию" #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" @@ -1778,25 +1861,9 @@ msgstr "Задержка" msgid "Delete" msgstr "Удалить" -#: lazarusidestrconsts:lismenueditordeletefromtemplate -msgid "Delete From Template..." -msgstr "Удалить шаблон формы" - -#: lazarusidestrconsts:lismenueditordeleteitem -msgid "Delete Item" -msgstr "Удалить элемент" - -#: lazarusidestrconsts:srkmecdeletelastchar -msgid "Delete Last Char" -msgstr "Удалить последний СЃРёРјРІРѕР»" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile -msgid "Delete Old Package File?" -msgstr "Удалить старый файл пакета?" - #: lazarusidestrconsts:lisdeleteallthesefiles msgid "Delete all these files?" -msgstr "" +msgstr "Удалить РІСЃРµ эти файлы?" #: lazarusidestrconsts:lisdeleteambiguousfile msgid "Delete ambiguous file?" @@ -1822,9 +1889,21 @@ msgstr "Удаление РЅРµ удалось" msgid "Delete file failed" msgstr "Удаление файла РЅРµ удалось" +#: lazarusidestrconsts:lismenueditordeletefromtemplate +msgid "Delete From Template..." +msgstr "Удалить шаблон формы..." + +#: lazarusidestrconsts:lismenueditordeleteitem +msgid "Delete Item" +msgstr "Удалить элемент" + +#: lazarusidestrconsts:srkmecdeletelastchar +msgid "Delete Last Char" +msgstr "Удалить последний СЃРёРјРІРѕР»" + #: lazarusidestrconsts:lislazdocdeletelinkbutton msgid "Delete link" -msgstr "" +msgstr "Удалить ссылку" #: lazarusidestrconsts:liscodetoolsdefsdeletenode msgid "Delete node" @@ -1838,6 +1917,10 @@ msgstr "Удалить старый файл %s%s%s?" msgid "Delete old package file %s%s%s?" msgstr "Удалить старый файл пакета %s%s%s?" +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile +msgid "Delete Old Package File?" +msgstr "Удалить старый файл пакета?" + #: lazarusidestrconsts:fdmdeleteselection msgid "Delete selection" msgstr "Удалить выбранное" @@ -1880,20 +1963,20 @@ msgstr "Совместимость СЃ Delphi" #: lazarusidestrconsts:lisdelphiproject msgid "Delphi project" -msgstr "" +msgstr "Проект Delphi" #: lazarusidestrconsts:lisa2pdependency msgid "Dependency" msgstr "Зависимость" -#: lazarusidestrconsts:lispckeditdependencyproperties -msgid "Dependency Properties" -msgstr "Свойства зависимости" - #: lazarusidestrconsts:lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Зависимость уже есть" +#: lazarusidestrconsts:lispckeditdependencyproperties +msgid "Dependency Properties" +msgstr "Свойства зависимости" + #: lazarusidestrconsts:lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Зависимость без владельца:%s" @@ -1938,18 +2021,18 @@ msgstr "Рабочий стол" msgid "Desktop files" msgstr "Файлы рабочего стола" -#: lazarusidestrconsts:lisaf2pdestinationpackage -msgid "Destination Package" -msgstr "Пакет назначения" - #: lazarusidestrconsts:lisdestinationdirectory msgid "Destination directory" -msgstr "" +msgstr "Каталог назначения" #: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "Каталог %s%s%s некорркетен.%sВыберите путь Рє компилятору." +#: lazarusidestrconsts:lisaf2pdestinationpackage +msgid "Destination Package" +msgstr "Пакет назначения" + #: lazarusidestrconsts:lismenudiff msgid "Diff" msgstr "Разница Diff" @@ -1980,7 +2063,7 @@ msgstr "Настройки каталогов" #: lazarusidestrconsts:lisdiscardchanges msgid "Discard changes" -msgstr "" +msgstr "Отбросить изменения" #: lazarusidestrconsts:dlgeddisplay msgid "Display" @@ -2000,31 +2083,31 @@ msgstr "Различать регистр Р±СѓРєРІ, например, Рђ Рё Р°" #: lazarusidestrconsts:lisdonotclosetheide msgid "Do not close the IDE" -msgstr "" +msgstr "РќРµ закрывать IDE" #: lazarusidestrconsts:lispodonotsaveanysessioninfo msgid "Do not save any session info" -msgstr "" +msgstr "РќРµ сохранять информацию Рѕ сеансе работы" #: lazarusidestrconsts:lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "" -#: lazarusidestrconsts:dlgnotsplitlinefront -msgid "Do not split line In front of:" -msgstr "РќРµ разрывать строку перед:" - #: lazarusidestrconsts:dlgnotsplitlineafter msgid "Do not split line after:" msgstr "РќРµ разрывать строку после:" +#: lazarusidestrconsts:dlgnotsplitlinefront +msgid "Do not split line In front of:" +msgstr "РќРµ разрывать строку перед:" + #: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Р’С‹ действительно хотите сбросить РІСЃРµ изменения РІ пакете %s Рё загрузить его РёР· файла?" #: lazarusidestrconsts:lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" -msgstr "" +msgstr "Р’С‹ хотите пересобрать Lazarus?" #: lazarusidestrconsts:rsiwpdocked msgid "Docked" @@ -2036,11 +2119,11 @@ msgstr "Редактор документации" #: lazarusidestrconsts:lislazdocnodocumentation msgid "Documentation entry does not exist" -msgstr "" +msgstr "Записи РІ документации РЅРµ существует" #: lazarusidestrconsts:lissortseldomain msgid "Domain" -msgstr "" +msgstr "Домен" #: lazarusidestrconsts:dlgdoubleclickline msgid "Double click line" @@ -2048,7 +2131,7 @@ msgstr "Выделить строку РґРІ. щелчком" #: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" -msgstr "Двойной щелчёк РЅР° переходах РїРѕ сообщениям (иначе - одинарный)" +msgstr "Двойной щелчок РЅР° переходах РїРѕ сообщениям (иначе - одинарный)" #: lazarusidestrconsts:dlgdownword msgid "Down" @@ -2056,7 +2139,7 @@ msgstr "Р’РЅРёР·" #: lazarusidestrconsts:dlgdragdroped msgid "Drag Drop editing" -msgstr "" +msgstr "Редактирование Drag Drop" #: lazarusidestrconsts:dlgdropfiles msgid "Drop files" @@ -2064,7 +2147,7 @@ msgstr "Бросить файлы" #: lazarusidestrconsts:rslanguagedutch msgid "Dutch" -msgstr "" +msgstr "Голландский" #: lazarusidestrconsts:lismenuenvironent msgid "E&nvironment" @@ -2074,6 +2157,10 @@ msgstr "&Окружение" msgid "Edit" msgstr "Правка" +#: lazarusidestrconsts:liscodetempleditcodetemplate +msgid "Edit code template" +msgstr "Править шаблоны РєРѕРґР°" + #: lazarusidestrconsts:lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Рзменить общие настройки" @@ -2082,6 +2169,10 @@ msgstr "Рзменить общие настройки" msgid "Edit Keys" msgstr "Рзменить клавиши" +#: lazarusidestrconsts:srkmeditforcmd +msgid "Edit keys for command" +msgstr "Править клавиши для команды" + #: lazarusidestrconsts:lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Рзменить настройки для компиляции пакета" @@ -2090,14 +2181,6 @@ msgstr "Рзменить настройки для компиляции паке msgid "Edit Tool" msgstr "Рнструмент правки" -#: lazarusidestrconsts:liscodetempleditcodetemplate -msgid "Edit code template" -msgstr "Править шаблоны РєРѕРґР°" - -#: lazarusidestrconsts:srkmeditforcmd -msgid "Edit keys for command" -msgstr "Править клавиши для команды" - #: lazarusidestrconsts:dlgededit msgid "Edit..." msgstr "Правка" @@ -2136,20 +2219,20 @@ msgstr "ElseIf" #: lazarusidestrconsts:lisenablemakros msgid "Enable Makros" -msgstr "" +msgstr "Включить Makros" #: lazarusidestrconsts:lisenclose msgid "Enclose" msgstr "Заключить" -#: lazarusidestrconsts:uemencloseselection -msgid "Enclose Selection" -msgstr "Заключить выделенное" - #: lazarusidestrconsts:lismenuencloseselection msgid "Enclose selection" msgstr "Заключить выделение РІ..." +#: lazarusidestrconsts:uemencloseselection +msgid "Enclose Selection" +msgstr "Заключить выделенное" + #: lazarusidestrconsts:srvk_end msgid "End" msgstr "End" @@ -2190,14 +2273,6 @@ msgstr "Параметры окружения" msgid "Error" msgstr "Ошибка" -#: lazarusidestrconsts:lispkgmangerrorreadingpackage -msgid "Error Reading Package" -msgstr "Ошибка чтения пакета" - -#: lazarusidestrconsts:lispkgmangerrorwritingpackage -msgid "Error Writing Package" -msgstr "Ошибка записи пакета" - #: lazarusidestrconsts:liserrorcreatingfile msgid "Error creating file" msgstr "Ошибка создания файла" @@ -2246,6 +2321,10 @@ msgstr "Ошибка чтения файла" msgid "Error reading file: %s" msgstr "Ошибка чтения файла: %s" +#: lazarusidestrconsts:lispkgmangerrorreadingpackage +msgid "Error Reading Package" +msgstr "Ошибка чтения пакета" + #: lazarusidestrconsts:liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "Ошибка чтения СЃРїРёСЃРєР° пакетов РёР· файла%s%s%s%s" @@ -2270,6 +2349,10 @@ msgstr "Ошибка записи проекта РІ файл %s%s%s%s%s" msgid "Error writing file" msgstr "Ошибка записи файла" +#: lazarusidestrconsts:lispkgmangerrorwritingpackage +msgid "Error Writing Package" +msgstr "Ошибка записи пакета" + #: lazarusidestrconsts:liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "Ошибка записи СЃРїРёСЃРєР° пакетов РІ файл%s%s%s%s" @@ -2290,17 +2373,21 @@ msgstr "Ошибки" msgid "Escape" msgstr "Escape" +#: lazarusidestrconsts:srkmecevaluate +msgid "evaluate/modify" +msgstr "рассчитать/изменить" + #: lazarusidestrconsts:lismenuevaluate msgid "Evaluate/Modify ..." msgstr "Вычислить/Рзменить..." #: lazarusidestrconsts:lislazdocexampletag msgid "Example" -msgstr "" +msgstr "Образец" #: lazarusidestrconsts:lisexcludefilter msgid "Exclude Filter" -msgstr "" +msgstr "Рсключающий фильтр" #: lazarusidestrconsts:srvk_execute msgid "Execute" @@ -2358,14 +2445,14 @@ msgstr "РЎРїРёСЃРѕРє экспорта" msgid "Extend unit path?" msgstr "" -#: lazarusidestrconsts:lisexttoolexternaltools -msgid "External Tools" -msgstr "Внешние инструменты" - #: lazarusidestrconsts:srkmecexttool msgid "External tool %d" msgstr "Внешний инструмент %d" +#: lazarusidestrconsts:lisexttoolexternaltools +msgid "External Tools" +msgstr "Внешние инструменты" + #: lazarusidestrconsts:srkmecexttoolsettings msgid "External tools settings" msgstr "Настройки внешнего инструмента" @@ -2378,29 +2465,13 @@ msgstr "Межстрочный интервал" msgid "Extract" msgstr "Рзвлечь" -#: lazarusidestrconsts:uemextractproc -msgid "Extract Procedure" -msgstr "Выделить процедуру" - #: lazarusidestrconsts:lismenuextractproc msgid "Extract procedure" msgstr "Выделить процедуру" -#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory -msgid "FPC SVN source directory" -msgstr "" - -#: lazarusidestrconsts:lisfpcsourcedirectoryerror -msgid "FPC Source Directory error" -msgstr "Ошибка каталога РёСЃС…РѕРґРЅРёРєРѕРІ FPC" - -#: lazarusidestrconsts:dlgfpcsrcpath -msgid "FPC source directory" -msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" - -#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg -msgid "FPC source directory \"%s\" not found." -msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC \"%s\" РЅРµ найден." +#: lazarusidestrconsts:uemextractproc +msgid "Extract Procedure" +msgstr "Выделить процедуру" #: lazarusidestrconsts:lisexttoolfailedtoruntool msgid "Failed to run tool" @@ -2442,14 +2513,6 @@ msgstr "Файл %s%s%s РЅРµ найден.%sСоздать его?%s" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Файл %s%s%s%sРЅРµ РїРѕС…РѕР¶ РЅР° текстовый.%sР’СЃС‘ равно открыть?" -#: lazarusidestrconsts:lispckeditfileproperties -msgid "File Properties" -msgstr "Свойства файла" - -#: lazarusidestrconsts:lisaf2pfiletype -msgid "File Type" -msgstr "РўРёРї файла" - #: lazarusidestrconsts:lisa2pfilealreadyexists msgid "File already exists" msgstr "Файл уже существует" @@ -2518,6 +2581,18 @@ msgstr "Файл РЅРµ текстовый" msgid "File not unit" msgstr "Файл - РЅРµ модуль" +#: lazarusidestrconsts:lispckeditfileproperties +msgid "File Properties" +msgstr "Свойства файла" + +#: lazarusidestrconsts:lisaf2pfiletype +msgid "File Type" +msgstr "РўРёРї файла" + +#: lazarusidestrconsts:lisfilewheredebugoutputiswritten +msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." +msgstr "файл, РєСѓРґР° записывается вывод отладки. Если РѕРЅ РЅРµ указан, вывод отладки записывается РІ консоль." + #: lazarusidestrconsts:lisa2pfilename2 msgid "Filename" msgstr "РРјСЏ файла" @@ -2550,6 +2625,10 @@ msgstr "Финальный" msgid "Find" msgstr "Найти" +#: lazarusidestrconsts:lismenufindinfiles +msgid "Find &in files" +msgstr "РџРѕРёСЃРє РІ файлах" + #: lazarusidestrconsts:lismenufindnext msgid "Find &Next" msgstr "Найти впереди" @@ -2558,26 +2637,6 @@ msgstr "Найти впереди" msgid "Find &Previous" msgstr "Найти сзади" -#: lazarusidestrconsts:lismenufindinfiles -msgid "Find &in files" -msgstr "РџРѕРёСЃРє РІ файлах" - -#: lazarusidestrconsts:lismenufinddeclarationatcursor -msgid "Find Declaration at cursor" -msgstr "Найти описание РїРѕРґ РєСѓСЂСЃРѕСЂР°" - -#: lazarusidestrconsts:lismenufindidentifierrefs -msgid "Find Identifier References" -msgstr "Найти ссылки РЅР° идентификатор" - -#: lazarusidestrconsts:lismenutemplatefindnext -msgid "Find Next" -msgstr "Найти далее" - -#: lazarusidestrconsts:lisfrifindreferences -msgid "Find References" -msgstr "Найти ссылки" - #: lazarusidestrconsts:srkmecfindblockotherend msgid "Find block other end" msgstr "Найти РґСЂСѓРіРѕР№ конец блока" @@ -2594,10 +2653,18 @@ msgstr "Найти начало блока РєРѕРґР°" msgid "Find declaration" msgstr "Найти описание" +#: lazarusidestrconsts:lismenufinddeclarationatcursor +msgid "Find Declaration at cursor" +msgstr "Найти описание РїРѕРґ РєСѓСЂСЃРѕСЂР°" + #: lazarusidestrconsts:srkmecfindidentifierrefs msgid "Find identifier references" msgstr "Найти ссылки РЅР° идентификатор" +#: lazarusidestrconsts:lismenufindidentifierrefs +msgid "Find Identifier References" +msgstr "Найти ссылки РЅР° идентификатор" + #: lazarusidestrconsts:srkmecfindinfiles msgid "Find in files" msgstr "Найти РІ файлах" @@ -2606,6 +2673,10 @@ msgstr "Найти РІ файлах" msgid "Find next" msgstr "Найти далее" +#: lazarusidestrconsts:lismenutemplatefindnext +msgid "Find Next" +msgstr "Найти далее" + #: lazarusidestrconsts:lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "Найти или переименовать ID" @@ -2626,6 +2697,10 @@ msgstr "Найти описание процедуры" msgid "Find procedure method" msgstr "Найти метод процедуры" +#: lazarusidestrconsts:lisfrifindreferences +msgid "Find References" +msgstr "Найти ссылки" + #: lazarusidestrconsts:srkmecfind msgid "Find text" msgstr "Найти текст" @@ -2648,7 +2723,7 @@ msgstr "Фокус РІ редактор РёСЃС…РѕРґРЅРёРєРѕРІ" #: lazarusidestrconsts:liscefollowcursor msgid "Follow cursor" -msgstr "" +msgstr "Следовать Р·Р° РєСѓСЂСЃРѕСЂРѕРј" #: lazarusidestrconsts:lisforcerenaming msgid "Force renaming" @@ -2686,6 +2761,22 @@ msgstr "" msgid "Forward search" msgstr "РџРѕРёСЃРє вперёд" +#: lazarusidestrconsts:dlgfpcsrcpath +msgid "FPC source directory" +msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" + +#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg +msgid "FPC source directory \"%s\" not found." +msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC \"%s\" РЅРµ найден." + +#: lazarusidestrconsts:lisfpcsourcedirectoryerror +msgid "FPC Source Directory error" +msgstr "Ошибка каталога РёСЃС…РѕРґРЅРёРєРѕРІ FPC" + +#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory +msgid "FPC SVN source directory" +msgstr "Каталог РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° Free Pascal РёР· SVN" + #: lazarusidestrconsts:lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "Компилятор FreePascal РЅРµ найден" @@ -2694,14 +2785,14 @@ msgstr "Компилятор FreePascal РЅРµ найден" msgid "Free Pascal Sources not found" msgstr "РќРµ найдены РёСЃС…РѕРґРЅРёРєРё FreePascal" -#: lazarusidestrconsts:lisfreepascalsourcefile -msgid "FreePascal source file" -msgstr "" - #: lazarusidestrconsts:lisfreepascalsourcedirectory msgid "Freepascal source directory" msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FreePascal" +#: lazarusidestrconsts:lisfreepascalsourcefile +msgid "FreePascal source file" +msgstr "Файл РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° FreePascal" + #: lazarusidestrconsts:rslanguagefrench msgid "French" msgstr "Французский" @@ -2734,33 +2825,17 @@ msgstr "Функция: извлечь РёРјСЏ файла СЃ расширение msgid "Function: extract file path" msgstr "Функция: извлечь путь файла" -#: lazarusidestrconsts:dlggpccomp -msgid "GPC (GNU Pascal Compiler) Compatible" -msgstr "Совместимость СЃ GPC (GNU Pascal Compiler)" - -#: lazarusidestrconsts:lismenuinsertgplnotice -msgid "GPL notice" -msgstr "Заметка GPL" - #: lazarusidestrconsts:lismenuinsertgeneral msgid "General" msgstr "Общие" -#: lazarusidestrconsts:lispckeditgeneraloptions -msgid "General Options" -msgstr "Общие настройки" - #: lazarusidestrconsts:srkmecenvironmentoptions msgid "General environment options" msgstr "Общие настройки окружения" -#: lazarusidestrconsts:dlgcodbx -msgid "Generate Debugging Info For DBX (Slows Compiling)" -msgstr "Генерировать информацию для DBX (замедляет СЃР±РѕСЂРєСѓ)" - -#: lazarusidestrconsts:dlgcogdb -msgid "Generate Debugging Info For GDB (Slows Compiling)" -msgstr "Генерировать информацию для GDB (замедляет СЃР±РѕСЂРєСѓ)" +#: lazarusidestrconsts:lispckeditgeneraloptions +msgid "General Options" +msgstr "Общие настройки" #: lazarusidestrconsts:dlggprof msgid "Generate code for gprof" @@ -2770,13 +2845,21 @@ msgstr "Создать РєРѕРґ для gprof" msgid "Generate code for valgrind" msgstr "Создать РєРѕРґ для valgrind" +#: lazarusidestrconsts:dlgcodbx +msgid "Generate Debugging Info For DBX (Slows Compiling)" +msgstr "Генерировать информацию для DBX (замедляет СЃР±РѕСЂРєСѓ)" + +#: lazarusidestrconsts:dlgcogdb +msgid "Generate Debugging Info For GDB (Slows Compiling)" +msgstr "Генерировать информацию для GDB (замедляет СЃР±РѕСЂРєСѓ)" + #: lazarusidestrconsts:dlgcogenerate msgid "Generate:" msgstr "Создать:" #: lazarusidestrconsts:rslanguagegerman msgid "German" -msgstr "" +msgstr "Немецкий" #: lazarusidestrconsts:dlggetposition msgid "Get position" @@ -2790,10 +2873,6 @@ msgstr "Везде" msgid "Global Source Path addition" msgstr "Глобально добавить путь РёСЃС…РѕРґРЅРёРєРѕРІ" -#: lazarusidestrconsts:srkmecgotomarker -msgid "Go to Marker %d" -msgstr "Переход Рє маркеру %d" - #: lazarusidestrconsts:srkmecgotoeditor msgid "Go to editor %d" msgstr "Переход Рє редактору %d" @@ -2802,6 +2881,10 @@ msgstr "Переход Рє редактору %d" msgid "Go to line number" msgstr "Переход Рє строке номер" +#: lazarusidestrconsts:srkmecgotomarker +msgid "Go to Marker %d" +msgstr "Переход Рє маркеру %d" + #: lazarusidestrconsts:srkmecmatchbracket msgid "Go to matching bracket" msgstr "Переход Рє соотв. СЃРєРѕР±РєРµ" @@ -2818,10 +2901,6 @@ msgstr "Переход Рє предыдущему редактору" msgid "Go to to include directive of current include file" msgstr "Переход РїРѕ директиве include текущего включаемого файла" -#: lazarusidestrconsts:srkmecgotoxy -msgid "Goto XY" -msgstr "Переход РїРѕ координате" - #: lazarusidestrconsts:lismenugotoincludedirective msgid "Goto include directive" msgstr "Переход РїРѕ директиве $I" @@ -2836,16 +2915,28 @@ msgstr "Строка :" #: lazarusidestrconsts:uemnextbookmark msgid "Goto next Bookmark" -msgstr "" +msgstr "Перейти Рє следующей Закладке" #: lazarusidestrconsts:uemprevbookmark msgid "Goto previous Bookmark" -msgstr "" +msgstr "Перейти Рє предыдущей Закладке" #: lazarusidestrconsts:listodolistgotoline msgid "Goto selected source line" msgstr "Переход Рє выделенной строке РёСЃС…РѕРґРЅРёРєР°" +#: lazarusidestrconsts:srkmecgotoxy +msgid "Goto XY" +msgstr "Переход РїРѕ координате" + +#: lazarusidestrconsts:dlggpccomp +msgid "GPC (GNU Pascal Compiler) Compatible" +msgstr "Совместимость СЃ GPC (GNU Pascal Compiler)" + +#: lazarusidestrconsts:lismenuinsertgplnotice +msgid "GPL notice" +msgstr "Заметка GPL" + #: lazarusidestrconsts:srkmgrabkey msgid "Grab Key" msgstr "Захват клавиш" @@ -2920,7 +3011,7 @@ msgstr "Размер кучи" #: lazarusidestrconsts:rslanguagehebrew msgid "Hebrew" -msgstr "" +msgstr "РРІСЂРёС‚" #: lazarusidestrconsts:dlgheightpos msgid "Height:" @@ -2938,6 +3029,14 @@ msgstr "Контекст справки РЅРµ найден" msgid "Help Database not found" msgstr "База данных справки РЅРµ найдена" +#: lazarusidestrconsts:srkmcarhelpmenu +msgid "Help menu commands" +msgstr "Команды меню Справка" + +#: lazarusidestrconsts:lishelpnotfound +msgid "Help not found" +msgstr "Справки РЅРµ найдено" + #: lazarusidestrconsts:lishlpoptshelpoptions msgid "Help Options" msgstr "Параметры справки" @@ -2954,18 +3053,14 @@ msgstr "Ошибка просмотра справки" msgid "Help Viewer not found" msgstr "Просмотрщик справки РЅРµ найден" -#: lazarusidestrconsts:srkmcarhelpmenu -msgid "Help menu commands" -msgstr "Команды меню Справка" - -#: lazarusidestrconsts:lishelpnotfound -msgid "Help not found" -msgstr "Справки РЅРµ найдено" - #: lazarusidestrconsts:dlghideideonrun msgid "Hide IDE windows on run" msgstr "Скрыть РѕРєРЅР° IDE РїСЂРё РїСѓСЃРєРµ" +#: lazarusidestrconsts:dlgedhintcommand +msgid "Hint: click on the command you want to edit" +msgstr "Подсказка: щёлкните РїРѕ команде, которая Вам нужна" + #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите только строковое выражение Рё попробуйте СЃРЅРѕРІР°." @@ -2974,10 +3069,6 @@ msgstr "Подсказка: функция Создать строку ресу msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите выражение Рё попробуйте СЃРЅРѕРІР°." -#: lazarusidestrconsts:dlgedhintcommand -msgid "Hint: click on the command you want to edit" -msgstr "Подсказка: щелкните РїРѕ команде, которая Вам нужна" - #: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgstr "Подсказка: Р’С‹ можете задать путь компилятора РІ Окружение->Параметры окружения->Файлы->Путь компилятора" @@ -3022,30 +3113,26 @@ msgstr "Встраивание РІ IDE" msgid "IDE Options:" msgstr "Параметры IDE:" -#: lazarusidestrconsts:uepins -msgid "INS" -msgstr "Р’РЎРў" - #: lazarusidestrconsts:liscodetoolsoptsidentifier msgid "Identifier" msgstr "Рдентификатор" -#: lazarusidestrconsts:lismakeresstridentifierlength -msgid "Identifier Length:" -msgstr "Длина идентификатора:" - -#: lazarusidestrconsts:lismakeresstridentifierprefix -msgid "Identifier Prefix:" -msgstr "Префикс идентификатора:" - #: lazarusidestrconsts:dlgedidcomlet msgid "Identifier completion" msgstr "Завершение идентификаторов" +#: lazarusidestrconsts:lismakeresstridentifierlength +msgid "Identifier Length:" +msgstr "Длина идентификатора:" + #: lazarusidestrconsts:dlgidentifierpolicy msgid "Identifier policy" msgstr "Политика идентификаторов" +#: lazarusidestrconsts:lismakeresstridentifierprefix +msgid "Identifier Prefix:" +msgstr "Префикс идентификатора:" + #: lazarusidestrconsts:lisfriidentifier msgid "Identifier: %s" msgstr "Рдентификатор: %s" @@ -3056,7 +3143,7 @@ msgstr "If" #: lazarusidestrconsts:uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "Если Р’С‹ можете помочь нам реализовать эту функцию, пишите lazarus@miraclec.com" +msgstr "Если Р’С‹ можете помочь нам реализовать эту функцию, пишите РЅР° lazarus@miraclec.com" #: lazarusidestrconsts:liscodetoolsdefsifdef msgid "IfDef" @@ -3070,17 +3157,13 @@ msgstr "IfNDef" msgid "Ignore" msgstr "РџСЂРѕРїСѓСЃРє" -#: lazarusidestrconsts:lissortselignorespace -msgid "Ignore Space" -msgstr "Ргнорировать пробелы" - #: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "Ргнорировать количество пробелов" #: lazarusidestrconsts:lisignorebinaries msgid "Ignore binaries" -msgstr "" +msgstr "Ргнорировать двоичные файлы" #: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" @@ -3096,7 +3179,11 @@ msgstr "Ргнорировать добавление/удаление РїСѓСЃС‚ #: lazarusidestrconsts:lisignoremissingfile msgid "Ignore missing file" -msgstr "" +msgstr "Ргнорировать отсутствующие файлы" + +#: lazarusidestrconsts:lissortselignorespace +msgid "Ignore Space" +msgstr "Ргнорировать пробелы" #: lazarusidestrconsts:lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" @@ -3112,16 +3199,36 @@ msgstr "Ргнорировать пробелы РІ начале строки" #: lazarusidestrconsts:srkmecimestr msgid "Ime Str" -msgstr "" +msgstr "Ime Str" #: lazarusidestrconsts:lisimportlist msgid "Import list" msgstr "РЎРїРёСЃРѕРє импорта" +#: lazarusidestrconsts:lisfriinallopenpackagesandprojects +msgid "in all open packages and projects" +msgstr "РІРѕ всех открытых пакетах Рё проектах" + +#: lazarusidestrconsts:lisfriincurrentunit +msgid "in current unit" +msgstr "РІ текущем модуле" + #: lazarusidestrconsts:dlginfrontofmethods msgid "In front of methods" msgstr "Перед методами" +#: lazarusidestrconsts:lisfriinmainproject +msgid "in main project" +msgstr "РІ главном проекте" + +#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit +msgid "in project/package owning current unit" +msgstr "РІ проекте/пакете, содержащем этот модуль" + +#: lazarusidestrconsts:lisuidinproject +msgid "in Project:" +msgstr "РІ проекте:" + #: lazarusidestrconsts:lispckoptsinclude msgid "Include" msgstr "Включает" @@ -3130,17 +3237,21 @@ msgstr "Включает" msgid "Include Assertion Code" msgstr "Включить РєРѕРґ Assert" +#: lazarusidestrconsts:lispkgfiletypeinclude +msgid "Include file" +msgstr "Включаемый файл:" + #: lazarusidestrconsts:dlgcoincfiles msgid "Include Files (-Fi):" msgstr "Включаемые файлы (-Fi):" #: lazarusidestrconsts:lisincludefilter msgid "Include Filter" -msgstr "" +msgstr "Включающий фильтр" -#: lazarusidestrconsts:lispkgfiletypeinclude -msgid "Include file" -msgstr "Включаемый файл:" +#: lazarusidestrconsts:lisincludepath +msgid "include path" +msgstr "путь включаемых" #: lazarusidestrconsts:lisfindfileincludesubdirectories msgid "Include sub directories" @@ -3178,6 +3289,10 @@ msgstr "Рнформация Рѕ %s" msgid "Inherited" msgstr "Унаследован" +#: lazarusidestrconsts:uepins +msgid "INS" +msgstr "Р’РЎРў" + #: lazarusidestrconsts:srvk_insert msgid "Insert" msgstr "Вставить" @@ -3186,6 +3301,34 @@ msgstr "Вставить" msgid "Insert $IFDEF..." msgstr "Вставить $IFDEF..." +#: lazarusidestrconsts:lismakeresstrinsertalphabetically +msgid "Insert alphabetically" +msgstr "Вставить РїРѕ алфавиту" + +#: lazarusidestrconsts:lislazdochintboldformat +msgid "Insert bold formatting tag" +msgstr "" + +#: lazarusidestrconsts:srkmecinsertchangelogentry +msgid "Insert ChangeLog entry" +msgstr "Вставить элемент ChangeLog" + +#: lazarusidestrconsts:lislazdochintinsertcodetag +msgid "Insert code formatting tag" +msgstr "" + +#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive +msgid "Insert context sensitive" +msgstr "Вставить СЃ учётом контекста" + +#: lazarusidestrconsts:srkmecinsertdatetime +msgid "Insert current date and time" +msgstr "Вставить текущие дату Рё время" + +#: lazarusidestrconsts:srkmecinsertusername +msgid "Insert current username" +msgstr "Вставить текущее РёРјСЏ пользователя" + #: lazarusidestrconsts:srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "Вставить ключевое слово CVS Author" @@ -3218,10 +3361,6 @@ msgstr "Вставить ключевое слово CVS Revision" msgid "Insert CVS keyword Source" msgstr "Вставить ключевое слово CVS Source" -#: lazarusidestrconsts:srkmecinsertchangelogentry -msgid "Insert ChangeLog entry" -msgstr "Вставить элемент ChangeLog" - #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "Вставить шаблон компилятора Delphi 5" @@ -3268,7 +3407,15 @@ msgstr "Вставить шаблон проекта FreePascal" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" -msgstr "" +msgstr "Вставить шаблон SVN-РєРѕРґР° Free Pascal " + +#: lazarusidestrconsts:lismenuinsertcharacter +msgid "Insert from Character Map" +msgstr "Вставить РёР· таблицы символов" + +#: lazarusidestrconsts:srkmecinsertcharacter +msgid "Insert from Charactermap" +msgstr "Вставить РёР· таблицы символов" #: lazarusidestrconsts:lismenueditorinsertfromtemplate msgid "Insert From Template..." @@ -3278,6 +3425,10 @@ msgstr "Вставить шаблон формы..." msgid "Insert GPL notice" msgstr "Вставить заметку Рѕ GPL" +#: lazarusidestrconsts:lislazdochintitalicformat +msgid "Insert italic formatting tag" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "Вставить шаблон компилятора Kylix 3" @@ -3290,17 +3441,17 @@ msgstr "Вставить шаблон каталога Kylix 3" msgid "Insert Kylix 3 Project Template" msgstr "Вставить шаблон проекта Kylix 3" -#: lazarusidestrconsts:srkmecinsertlgplnotice -msgid "Insert LGPL notice" -msgstr "Вставить заметку Рѕ LGPL" - #: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "Вставить шаблон каталога Lazarus" +#: lazarusidestrconsts:srkmecinsertlgplnotice +msgid "Insert LGPL notice" +msgstr "Вставить заметку Рѕ LGPL" + #: lazarusidestrconsts:lisctinsertmacro msgid "Insert Macro" -msgstr "" +msgstr "Вставить Макрос" #: lazarusidestrconsts:srkmecinsertmode msgid "Insert Mode" @@ -3314,46 +3465,6 @@ msgstr "Вставить новый РїСѓРЅРєС‚ (после)" msgid "Insert New Item (before)" msgstr "Вставить новый РїСѓРЅРєС‚ (перед)" -#: lazarusidestrconsts:liscodetoolsdefsinserttemplate -msgid "Insert Template" -msgstr "Вставить шаблон" - -#: lazarusidestrconsts:lismakeresstrinsertalphabetically -msgid "Insert alphabetically" -msgstr "Вставить РїРѕ алфавиту" - -#: lazarusidestrconsts:lislazdochintboldformat -msgid "Insert bold formatting tag" -msgstr "" - -#: lazarusidestrconsts:lislazdochintinsertcodetag -msgid "Insert code formatting tag" -msgstr "" - -#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive -msgid "Insert context sensitive" -msgstr "Вставить СЃ учётом контекста" - -#: lazarusidestrconsts:srkmecinsertdatetime -msgid "Insert current date and time" -msgstr "Вставить текущие дату Рё время" - -#: lazarusidestrconsts:srkmecinsertusername -msgid "Insert current username" -msgstr "Вставить текущее РёРјСЏ пользователя" - -#: lazarusidestrconsts:lismenuinsertcharacter -msgid "Insert from Character Map" -msgstr "Вставить РёР· таблицы символов" - -#: lazarusidestrconsts:srkmecinsertcharacter -msgid "Insert from Charactermap" -msgstr "Вставить РёР· таблицы символов" - -#: lazarusidestrconsts:lislazdochintitalicformat -msgid "Insert italic formatting tag" -msgstr "" - #: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "Вставить элемент как дочерний" @@ -3374,6 +3485,10 @@ msgstr "Вставлять пробелы после" msgid "Insert space in front of" msgstr "Вставлять пробелы перед" +#: lazarusidestrconsts:liscodetoolsdefsinserttemplate +msgid "Insert Template" +msgstr "Вставить шаблон" + #: lazarusidestrconsts:lismenuinserttext msgid "Insert text" msgstr "Вставить текст" @@ -3386,6 +3501,10 @@ msgstr "" msgid "Insert var formatting tag" msgstr "" +#: lazarusidestrconsts:srkmecinspect +msgid "inspect" +msgstr "проверить" + #: lazarusidestrconsts:lismenuinspect msgid "Inspect ..." msgstr "Следить Р·Р° ..." @@ -3408,23 +3527,31 @@ msgstr "Установить выбранное" #: lazarusidestrconsts:lisinstallationfailed msgid "Installation failed" -msgstr "" +msgstr "Установка РЅРµ удалась" #: lazarusidestrconsts:lispckexplinstalled msgid "Installed" msgstr "Установлен" +#: lazarusidestrconsts:lisoipinstalleddynamic +msgid "installed dynamic" +msgstr "установлен динамически" + #: lazarusidestrconsts:lisinstalledpackages msgid "Installed Packages" msgstr "Установленные пакеты" +#: lazarusidestrconsts:lisoipinstalledstatic +msgid "installed static" +msgstr "установлен статически" + #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" -msgstr "" +msgstr "РџСЂРё установке пакета %s автоматически установится пакет:" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" -msgstr "" +msgstr "РџСЂРё установке пакета %s автоматически установятся эти пакеты:" #: lazarusidestrconsts:dlgintvinsec msgid "Interval in secs" @@ -3442,62 +3569,22 @@ msgstr "Неправильный цикл" msgid "Invalid Class Name" msgstr "Неправильное РёРјСЏ класса" -#: lazarusidestrconsts:lisinvalidcompilerfilename -msgid "Invalid Compiler Filename" -msgstr "Неправильное РёРјСЏ файла компилятора" - -#: lazarusidestrconsts:lispublprojinvalidexcludefilter -msgid "Invalid Exclude filter" -msgstr "Неправильный фильтр исключений" - -#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory -msgid "Invalid Free Pascal source directory" -msgstr "Неправильный каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" - -#: lazarusidestrconsts:lisfriinvalididentifier -msgid "Invalid Identifier" -msgstr "Некорректный идентификатор" - -#: lazarusidestrconsts:lispublprojinvalidincludefilter -msgid "Invalid Include filter" -msgstr "Неправильный фильтр включений" - -#: lazarusidestrconsts:lisprojaddinvalidminmaxversion -msgid "Invalid Min-Max version" -msgstr "Неправильные версии (минимальная/максимальная)" - -#: lazarusidestrconsts:lisaf2pinvalidpackage -msgid "Invalid Package" -msgstr "Неправильный пакет" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename2 -msgid "Invalid Package Name" -msgstr "Неправильное РёРјСЏ пакета" - -#: lazarusidestrconsts:lisinvalidpascalidentifiercap -msgid "Invalid Pascal Identifier" -msgstr "Некорректный идентификатор паскаля" - -#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect -msgid "Invalid Resourcestring section" -msgstr "Неправильная секция Resourcestring" - -#: lazarusidestrconsts:lisa2pinvalidunitname -msgid "Invalid Unit Name" -msgstr "Неправильное РёРјСЏ модуля" - -#: lazarusidestrconsts:lispkgsysinvalidunitname -msgid "Invalid Unitname: %s" -msgstr "Неправильное РёРјСЏ модуля: %s" - #: lazarusidestrconsts:lisinvalidcommand msgid "Invalid command" msgstr "Неправильная команда" +#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename +msgid "invalid Compiler filename" +msgstr "неправильное РёРјСЏ Компилятора" + #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "Некорректное РёРјСЏ компилятора" +#: lazarusidestrconsts:lisinvalidcompilerfilename +msgid "Invalid Compiler Filename" +msgstr "Неправильное РёРјСЏ файла компилятора" + #: lazarusidestrconsts:lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "Неправильный класс компонента" @@ -3514,6 +3601,10 @@ msgstr "Недопустимое удаление" msgid "Invalid destination directory" msgstr "Неправильный каталог назначения" +#: lazarusidestrconsts:lispublprojinvalidexcludefilter +msgid "Invalid Exclude filter" +msgstr "Неправильный фильтр исключений" + #: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." msgstr "Неправильное выражение.%sПодсказка: функция Создать строку ресурсов требует строковую константу РІ РѕРґРЅРѕРј файле. Выделите выражение Рё попробуйте ещё." @@ -3530,6 +3621,18 @@ msgstr "Неправильное расширение файла" msgid "Invalid filename" msgstr "Неправильное РёРјСЏ файла" +#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory +msgid "Invalid Free Pascal source directory" +msgstr "Неправильный каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" + +#: lazarusidestrconsts:lisfriinvalididentifier +msgid "Invalid Identifier" +msgstr "Некорректный идентификатор" + +#: lazarusidestrconsts:lispublprojinvalidincludefilter +msgid "Invalid Include filter" +msgstr "Неправильный фильтр включений" + #: lazarusidestrconsts:lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "Неправильное РёРјСЏ файла make" @@ -3542,6 +3645,10 @@ msgstr "Неправильная максимальная версия" msgid "Invalid minimum version" msgstr "Неправильная минимальная версия" +#: lazarusidestrconsts:lisprojaddinvalidminmaxversion +msgid "Invalid Min-Max version" +msgstr "Неправильные версии (минимальная/максимальная)" + #: lazarusidestrconsts:lisinvalidmultiselection msgid "Invalid multiselection" msgstr "Неправильный множественный выбор" @@ -3550,9 +3657,9 @@ msgstr "Неправильный множественный выбор" msgid "Invalid mutliselection" msgstr "Неправильный множественный выбор" -#: lazarusidestrconsts:lisaf2pinvalidpackageid -msgid "Invalid package ID: %s%s%s" -msgstr "Неправильный идентификатор пакета: %s%s%s" +#: lazarusidestrconsts:lisaf2pinvalidpackage +msgid "Invalid Package" +msgstr "Неправильный пакет" #: lazarusidestrconsts:lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" @@ -3562,10 +3669,18 @@ msgstr "Неправильное расширение файла пакета" msgid "Invalid package filename" msgstr "Неправильное РёРјСЏ файла пакета" +#: lazarusidestrconsts:lisaf2pinvalidpackageid +msgid "Invalid package ID: %s%s%s" +msgstr "Неправильный идентификатор пакета: %s%s%s" + #: lazarusidestrconsts:lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Неправильное РёРјСЏ пакета" +#: lazarusidestrconsts:lispkgmanginvalidpackagename2 +msgid "Invalid Package Name" +msgstr "Неправильное РёРјСЏ пакета" + #: lazarusidestrconsts:lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "Неправильный тип пакета" @@ -3582,9 +3697,13 @@ msgstr "Неправильный \"предок\"" msgid "Invalid parent node" msgstr "Неправильный родительский элемент" +#: lazarusidestrconsts:lisinvalidpascalidentifiercap +msgid "Invalid Pascal Identifier" +msgstr "Некорректный идентификатор Паскаля" + #: lazarusidestrconsts:lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" -msgstr "Неправильное РёРјСЏ модуля паскаля" +msgstr "Неправильное РёРјСЏ модуля Паскаля" #: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" @@ -3598,10 +3717,22 @@ msgstr "Неправильное РёРјСЏ РїСЂРѕС†-СЂС‹" msgid "Invalid project filename" msgstr "Неправильное РёРјСЏ файла проекта" +#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect +msgid "Invalid Resourcestring section" +msgstr "Неправильная секция Resourcestring" + #: lazarusidestrconsts:lisinvalidselection msgid "Invalid selection" msgstr "Неправильное выделение" +#: lazarusidestrconsts:lisa2pinvalidunitname +msgid "Invalid Unit Name" +msgstr "Неправильное РёРјСЏ модуля" + +#: lazarusidestrconsts:lispkgsysinvalidunitname +msgid "Invalid Unitname: %s" +msgstr "Неправильное РёРјСЏ модуля: %s" + #: lazarusidestrconsts:lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "Неправильное РёРјСЏ переменной" @@ -3610,14 +3741,14 @@ msgstr "Неправильное РёРјСЏ переменной" msgid "Invalid version" msgstr "Неправильная версия" -#: lazarusidestrconsts:ueminvertassignment -msgid "Invert Assignment" -msgstr "Рнвертировать присвоение" - #: lazarusidestrconsts:srkmecinvertassignment msgid "Invert assignment" msgstr "Рнвертировать присвоение" +#: lazarusidestrconsts:ueminvertassignment +msgid "Invert Assignment" +msgstr "Рнвертировать присвоение" + #: lazarusidestrconsts:srvk_irregular msgid "Irregular " msgstr "Нерегулярный " @@ -3640,7 +3771,7 @@ msgstr "Высота элемента" #: lazarusidestrconsts:rslanguagejapanese msgid "Japanese" -msgstr "" +msgstr "РЇРїРѕРЅСЃРєРёР№" #: lazarusidestrconsts:lismenujumpback msgid "Jump back" @@ -3652,11 +3783,11 @@ msgstr "Переход вперед" #: lazarusidestrconsts:lismenujumpto msgid "Jump to" -msgstr "" +msgstr "Перейти Рє" #: lazarusidestrconsts:lismenujumptonextbookmark msgid "Jump to next bookmark" -msgstr "" +msgstr "Перейти Рє следующей закладке" #: lazarusidestrconsts:lismenujumptonexterror msgid "Jump to next error" @@ -3664,7 +3795,7 @@ msgstr "Переход Рє след. ошибке" #: lazarusidestrconsts:lismenujumptoprevbookmark msgid "Jump to previous bookmark" -msgstr "" +msgstr "Перейти Рє предыдущей закладке" #: lazarusidestrconsts:lismenujumptopreverror msgid "Jump to previous error" @@ -3688,7 +3819,7 @@ msgstr "Оставлять РІСЃРµ текстовые файлы" #: lazarusidestrconsts:dlgkeepcaretx msgid "Keep caret X position" -msgstr "" +msgstr "Сохранять положение РєСѓСЂСЃРѕСЂР° РїРѕ РѕСЃРё X" #: lazarusidestrconsts:dlgcokeepvarsreg msgid "Keep certain variables in registers" @@ -3700,7 +3831,7 @@ msgstr "Сохранять файлы, соотв. фильтру" #: lazarusidestrconsts:liskeepname msgid "Keep name" -msgstr "" +msgstr "Сохранить РёРјСЏ" #: lazarusidestrconsts:dlgforwardprocskeeporder msgid "Keep order of procedures" @@ -3710,6 +3841,10 @@ msgstr "Сохранять РїРѕСЂСЏРґРѕРє процедур" msgid "Key" msgstr "Клавиша" +#: lazarusidestrconsts:dlgkeymappingerrors +msgid "Key mapping errors" +msgstr "Ошибки комбинаций клавиш" + #: lazarusidestrconsts:dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "Схема раскладки клавиш" @@ -3718,10 +3853,6 @@ msgstr "Схема раскладки клавиш" msgid "Key Mappings" msgstr "Клавиши" -#: lazarusidestrconsts:dlgkeymappingerrors -msgid "Key mapping errors" -msgstr "Ошибки комбинаций клавиш" - #: lazarusidestrconsts:liscodetoolsoptskeyword msgid "Keyword" msgstr "Ключевое слово" @@ -3730,46 +3861,6 @@ msgstr "Ключевое слово" msgid "Keyword policy" msgstr "Политика ключевых слов" -#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions -msgid "LCL Interface specific options:" -msgstr "Опции LCL, зависящие РѕС‚ интерфейса:" - -#: lazarusidestrconsts:lislclwidgettype -msgid "LCL Widget Type" -msgstr "РўРёРї элемента управления LCL" - -#: lazarusidestrconsts:lislazbuildlclinterface -msgid "LCL interface" -msgstr "интерфейс LCL" - -#: lazarusidestrconsts:lislclunitpathmissing -msgid "LCL unit path missing" -msgstr "Отсутствует путь модуля LCL" - -#: lazarusidestrconsts:lispkgfiletypelfm -msgid "LFM - Lazarus form text" -msgstr "LFM - текст формы Lazarus" - -#: lazarusidestrconsts:lislfmfile -msgid "LFM file" -msgstr "Файл LFM" - -#: lazarusidestrconsts:lislfmfilecorrupt -msgid "LFM file corrupt" -msgstr "Файл LFM повреждён" - -#: lazarusidestrconsts:lislfmfilenotfound -msgid "LFM file not found" -msgstr "Файл LFM РЅРµ найден" - -#: lazarusidestrconsts:lismenuinsertlgplnotice -msgid "LGPL notice" -msgstr "Заметка Рѕ LGPL" - -#: lazarusidestrconsts:lispkgfiletypelrs -msgid "LRS - Lazarus resource" -msgstr "LRS - ресурс Lazarus" - #: lazarusidestrconsts:dlgenvlanguage msgid "Language" msgstr "Язык" @@ -3788,7 +3879,7 @@ msgstr "Последний (С‚.Рµ. РІ конце РёСЃС…РѕРґРЅРёРєР°)" #: lazarusidestrconsts:lisuselaunchingapplicationgroupbox msgid "Launching application" -msgstr "" +msgstr "Запускающее приложение" #: lazarusidestrconsts:lislaunchingapplicationinvalid msgid "Launching application invalid" @@ -3798,58 +3889,30 @@ msgstr "Запускающее приложение недопустимо" msgid "Launching target command line" msgstr "Командная строка для запуска" -#: lazarusidestrconsts:lislazdoc -msgid "LazDoc" -msgstr "" - -#: lazarusidestrconsts:lismenulazdoc -msgid "LazDoc Editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocmainformcaption -msgid "LazDoc editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocpathsgroupbox -msgid "LazDoc settings" -msgstr "" - #: lazarusidestrconsts:lispkgmanglazarus msgid "Lazarus" -msgstr "" +msgstr "Lazarus" -#: lazarusidestrconsts:lislazarusdesktopsettings -msgid "Lazarus Desktop Settings" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory -msgid "Lazarus Directory" -msgstr "Каталог Lazarus" - -#: lazarusidestrconsts:lislazaruseditorv -msgid "Lazarus Editor v%s" -msgstr "Редактор Lazarus v%s" - -#: lazarusidestrconsts:lislazarusfile -msgid "Lazarus File" -msgstr "" - -#: lazarusidestrconsts:lislazarusprojectinfofile -msgid "Lazarus Project Info file" -msgstr "" - -#: lazarusidestrconsts:locwndsrceditor -msgid "Lazarus Source Editor" -msgstr "Редактор РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° Lazarus" +#: lazarusidestrconsts:lislazarusoptionsprojectfilename +msgid "lazarus [options] " +msgstr "lazarus [опции] <РёРјСЏ файла проекта>" #: lazarusidestrconsts:lisconfigdirectory msgid "Lazarus config directory" msgstr "Каталог конфигурации Lazarus" +#: lazarusidestrconsts:lislazarusdesktopsettings +msgid "Lazarus Desktop Settings" +msgstr "Установки Рабочего Стола Lazarus" + #: lazarusidestrconsts:lislazarusdirectory msgid "Lazarus directory" msgstr "Каталог Lazarus" +#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory +msgid "Lazarus Directory" +msgstr "Каталог Lazarus" + #: lazarusidestrconsts:dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Каталог Lazarus (общий для всех проектов)" @@ -3862,25 +3925,73 @@ msgstr "Каталог Lazarus \"%s\" РЅРµ найден." msgid "Lazarus directory not found" msgstr "Каталог Lazarus РЅРµ найден" +#: lazarusidestrconsts:lislazaruseditorv +msgid "Lazarus Editor v%s" +msgstr "Редактор Lazarus v%s" + +#: lazarusidestrconsts:lislazarusfile +msgid "Lazarus File" +msgstr "Файл Lazarus" + #: lazarusidestrconsts:lislazarusform msgid "Lazarus form" -msgstr "" +msgstr "Форма Lazarus" #: lazarusidestrconsts:lislazaruspackage msgid "Lazarus package" -msgstr "" +msgstr "Пакет Lazarus" #: lazarusidestrconsts:lislazarusproject msgid "Lazarus project" -msgstr "" +msgstr "Проект Lazarus" + +#: lazarusidestrconsts:lislazarusprojectinfofile +msgid "Lazarus Project Info file" +msgstr "Файл информации проекта Lazarus" #: lazarusidestrconsts:lislazarusprojectsource msgid "Lazarus project source" -msgstr "" +msgstr "Рсходный РєРѕРґ проекта Lazarus" + +#: lazarusidestrconsts:locwndsrceditor +msgid "Lazarus Source Editor" +msgstr "Редактор РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° Lazarus" #: lazarusidestrconsts:lislazarusunit msgid "Lazarus unit" -msgstr "" +msgstr "Модуль Lazarus" + +#: lazarusidestrconsts:lislazdoc +msgid "LazDoc" +msgstr "LazDoc" + +#: lazarusidestrconsts:lislazdocmainformcaption +msgid "LazDoc editor" +msgstr "редактор LazDoc" + +#: lazarusidestrconsts:lismenulazdoc +msgid "LazDoc Editor" +msgstr "Редактор LazDoc" + +#: lazarusidestrconsts:lislazdocpathsgroupbox +msgid "LazDoc settings" +msgstr "Установки LazDoc" + +#: lazarusidestrconsts:lislazbuildlclinterface +msgid "LCL interface" +msgstr "интерфейс LCL" + +#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions +msgid "LCL Interface specific options:" +msgstr "Опции LCL, зависящие РѕС‚ интерфейса:" + +#: lazarusidestrconsts:lislclunitpathmissing +msgid "LCL unit path missing" +msgstr "Отсутствует путь модуля LCL" + +#: lazarusidestrconsts:lislclwidgettype +msgid "LCL Widget Type" +msgstr "РўРёРї элемента управления LCL" #: lazarusidestrconsts:lisleaveemptyfo msgid "Leave empty for default .po file" @@ -3898,6 +4009,10 @@ msgstr "Левые края" msgid "Left space equally" msgstr "" +#: lazarusidestrconsts:srvk_lwin +msgid "left windows key" +msgstr "Левая клавиша Windows" + #: lazarusidestrconsts:dlgleftpos msgid "Left:" msgstr "Слева:" @@ -3918,6 +4033,26 @@ msgstr "Уровень 2 (уровень 1 + более медленная)" msgid "Level 3 (Level 2 + Uncertain)" msgstr "Уровень 3 (уровень 3 + нестандартная)" +#: lazarusidestrconsts:lispkgfiletypelfm +msgid "LFM - Lazarus form text" +msgstr "LFM - текст формы Lazarus" + +#: lazarusidestrconsts:lislfmfile +msgid "LFM file" +msgstr "Файл LFM" + +#: lazarusidestrconsts:lislfmfilecorrupt +msgid "LFM file corrupt" +msgstr "Файл LFM повреждён" + +#: lazarusidestrconsts:lislfmfilenotfound +msgid "LFM file not found" +msgstr "Файл LFM РЅРµ найден" + +#: lazarusidestrconsts:lismenuinsertlgplnotice +msgid "LGPL notice" +msgstr "Заметка Рѕ LGPL" + #: lazarusidestrconsts:dlgcolibraries msgid "Libraries (-Fl):" msgstr "Библиотеки (-Fl):" @@ -3926,6 +4061,10 @@ msgstr "Библиотеки (-Fl):" msgid "Library" msgstr "Библиотека" +#: lazarusidestrconsts:lislibrarypath +msgid "library path" +msgstr "путь Рє библиотекам" + #: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .so under macosx). The library source file is automatically maintained by Lazarus." msgstr "" @@ -3942,21 +4081,21 @@ msgstr "Лицензия: GPL/LGPL%sLazarus - это библиотеки кла msgid "Line" msgstr "Строка" -#: lazarusidestrconsts:dlglinesplitting -msgid "Line Splitting" -msgstr "Разрыв строк" - #: lazarusidestrconsts:srkmeclineselect msgid "Line selection mode" msgstr "Режим выбора строк" +#: lazarusidestrconsts:dlglinesplitting +msgid "Line Splitting" +msgstr "Разрыв строк" + #: lazarusidestrconsts:lissortsellines msgid "Lines" msgstr "Строки" #: lazarusidestrconsts:lisuidlines msgid "Lines:" -msgstr "" +msgstr "Строки:" #: lazarusidestrconsts:dlglinksmart msgid "Link Smart" @@ -3970,6 +4109,10 @@ msgstr "Стиль СЃР±РѕСЂРєРё:" msgid "Linker" msgstr "Линкер" +#: lazarusidestrconsts:lislinkeroptions +msgid "linker options" +msgstr "параметры линкера" + #: lazarusidestrconsts:dlgcolinking msgid "Linking" msgstr "Связывание" @@ -3998,6 +4141,10 @@ msgstr "Локальные" msgid "Local Variables" msgstr "Локальные переменные" +#: lazarusidestrconsts:dlgcdtlower +msgid "lowercase" +msgstr "нижний регистр" + #: lazarusidestrconsts:lismenulowercaseselection msgid "Lowercase selection" msgstr "Нижний регистр выделения" @@ -4006,6 +4153,10 @@ msgstr "Нижний регистр выделения" msgid "Lowercase, first letter up" msgstr "Только 1СЏ Р±СѓРєРІР° заглавная" +#: lazarusidestrconsts:lispkgfiletypelrs +msgid "LRS - Lazarus resource" +msgstr "LRS - ресурс Lazarus" + #: lazarusidestrconsts:lisedtexttoolmacros msgid "Macros" msgstr "Макросы" @@ -4038,6 +4189,18 @@ msgstr "Главная" msgid "Make Executable" msgstr "Создать исполняемый" +#: lazarusidestrconsts:lismakenotfound +msgid "Make not found" +msgstr "РќРµ найден Make" + +#: lazarusidestrconsts:dlgmakepath +msgid "Make path" +msgstr "Путь Рє Make" + +#: lazarusidestrconsts:srkmecmakeresourcestring +msgid "Make resource string" +msgstr "Создать строку ресурсов" + #: lazarusidestrconsts:lismenumakeresourcestring msgid "Make Resource String" msgstr "Создать строку ресурсов" @@ -4046,17 +4209,9 @@ msgstr "Создать строку ресурсов" msgid "Make ResourceString" msgstr "Создать строку ресурсов" -#: lazarusidestrconsts:lismakenotfound -msgid "Make not found" -msgstr "РќРµ найден Make" - -#: lazarusidestrconsts:dlgmakepath -msgid "Make path" -msgstr "путь Рє Make" - -#: lazarusidestrconsts:srkmecmakeresourcestring -msgid "Make resource string" -msgstr "Создать строку ресурсов" +#: lazarusidestrconsts:lisprojectmakrounitpath +msgid "makro ProjectUnitPath" +msgstr "" #: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" @@ -4072,7 +4227,7 @@ msgstr "Цвет маркера" #: lazarusidestrconsts:lissmatches msgid "Matches" -msgstr "" +msgstr "Соответствия" #: lazarusidestrconsts:dlgmaxlinelength msgid "Max line length:" @@ -4086,6 +4241,10 @@ msgstr "Предел недавних файлов" msgid "Max recent project files" msgstr "Предел недавних проектов" +#: lazarusidestrconsts:dlgmaxcntr +msgid "Maximum counter" +msgstr "Максимальный счетчик" + #: lazarusidestrconsts:lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "Достигнут предел инструментов" @@ -4098,10 +4257,6 @@ msgstr "Макс. версия (РїРѕ выбору):" msgid "Maximum Version:" msgstr "Макс. версия" -#: lazarusidestrconsts:dlgmaxcntr -msgid "Maximum counter" -msgstr "Максимальный счетчик" - #: lazarusidestrconsts:srvk_menu msgid "Menu" msgstr "Меню" @@ -4112,7 +4267,7 @@ msgstr "Редактор меню" #: lazarusidestrconsts:lismenuviewmessages msgid "Messages" -msgstr "Сообщения..." +msgstr "Сообщения" #: lazarusidestrconsts:dlgmethodinspolicy msgid "Method insert policy" @@ -4146,6 +4301,10 @@ msgstr "Отразить РїРѕ вертикали" msgid "Miscellaneous" msgstr "Разное" +#: lazarusidestrconsts:lisoipmissing +msgid "missing" +msgstr "отсутствует" + #: lazarusidestrconsts:lismissingpackages msgid "Missing Packages" msgstr "Отсутствующие пакеты" @@ -4158,6 +4317,10 @@ msgstr "Смешивать методы Рё свойства" msgid "Mode Change" msgstr "Сменить режим" +#: lazarusidestrconsts:lisoipmodified +msgid "modified" +msgstr "изменён" + #: lazarusidestrconsts:uemodified msgid "Modified" msgstr "Рзменён" @@ -4186,30 +4349,6 @@ msgstr "Правая РєРЅРѕРїРєР° мыши" msgid "Mouse links" msgstr "Ссылки мыши" -#: lazarusidestrconsts:lisexttoolmovedown -msgid "Move Down" -msgstr "Сдвинуть РІРЅРёР·" - -#: lazarusidestrconsts:lismenueditormovedown -msgid "Move Down (or right)" -msgstr "" - -#: lazarusidestrconsts:uemmoveeditorleft -msgid "Move Editor Left" -msgstr "Подвинуть страницу влево" - -#: lazarusidestrconsts:uemmoveeditorright -msgid "Move Editor Right" -msgstr "Подвинуть страницу вправо" - -#: lazarusidestrconsts:lisexttoolmoveup -msgid "Move Up" -msgstr "Вверх" - -#: lazarusidestrconsts:lismenueditormoveup -msgid "Move Up (or left)" -msgstr "" - #: lazarusidestrconsts:lisdsgorderbackone msgid "Move component one back" msgstr "" @@ -4282,14 +4421,30 @@ msgstr "Зависимость - РІРЅРёР·" msgid "Move dependency up" msgstr "Зависимость вверх" +#: lazarusidestrconsts:lisexttoolmovedown +msgid "Move Down" +msgstr "Сдвинуть РІРЅРёР·" + +#: lazarusidestrconsts:lismenueditormovedown +msgid "Move Down (or right)" +msgstr "" + #: lazarusidestrconsts:srkmecmoveeditorleft msgid "Move editor left" msgstr "Сместить редактор влево" +#: lazarusidestrconsts:uemmoveeditorleft +msgid "Move Editor Left" +msgstr "Подвинуть страницу влево" + #: lazarusidestrconsts:srkmecmoveeditorright msgid "Move editor right" msgstr "Сместить редактор вправо" +#: lazarusidestrconsts:uemmoveeditorright +msgid "Move Editor Right" +msgstr "Подвинуть страницу вправо" + #: lazarusidestrconsts:liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "Переместить элемент РІРЅРёР·" @@ -4322,6 +4477,14 @@ msgstr "" msgid "Move to front" msgstr "" +#: lazarusidestrconsts:lisexttoolmoveup +msgid "Move Up" +msgstr "Вверх" + +#: lazarusidestrconsts:lismenueditormoveup +msgid "Move Up (or left)" +msgstr "" + #: lazarusidestrconsts:dlgmultiline msgid "Multi Line" msgstr "Многострочный" @@ -4334,22 +4497,6 @@ msgstr "" msgid "Multiselected components must be of a single form." msgstr "Множественный выбор компонентов должен быть РЅР° РѕРґРЅРѕР№ форме" -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal -msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "ЗАМЕТКА: РќРµ РјРѕРіСѓ создать шаблон определений РёР· РёСЃС…РѕРґРЅРёРєРѕРІ FPC" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources -msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "ЗАМЕТКА: РќРµ РјРѕРіСѓ создать шаблон определений РёР· РёСЃС…РѕРґРЅРёРєРѕРІ Lazarus" - -#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults -msgid "NOTE: codetools config file not found - using defaults" -msgstr "ЗАМЕТКА: файл настроек CodeTools РЅРµ найден - используем умолчания" - -#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile -msgid "NOTE: loading old codetools options file: " -msgstr "ЗАМЕТКА: РіСЂСѓР·РёРј старый файл настроек CodeTools: " - #: lazarusidestrconsts:lisnameofnewprocedure msgid "Name of new procedure" msgstr "РРјСЏ РЅРѕРІРѕР№ процедуры" @@ -4364,7 +4511,7 @@ msgstr "Названия" #: lazarusidestrconsts:lisceoneveronlymanually msgid "Never, only manually" -msgstr "" +msgstr "РќРёРєРѕРіРґР°, только вручную" #: lazarusidestrconsts:srkmecnew msgid "New" @@ -4376,11 +4523,15 @@ msgstr "Создать ..." #: lazarusidestrconsts:lisnewancestors msgid "New Ancestors" -msgstr "" +msgstr "Новые Предки" #: lazarusidestrconsts:lisnewclass msgid "New Class" -msgstr "" +msgstr "Новый Класс" + +#: lazarusidestrconsts:lisa2pnewclassname +msgid "New class name:" +msgstr "РќРѕРІРѕРµ РёРјСЏ класса:" #: lazarusidestrconsts:lisa2pnewcomponent msgid "New Component" @@ -4388,7 +4539,11 @@ msgstr "Новый компонент" #: lazarusidestrconsts:lisa2pnewfile msgid "New File" -msgstr "" +msgstr "Новый Файл" + +#: lazarusidestrconsts:srkmecnewform +msgid "New form" +msgstr "Создать форму" #: lazarusidestrconsts:lismenunewform msgid "New Form" @@ -4410,26 +4565,22 @@ msgstr "РќРѕРІРѕРµ требование" msgid "New Template Description..." msgstr "РќРѕРІРѕРµ описание шаблона..." -#: lazarusidestrconsts:lismenunewunit -msgid "New Unit" -msgstr "Создать модуль" - -#: lazarusidestrconsts:lisa2pnewclassname -msgid "New class name:" -msgstr "РќРѕРІРѕРµ РёРјСЏ класса:" - -#: lazarusidestrconsts:srkmecnewform -msgid "New form" -msgstr "Создать форму" - #: lazarusidestrconsts:srkmecnewunit msgid "New unit" msgstr "Создать модуль" +#: lazarusidestrconsts:lismenunewunit +msgid "New Unit" +msgstr "Создать модуль" + #: lazarusidestrconsts:lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Новый модуль РЅРµ РІ пути РїРѕРёСЃРєР°" +#: lazarusidestrconsts:liscodetoolsoptsnewline +msgid "Newline" +msgstr "Новая строка" + #: lazarusidestrconsts:liscodetoolsdefsnewnode msgid "NewNode" msgstr "Новый элемент" @@ -4438,25 +4589,21 @@ msgstr "Новый элемент" msgid "NewPackage" msgstr "Новый Пакет" -#: lazarusidestrconsts:liscodetoolsoptsnewline -msgid "Newline" -msgstr "Новая строка" - #: lazarusidestrconsts:srvk_next msgid "Next" msgstr "Следующий" #: lazarusidestrconsts:srkmecnextbookmark msgid "Next Bookmark" -msgstr "" +msgstr "Следующая Закладка" -#: lazarusidestrconsts:lisnoresourcestringsectionfound -msgid "No ResourceString Section found" -msgstr "РќРµ найдено секции ResourceString" +#: lazarusidestrconsts:lisuidno +msgid "no" +msgstr "нет" -#: lazarusidestrconsts:lisnostringconstantfound -msgid "No String Constant Found" -msgstr "РќРµ найдено строковой константы" +#: lazarusidestrconsts:dlgnoautomaticrenaming +msgid "no automatic renaming" +msgstr "без автопереименования" #: lazarusidestrconsts:lisnochange msgid "No change" @@ -4472,7 +4619,7 @@ msgstr "РќРµ унаследовано параметров компилятор #: lazarusidestrconsts:lisdbgmangnodebuggerspecified msgid "No debugger specified" -msgstr "" +msgstr "Отладчик РЅРµ указан" #: lazarusidestrconsts:dlgednoerr msgid "No errors in key mapping found." @@ -4494,6 +4641,14 @@ msgstr "РќРµ выбрано пакетов" msgid "No program file %s%s%s found." msgstr "Файла программы %s%s%s РЅРµ найдено." +#: lazarusidestrconsts:lisnoresourcestringsectionfound +msgid "No ResourceString Section found" +msgstr "РќРµ найдено секции ResourceString" + +#: lazarusidestrconsts:lisnostringconstantfound +msgid "No String Constant Found" +msgstr "РќРµ найдено строковой константы" + #: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "Элемент Рё его \"потомки\" доступны только для этого проекта" @@ -4502,6 +4657,10 @@ msgstr "Элемент Рё его \"потомки\" доступны тольк msgid "Node is readonly" msgstr "Элемент только для чтения" +#: lazarusidestrconsts:lisnoname +msgid "noname" +msgstr "без имени" + #: lazarusidestrconsts:srvk_nonconvert msgid "Nonconvert" msgstr "Без конвертации" @@ -4510,6 +4669,10 @@ msgstr "Без конвертации" msgid "None" msgstr "Нет" +#: lazarusidestrconsts:liscodetoolsdefsnoneselected +msgid "none selected" +msgstr "Ничего РЅРµ выбрано" + #: lazarusidestrconsts:dlgconormal msgid "Normal Code" msgstr "Нормальный РєРѕРґ" @@ -4542,6 +4705,22 @@ msgstr "Еще РЅРµ реализовано" msgid "Not now" msgstr "РќРµ сейчас" +#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults +msgid "NOTE: codetools config file not found - using defaults" +msgstr "ЗАМЕТКА: файл настроек CodeTools РЅРµ найден - используем умолчания" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal +msgid "NOTE: Could not create Define Template for Free Pascal Sources" +msgstr "ЗАМЕТКА: РќРµ РјРѕРіСѓ создать шаблон определений РёР· РёСЃС…РѕРґРЅРёРєРѕРІ FPC" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources +msgid "NOTE: Could not create Define Template for Lazarus Sources" +msgstr "ЗАМЕТКА: РќРµ РјРѕРіСѓ создать шаблон определений РёР· РёСЃС…РѕРґРЅРёРєРѕРІ Lazarus" + +#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile +msgid "NOTE: loading old codetools options file: " +msgstr "ЗАМЕТКА: РіСЂСѓР·РёРј старый файл настроек CodeTools: " + #: lazarusidestrconsts:dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Внимание, файлы проекта - РІСЃРµ файлы РІ его каталоге" @@ -4558,10 +4737,6 @@ msgstr "NumLock" msgid "Numpad %d" msgstr "%d цифровой клавиатуры" -#: lazarusidestrconsts:uepovr -msgid "OVR" -msgstr "Р—РђРњ" - #: lazarusidestrconsts:lispckoptsobject msgid "Object" msgstr "Объект" @@ -4570,17 +4745,21 @@ msgstr "Объект" msgid "Object Inspector" msgstr "Рнспектор объектов" +#: lazarusidestrconsts:lisobjectpath +msgid "object path" +msgstr "путь объекта" + #: lazarusidestrconsts:lisokbtn msgid "Ok" msgstr "РћРљ" #: lazarusidestrconsts:lisoldancestors msgid "Old Ancestors" -msgstr "" +msgstr "Старые Предки" #: lazarusidestrconsts:lisoldclass msgid "Old Class" -msgstr "" +msgstr "Старый Класс" #: lazarusidestrconsts:lisceoonidle msgid "On idle" @@ -4588,7 +4767,7 @@ msgstr "" #: lazarusidestrconsts:lismenuonlinehelp msgid "Online Help" -msgstr "" +msgstr "Оперативная справка" #: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" @@ -4612,48 +4791,16 @@ msgstr "Открыть" #: lazarusidestrconsts:lisopenlfm msgid "Open %s" -msgstr "" +msgstr "Открыть %s" + +#: lazarusidestrconsts:lisopenastextfile +msgid "Open as text file" +msgstr "Открыть как текстовый файл" #: lazarusidestrconsts:lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "Откр. Diff РІ редакторе" -#: lazarusidestrconsts:lisopenpackagefile -msgid "Open Package File" -msgstr "Открыть файл пакета" - -#: lazarusidestrconsts:lisopenpackage -msgid "Open Package?" -msgstr "Открыть пакет?" - -#: lazarusidestrconsts:lisctdefsopenpreview -msgid "Open Preview" -msgstr "Открыть предпросмотр" - -#: lazarusidestrconsts:lismenuopenproject -msgid "Open Project" -msgstr "Открыть проект" - -#: lazarusidestrconsts:lisopenprojectfile -msgid "Open Project File" -msgstr "Открыть проект" - -#: lazarusidestrconsts:lisopenproject -msgid "Open Project?" -msgstr "Открыть проект?" - -#: lazarusidestrconsts:lismenuopenrecent -msgid "Open Recent" -msgstr "Открыть недавнее" - -#: lazarusidestrconsts:lismenuopenrecentproject -msgid "Open Recent Project" -msgstr "Открыть недавний проект" - -#: lazarusidestrconsts:lisopenastextfile -msgid "Open as text file" -msgstr "" - #: lazarusidestrconsts:lisopenfile msgid "Open file" msgstr "Открыть файл" @@ -4668,7 +4815,7 @@ msgstr "Открыть РёРјСЏ файла РїРѕРґ РєСѓСЂСЃРѕСЂРѕРј" #: lazarusidestrconsts:dlgqopenlastprj msgid "Open last project at start" -msgstr "Грузить последний проект РїСЂРё РїСѓСЃРєРµ" +msgstr "Открывать последний проект РїСЂРё запуске" #: lazarusidestrconsts:lismenuopenpackage msgid "Open loaded package" @@ -4678,6 +4825,10 @@ msgstr "Открыть загруженный пакет" msgid "Open package" msgstr "Открыть пакет" +#: lazarusidestrconsts:lisopenpackagefile +msgid "Open Package File" +msgstr "Открыть файл пакета" + #: lazarusidestrconsts:lismenuopenpackagefile msgid "Open package file (.lpk)" msgstr "Открыть файл пакета (.lpk)" @@ -4686,18 +4837,46 @@ msgstr "Открыть файл пакета (.lpk)" msgid "Open package of current unit" msgstr "Открыть пакет текущего модуля" +#: lazarusidestrconsts:lisopenpackage +msgid "Open Package?" +msgstr "Открыть пакет?" + +#: lazarusidestrconsts:lisctdefsopenpreview +msgid "Open Preview" +msgstr "Открыть предпросмотр" + #: lazarusidestrconsts:lisopenproject2 msgid "Open project" -msgstr "" +msgstr "Открыть проект" + +#: lazarusidestrconsts:lismenuopenproject +msgid "Open Project" +msgstr "Открыть проект" #: lazarusidestrconsts:lisopenprojectagain msgid "Open project again" -msgstr "" +msgstr "Открыть проект СЃРЅРѕРІР°" + +#: lazarusidestrconsts:lisopenprojectfile +msgid "Open Project File" +msgstr "Открыть проект" + +#: lazarusidestrconsts:lisopenproject +msgid "Open Project?" +msgstr "Открыть проект?" + +#: lazarusidestrconsts:lismenuopenrecent +msgid "Open Recent" +msgstr "Открыть недавнее" #: lazarusidestrconsts:lismenuopenrecentpkg msgid "Open recent package" msgstr "Открыть недавний пакет" +#: lazarusidestrconsts:lismenuopenrecentproject +msgid "Open Recent Project" +msgstr "Открыть недавний проект" + #: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile msgid "Open the package %s?%sAnswer No to load it as xml file." msgstr "Открыть пакет %s?%s Ответьте Нет, чтобы загрузить его как xml." @@ -4736,7 +4915,7 @@ msgstr "Параметры: " #: lazarusidestrconsts:fdmorder msgid "Order" -msgstr "" +msgstr "РџРѕСЂСЏРґРѕРє" #: lazarusidestrconsts:dlgsrorigin msgid "Origin" @@ -4746,6 +4925,10 @@ msgstr "Начинать" msgid "Other" msgstr "Другое" +#: lazarusidestrconsts:dlgenvotherfiles +msgid "Other files" +msgstr "Др. файлы" + #: lazarusidestrconsts:dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Другие РёСЃС…РѕРґРЅРёРєРё (.pp/.pas files, нужны только IDE, РЅРµ компилятору)" @@ -4754,18 +4937,14 @@ msgstr "Другие РёСЃС…РѕРґРЅРёРєРё (.pp/.pas files, нужны только msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "Другие модули (-Fu) (разделитель точка СЃ запятой):" -#: lazarusidestrconsts:dlgenvotherfiles -msgid "Other files" -msgstr "Др. файлы" +#: lazarusidestrconsts:lispkgdefsoutputdirectory +msgid "Output directory" +msgstr "Каталог сохранений" #: lazarusidestrconsts:dlgpooutputsettings msgid "Output Settings" msgstr "Параметры вывода" -#: lazarusidestrconsts:lispkgdefsoutputdirectory -msgid "Output directory" -msgstr "Каталог сохранений" - #: lazarusidestrconsts:dlgcooverflow msgid "Overflow" msgstr "Переполнения" @@ -4778,21 +4957,25 @@ msgstr "" msgid "Override system variable" msgstr "Перекрыть системную переменную" -#: lazarusidestrconsts:srkmecoverwritemode -msgid "Overwrite Mode" -msgstr "Режим замены" - #: lazarusidestrconsts:lisoverwritefileondisk msgid "Overwrite file on disk" -msgstr "" +msgstr "Перезаписать файл РЅР° РґРёСЃРєРµ" #: lazarusidestrconsts:lisoverwritefile msgid "Overwrite file?" msgstr "Переписать файл?" +#: lazarusidestrconsts:srkmecoverwritemode +msgid "Overwrite Mode" +msgstr "Режим замены" + +#: lazarusidestrconsts:uepovr +msgid "OVR" +msgstr "Р—РђРњ" + #: lazarusidestrconsts:lispackage msgid "Package" -msgstr "" +msgstr "Пакет" #: lazarusidestrconsts:lispckeditpackage msgid "Package %s" @@ -4802,6 +4985,10 @@ msgstr "Пакет %s" msgid "Package %s not found" msgstr "Пакет %s РЅРµ найден" +#: lazarusidestrconsts:lispckeditpackagenotsaved +msgid "package %s not saved" +msgstr "пакет %s РЅРµ сохранён" + #: lazarusidestrconsts:lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "Пакет %s%s%s изменён. Сохранить?" @@ -4818,26 +5005,6 @@ msgstr "Пакет %s%s%s РЅРµ имеет правильного каталог msgid "Package %s%s%s not found." msgstr "Пакет %s%s%s РЅРµ найден" -#: lazarusidestrconsts:lismenupackagegraph -msgid "Package Graph" -msgstr "Диаграмма пакетов" - -#: lazarusidestrconsts:lisoippackagename -msgid "Package Name" -msgstr "РРјСЏ пакета" - -#: lazarusidestrconsts:lisprojaddpackagename -msgid "Package Name:" -msgstr "РРјСЏ пакета:" - -#: lazarusidestrconsts:lispckoptspackageoptions -msgid "Package Options" -msgstr "Параметры пакета" - -#: lazarusidestrconsts:lispkgdefssrcdirmark -msgid "Package Source Directory Mark" -msgstr "Метка каталога РёСЃС…РѕРґРЅРёРєР° пакета" - #: lazarusidestrconsts:lispkgmangpackageconflicts msgid "Package conflicts" msgstr "Конфликты пакетов" @@ -4846,6 +5013,10 @@ msgstr "Конфликты пакетов" msgid "Package file not found" msgstr "Файл пакета РЅРµ найден" +#: lazarusidestrconsts:lismenupackagegraph +msgid "Package Graph" +msgstr "Диаграмма пакетов" + #: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "Пакет - РЅРµ пакет разработки" @@ -4858,10 +5029,22 @@ msgstr "Пакет только для чтения" msgid "Package is required" msgstr "Требуется пакет" +#: lazarusidestrconsts:lispkgmangpackagemainsourcefile +msgid "package main source file" +msgstr "главный файл-РёСЃС…РѕРґРЅРёРє пакета" + +#: lazarusidestrconsts:lisoippackagename +msgid "Package Name" +msgstr "РРјСЏ пакета" + #: lazarusidestrconsts:lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "РРјСЏ пакета уже занято" +#: lazarusidestrconsts:lisprojaddpackagename +msgid "Package Name:" +msgstr "РРјСЏ пакета:" + #: lazarusidestrconsts:lispackageneedsinstallation msgid "Package needs installation" msgstr "Пакет требует установки" @@ -4870,14 +5053,18 @@ msgstr "Пакет требует установки" msgid "Package not found" msgstr "Пакет РЅРµ найден" +#: lazarusidestrconsts:lispckoptspackageoptions +msgid "Package Options" +msgstr "Параметры пакета" + +#: lazarusidestrconsts:lispkgdefssrcdirmark +msgid "Package Source Directory Mark" +msgstr "Метка каталога РёСЃС…РѕРґРЅРёРєР° пакета" + #: lazarusidestrconsts:lispkgmangpackage msgid "Package: %s" msgstr "Пакет: %s" -#: lazarusidestrconsts:lispckoptspackagetype -msgid "PackageType" -msgstr "РўРёРї пакета" - #: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "Пакеты должны иметь расширение .lpk" @@ -4886,6 +5073,10 @@ msgstr "Пакеты должны иметь расширение .lpk" msgid "Packages to install in the IDE" msgstr "Пакеты для установки РІ IDE" +#: lazarusidestrconsts:lispckoptspackagetype +msgid "PackageType" +msgstr "РўРёРї пакета" + #: lazarusidestrconsts:lisa2ppagenametoolong msgid "Page Name too long" msgstr "РРјСЏ страницы слишком длинное" @@ -4904,7 +5095,7 @@ msgstr "Абзацы" #: lazarusidestrconsts:liscmparameter msgid "Parameter" -msgstr "" +msgstr "Параметр" #: lazarusidestrconsts:lisedtexttoolparameters msgid "Parameters:" @@ -4920,15 +5111,15 @@ msgstr "Обработка" #: lazarusidestrconsts:lispascalsourcefile msgid "Pascal source file" -msgstr "" +msgstr "Рсходный РєРѕРґ Паскаля" #: lazarusidestrconsts:lispascalunit msgid "Pascal unit" -msgstr "" +msgstr "Модуль Паскаля" #: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" -msgstr "Модули паскаля должны иметь расширение .pp или .pas" +msgstr "Модули Паскаля должны иметь расширение .pp или .pas" #: lazarusidestrconsts:dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" @@ -4970,6 +5161,10 @@ msgstr "Пауза" msgid "Pause key" msgstr "Клавиша Pause" +#: lazarusidestrconsts:srkmecpause +msgid "pause program" +msgstr "приостановить программу" + #: lazarusidestrconsts:dlgpersistentcaret msgid "Persistent caret" msgstr "Неподвижный РєСѓСЂСЃРѕСЂ" @@ -5000,7 +5195,11 @@ msgstr "Сохраните файл перед добавлением РІ пак #: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst msgid "Please save the package first." -msgstr "" +msgstr "Пожалуйста, сначала сохраните пакет." + +#: lazarusidestrconsts:lisctpleaseselectamacro +msgid "please select a macro" +msgstr "пожалуйста, выберите макрос" #: lazarusidestrconsts:lisoippleaseselectapackage msgid "Please select a package" @@ -5036,7 +5235,7 @@ msgstr "Польский(ISO 8859-2)" #: lazarusidestrconsts:rslanguageportugues msgid "Portuguese" -msgstr "" +msgstr "Португальский" #: lazarusidestrconsts:dlgwrdpreview msgid "Preview" @@ -5048,12 +5247,16 @@ msgstr "Предпросмотр(max длина=1)" #: lazarusidestrconsts:srkmecprevbookmark msgid "Previous Bookmark" -msgstr "" +msgstr "Предыдущая закладка" #: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "Предыдущий элемент РЅРµ может содержать дочерних." +#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig +msgid "primary config directory, where Lazarus stores its config files. Default is " +msgstr "первичный каталог настроек, РіРґРµ Lazarus хранит СЃРІРѕРё файлы настроек. РџРѕ умолчанию - " + #: lazarusidestrconsts:srvk_print msgid "Print" msgstr "Печать" @@ -5096,7 +5299,7 @@ msgstr "Обнаружена программа" #: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "РСЃС…РѕРґРЅРёРє программы должен иметь расширение паскаля, напр. .pas, .pp или .lpr" +msgstr "РСЃС…РѕРґРЅРёРє программы должен иметь расширение Паскаля, напр. .pas, .pp или .lpr" #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." @@ -5108,7 +5311,7 @@ msgstr "РРјСЏ файла программы:" #: lazarusidestrconsts:lispdprogress msgid "Progress" -msgstr "" +msgstr "Прогресс" #: lazarusidestrconsts:dlgenvproject msgid "Project" @@ -5118,17 +5321,37 @@ msgstr "Проект" msgid "Project %s%s%s successfully built. :)" msgstr "Проект %s%s%s успешно собран. :)" -#: lazarusidestrconsts:lisedtdefprojectincpath -msgid "Project IncPath" -msgstr "Путь РІРєР».проекта" +#: lazarusidestrconsts:lisprojectchanged +msgid "Project changed" +msgstr "Проект изменен" + +#: lazarusidestrconsts:lisprojectdirectory +msgid "Project directory" +msgstr "РРјСЏ каталога проекта" + +#: lazarusidestrconsts:lisprojectfilename +msgid "Project filename" +msgstr "РРјСЏ файла проекта" + +#: lazarusidestrconsts:dlgprojfiles +msgid "Project files" +msgstr "Файлы проекта" #: lazarusidestrconsts:lisprojectincpath msgid "Project Include Path" msgstr "Пути включений проекта" +#: lazarusidestrconsts:lisedtdefprojectincpath +msgid "Project IncPath" +msgstr "Путь РІРєР».проекта" + +#: lazarusidestrconsts:lisprojectinfofiledetected +msgid "Project info file detected" +msgstr "Обнаружен файл сведений проекта" + #: lazarusidestrconsts:lisprojectinformation msgid "Project Information" -msgstr "" +msgstr "Рнформация Рѕ проекте" #: lazarusidestrconsts:lismenuprojectinspector msgid "Project Inspector" @@ -5138,6 +5361,18 @@ msgstr "Рнспектор проекта" msgid "Project Inspector - %s" msgstr "Рнспектор проекта - %s" +#: lazarusidestrconsts:lisprojectisrunnable +msgid "Project is runnable" +msgstr "Проект запускаемый" + +#: lazarusidestrconsts:lisprojectmakroproperties +msgid "Project makro properties" +msgstr "" + +#: lazarusidestrconsts:srkmcatprojectmenu +msgid "Project menu commands" +msgstr "Команды меню Проект" + #: lazarusidestrconsts:dlgprojectoptions msgid "Project Options" msgstr "Параметры проекта" @@ -5166,50 +5401,18 @@ msgstr "Путь модулей проекта" msgid "Project UnitPath" msgstr "Путь модулей проекта" -#: lazarusidestrconsts:lisprojectchanged -msgid "Project changed" -msgstr "Проект изменен" - -#: lazarusidestrconsts:lisprojectdirectory -msgid "Project directory" -msgstr "РРјСЏ каталога проекта" - -#: lazarusidestrconsts:lisprojectfilename -msgid "Project filename" -msgstr "РРјСЏ файла проекта" - -#: lazarusidestrconsts:dlgprojfiles -msgid "Project files" -msgstr "Файлы проекта" - -#: lazarusidestrconsts:lisprojectinfofiledetected -msgid "Project info file detected" -msgstr "Обнаружен файл сведений проекта" - -#: lazarusidestrconsts:lisprojectisrunnable -msgid "Project is runnable" -msgstr "Проект запускаемый" - -#: lazarusidestrconsts:lisprojectmakroproperties -msgid "Project makro properties" -msgstr "" - -#: lazarusidestrconsts:srkmcatprojectmenu -msgid "Project menu commands" -msgstr "Команды меню Проект" - #: lazarusidestrconsts:lispkgmangproject msgid "Project: %s" msgstr "Проект: %s" -#: lazarusidestrconsts:dlgpromptonreplace -msgid "Prompt On Replace" -msgstr "Подтверждать замену" - #: lazarusidestrconsts:lispromptforvalue msgid "Prompt for value" msgstr "Подсказка РїРѕ значению" +#: lazarusidestrconsts:dlgpromptonreplace +msgid "Prompt On Replace" +msgstr "Подтверждать замену" + #: lazarusidestrconsts:lishlpoptsproperties msgid "Properties:" msgstr "Свойства:" @@ -5220,7 +5423,7 @@ msgstr "Завершение свойств" #: lazarusidestrconsts:dlgpropnamecolor msgid "Property name" -msgstr "" +msgstr "РРјСЏ свойства" #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" @@ -5258,17 +5461,9 @@ msgstr "Выход" msgid "Range" msgstr "Диапазона" -#: lazarusidestrconsts:lispckeditreadddependency -msgid "Re-Add dependency" -msgstr "Обновить зависимость" - -#: lazarusidestrconsts:lispckeditreaddfile -msgid "Re-Add file" -msgstr "Обновить файл" - -#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages -msgid "Re-Compile this and all required packages?" -msgstr "Перекомпилировать" +#: lazarusidestrconsts:liscodetoolsdefsreaderror +msgid "Read error" +msgstr "Ошибка чтения" #: lazarusidestrconsts:lisreaderror msgid "Read Error" @@ -5282,14 +5477,22 @@ msgstr "Только чтение" msgid "Read Only: %s" msgstr "Только чтение:%s" -#: lazarusidestrconsts:liscodetoolsdefsreaderror -msgid "Read error" -msgstr "Ошибка чтения" - #: lazarusidestrconsts:dlgcdtreadprefix msgid "Read prefix" msgstr "Префикс READ" +#: lazarusidestrconsts:lispckeditreadddependency +msgid "Re-Add dependency" +msgstr "Обновить зависимость" + +#: lazarusidestrconsts:lispckeditreaddfile +msgid "Re-Add file" +msgstr "Обновить файл" + +#: lazarusidestrconsts:lisoipreadonly +msgid "readonly" +msgstr "только чтение" + #: lazarusidestrconsts:uepreadonly msgid "Readonly" msgstr "Только чтение" @@ -5306,6 +5509,10 @@ msgstr "Требуется пересобрать РІСЃРµ" msgid "Recompile clean" msgstr "Чистая пересборка" +#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages +msgid "Re-Compile this and all required packages?" +msgstr "Перекомпилировать" + #: lazarusidestrconsts:lismenuredo msgid "Redo" msgstr "Вернуть" @@ -5328,7 +5535,7 @@ msgstr "Обновить" #: lazarusidestrconsts:lisceorefreshautomatically msgid "Refresh automatically" -msgstr "" +msgstr "Обновлять автоматически" #: lazarusidestrconsts:listodolistrefresh msgid "Refresh todo items" @@ -5342,26 +5549,26 @@ msgstr "Процедура регистрации пуста" msgid "Register unit" msgstr "Зарегистрировать модуль" -#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering -msgid "RegisterUnit was called, but no package is registering." -msgstr "Был вызван RegisterUnit, РЅРѕ пакетов РЅРµ зарегистрировано." - #: lazarusidestrconsts:lispckeditregisteredplugins msgid "Registered plugins" msgstr "Зарегистрированные дополнения" +#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering +msgid "RegisterUnit was called, but no package is registering." +msgstr "Был вызван RegisterUnit, РЅРѕ пакетов РЅРµ зарегистрировано." + #: lazarusidestrconsts:lispkgsysregistrationerror msgid "Registration Error" msgstr "Ошибка регистрации" -#: lazarusidestrconsts:dlgregularexpressions -msgid "Regular Expressions" -msgstr "Целые выражения" - #: lazarusidestrconsts:lisfindfileregularexpressions msgid "Regular expressions" msgstr "Регулярное выражение" +#: lazarusidestrconsts:dlgregularexpressions +msgid "Regular Expressions" +msgstr "Целые выражения" + #: lazarusidestrconsts:lispckoptsrelease msgid "Release" msgstr "Релиз" @@ -5374,14 +5581,14 @@ msgstr "Перегрузить СЃ РґРёСЃРєР°" msgid "Remove" msgstr "Удалить" -#: lazarusidestrconsts:lispckeditremovedependency2 -msgid "Remove Dependency?" -msgstr "Удалить зависимость?" - #: lazarusidestrconsts:lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Удалить РІСЃРµ некорректные свойства" +#: lazarusidestrconsts:srkmecremovebreakpoint +msgid "remove break point" +msgstr "удалить точку останова" + #: lazarusidestrconsts:lispckeditremovedependency msgid "Remove dependency" msgstr "Удалить зависимость" @@ -5390,6 +5597,10 @@ msgstr "Удалить зависимость" msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "Удалить зависимость %s%s%s%sРёР· пакета %s%s%s?" +#: lazarusidestrconsts:lispckeditremovedependency2 +msgid "Remove Dependency?" +msgstr "Удалить зависимость?" + #: lazarusidestrconsts:lispckeditremovefile msgid "Remove file" msgstr "Удалить файл" @@ -5410,21 +5621,21 @@ msgstr "Удалить файл?" msgid "Remove files matching filter" msgstr "Удалить файлы РїРѕ фильтру" -#: lazarusidestrconsts:lismenuremovefromproject -msgid "Remove from Project" -msgstr "Убрать РёР· проекта" - #: lazarusidestrconsts:lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" -msgstr "" +msgstr "Удалить РёР· избранных свойств" #: lazarusidestrconsts:lisremovefromproject msgid "Remove from project" msgstr "Удалить РёР· проекта" +#: lazarusidestrconsts:lismenuremovefromproject +msgid "Remove from Project" +msgstr "Убрать РёР· проекта" + #: lazarusidestrconsts:lislazdocdeletepathbutton msgid "Remove path" -msgstr "" +msgstr "Удалить путь" #: lazarusidestrconsts:lispckeditremoveselecteditem msgid "Remove selected item" @@ -5446,14 +5657,6 @@ msgstr "Удалены требуемые пакеты (РѕРЅРё РЅРµ сохран msgid "Rename" msgstr "Переименовать" -#: lazarusidestrconsts:lispkgmangrenamefilelowercase -msgid "Rename File lowercase?" -msgstr "Переименовать файл РІ нижн.рег-СЂРµ?" - -#: lazarusidestrconsts:lismenurenameidentifier -msgid "Rename Identifier" -msgstr "Переименовать ID" - #: lazarusidestrconsts:lisfrirenameallreferences msgid "Rename all References" msgstr "Переименовать РІСЃРµ ссылки" @@ -5466,6 +5669,10 @@ msgstr "РќРµ удалось переименовать файл" msgid "Rename file in package?" msgstr "Переименовать файл РІ пакете?" +#: lazarusidestrconsts:lispkgmangrenamefilelowercase +msgid "Rename File lowercase?" +msgstr "Переименовать файл РІ нижн.рег-СЂРµ?" + #: lazarusidestrconsts:lisrenamefile msgid "Rename file?" msgstr "Переименовать файл?" @@ -5474,13 +5681,17 @@ msgstr "Переименовать файл?" msgid "Rename identifier" msgstr "Переименовать ID" +#: lazarusidestrconsts:lismenurenameidentifier +msgid "Rename Identifier" +msgstr "Переименовать ID" + #: lazarusidestrconsts:lisfrirenameto msgid "Rename to" msgstr "Переименовать РІ" #: lazarusidestrconsts:lisrenametolowercase msgid "Rename to lowercase" -msgstr "" +msgstr "Преобразовать РІ нижний регистр" #: lazarusidestrconsts:lismenureplace msgid "Replace" @@ -5490,14 +5701,14 @@ msgstr "Замена" msgid "Replace All" msgstr "Заменить РІСЃРµ" -#: lazarusidestrconsts:lispkgmangreplacefile -msgid "Replace File" -msgstr "Заменить файл" - #: lazarusidestrconsts:lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "Заменить существующий файл %s%s%s?" +#: lazarusidestrconsts:lispkgmangreplacefile +msgid "Replace File" +msgstr "Заменить файл" + #: lazarusidestrconsts:srkmecreplace msgid "Replace text" msgstr "Заменить текст" @@ -5508,7 +5719,7 @@ msgstr "Заменить %s%s%s%s РЅР° %s%s%s РІ этом месте?" #: lazarusidestrconsts:lisreplacingselectionfailed msgid "Replacing selection failed." -msgstr "" +msgstr "Замена выделенного РЅРµ удалась." #: lazarusidestrconsts:dlgreport msgid "Report" @@ -5522,6 +5733,10 @@ msgstr "Требуемые пакеты" msgid "Rescan FPC source directory" msgstr "Пересмотреть каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC" +#: lazarusidestrconsts:srkmecresetdebugger +msgid "reset debugger" +msgstr "СЃР±СЂРѕСЃ отладчика" + #: lazarusidestrconsts:lismenuresetdebugger msgid "Reset debugger" msgstr "РЎР±СЂРѕСЃ отладчика" @@ -5534,14 +5749,14 @@ msgstr "Ошибка загрузки ресурса" msgid "Resource save error" msgstr "Ошибка сохранения ресурса" -#: lazarusidestrconsts:lismakeresstrresourcestringsection -msgid "Resourcestring Section:" -msgstr "Секция Resourcestring:" - #: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "Строка ресурсов уже существует" +#: lazarusidestrconsts:lismakeresstrresourcestringsection +msgid "Resourcestring Section:" +msgstr "Секция Resourcestring:" + #: lazarusidestrconsts:lismenurestart msgid "Restart" msgstr "Перезапуск" @@ -5578,14 +5793,14 @@ msgstr "Вернуть пакет?" msgid "Right" msgstr "Справа" -#: lazarusidestrconsts:dlgrightclickselects -msgid "Right Click selects" -msgstr "Выбор правым щелчком" - #: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "Правый щелчок РЅР° элементе дерева даст меню СЃРѕ всеми доступными функциями пакета." +#: lazarusidestrconsts:dlgrightclickselects +msgid "Right Click selects" +msgstr "Выбор правым щелчком" + #: lazarusidestrconsts:dlgrightmargin msgid "Right margin" msgstr "Правая граница" @@ -5606,6 +5821,10 @@ msgstr "Правые края" msgid "Right space equally" msgstr "" +#: lazarusidestrconsts:srvk_rwin +msgid "right windows key" +msgstr "правая клавиша Windows" + #: lazarusidestrconsts:dlgrubberbandgroup msgid "Rubber band" msgstr "Поле заметок" @@ -5614,34 +5833,46 @@ msgstr "Поле заметок" msgid "Run" msgstr "Запуск" +#: lazarusidestrconsts:srkmecrunfile +msgid "run file" +msgstr "запуск файла" + #: lazarusidestrconsts:lismenurunfile msgid "Run File" msgstr "Запустить файл" -#: lazarusidestrconsts:lismenurunparameters -msgid "Run Parameters ..." -msgstr "Параметры запуска ..." - #: lazarusidestrconsts:srkmcatrunmenu msgid "Run menu commands" msgstr "Комаднды меню Запуск" +#: lazarusidestrconsts:srkmecrunparameters +msgid "run parameters" +msgstr "параметры запуска" + #: lazarusidestrconsts:dlgrunparameters msgid "Run parameters" msgstr "Параметры запуска" +#: lazarusidestrconsts:lismenurunparameters +msgid "Run Parameters ..." +msgstr "Параметры запуска ..." + +#: lazarusidestrconsts:srkmecrun +msgid "run program" +msgstr "запустить программу" + #: lazarusidestrconsts:lismenuruntocursor msgid "Run to cursor" msgstr "Запуск РґРѕ РєСѓСЂСЃРѕСЂР°" -#: lazarusidestrconsts:lisruntofailed -msgid "Run-to failed" -msgstr "Запуск-РґРѕ РЅРµ удался" - #: lazarusidestrconsts:lispckoptsruntimeonly msgid "Runtime only" msgstr "Времени исполнения" +#: lazarusidestrconsts:lisruntofailed +msgid "Run-to failed" +msgstr "Запуск-РґРѕ РЅРµ удался" + #: lazarusidestrconsts:rslanguagerussian msgid "Russian" msgstr "Р СѓСЃСЃРєРёР№" @@ -5650,10 +5881,6 @@ msgstr "Р СѓСЃСЃРєРёР№" msgid "Russian(CP1251)" msgstr "Р СѓСЃСЃРєРёР№(CP1251)" -#: lazarusidestrconsts:lissvnrevision -msgid "SVN Revision: " -msgstr "" - #: lazarusidestrconsts:dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "РўРѕ же РёРјСЏ (РІ подкаталоге)" @@ -5666,58 +5893,22 @@ msgstr "Сохранить" msgid "Save " msgstr "Сохранить " -#: lazarusidestrconsts:lismenusaveall -msgid "Save All" -msgstr "Сохранить РІСЃРµ" - -#: lazarusidestrconsts:lismenusaveas -msgid "Save As" -msgstr "Сохранить как" - -#: lazarusidestrconsts:dlgcharcasefileact -msgid "Save As - auto rename pascal files lower case" -msgstr "Сохранить как-автопереименовать РІ нижний регистр" - -#: lazarusidestrconsts:lismenueditorsaveastemplate -msgid "Save As Template..." -msgstr "Сохранить как шаблон..." - -#: lazarusidestrconsts:lispckeditsavechanges -msgid "Save Changes?" -msgstr "Сохранить изменения?" - -#: lazarusidestrconsts:lispkgmangsavepackagelpk -msgid "Save Package %s (*.lpk)" -msgstr "Сохранить пакет %s (*.lpk)" - -#: lazarusidestrconsts:lispkgmangsavepackage -msgid "Save Package?" -msgstr "Сохранить пакет?" - -#: lazarusidestrconsts:lismenusaveproject -msgid "Save Project" -msgstr "Сохранить проект" - -#: lazarusidestrconsts:lissaveprojectlpi -msgid "Save Project %s (*.lpi)" -msgstr "Сохранить прокет %s (*.lpi)" - -#: lazarusidestrconsts:lismenusaveprojectas -msgid "Save Project As..." -msgstr "Сохранить проект как..." - -#: lazarusidestrconsts:lissavesettings -msgid "Save Settings" -msgstr "" - #: lazarusidestrconsts:lishintsaveall msgid "Save all" msgstr "Сохранить РІСЃРµ" +#: lazarusidestrconsts:lismenusaveall +msgid "Save All" +msgstr "Сохранить РІСЃРµ" + #: lazarusidestrconsts:lissaveallmessagestofile msgid "Save all messages to file" msgstr "Сохранить РІСЃРµ сообщения РІ файл" +#: lazarusidestrconsts:lissaveallmodified +msgid "save all modified files" +msgstr "Сохранить РІСЃРµ измененные файлы" + #: lazarusidestrconsts:liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "Сохранить Рё выйти" @@ -5734,6 +5925,18 @@ msgstr "Сохранить Рё перезапустить IDE" msgid "Save as" msgstr "Сохранить как" +#: lazarusidestrconsts:lismenusaveas +msgid "Save As" +msgstr "Сохранить как" + +#: lazarusidestrconsts:dlgcharcasefileact +msgid "Save As - auto rename pascal files lower case" +msgstr "Сохранить как-автопереименовать РІ нижний регистр" + +#: lazarusidestrconsts:lismenueditorsaveastemplate +msgid "Save As Template..." +msgstr "Сохранить как шаблон..." + #: lazarusidestrconsts:lissavechangestoproject msgid "Save changes to project %s?" msgstr "Сохранить изменения РІ проект %s?" @@ -5742,6 +5945,14 @@ msgstr "Сохранить изменения РІ проект %s?" msgid "Save changes?" msgstr "Сохранить изменения?" +#: lazarusidestrconsts:lispckeditsavechanges +msgid "Save Changes?" +msgstr "Сохранить изменения?" + +#: lazarusidestrconsts:lissavecurrenteditorfile +msgid "save current editor file" +msgstr "Сохранить текущий файл редактора" + #: lazarusidestrconsts:dlgsavedfile msgid "Save desktop settings to file" msgstr "РЎРѕС…СЂ. рабочий стол РІ файл" @@ -5752,7 +5963,7 @@ msgstr "Сохранять сведения Рѕ закрываемых файла #: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" -msgstr "" +msgstr "Сохранять информацию редактора для файлов, РЅРµ принадлежащих проекту" #: lazarusidestrconsts:dlgsaveeditorinfoproject msgid "Save editor info only for project files" @@ -5764,31 +5975,55 @@ msgstr "Сохранить файл %s%s%sперед закрытием форм #: lazarusidestrconsts:lisposaveinlpifil msgid "Save in .lpi file" -msgstr "" +msgstr "Сохранить РІ файле .lpi" #: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" -msgstr "" +msgstr "Сохранить РІ файле .lps РІ каталоге проекта" #: lazarusidestrconsts:lisposaveinideconfigdirectory msgid "Save in IDE config directory" -msgstr "" +msgstr "Сохранить РІ кталоге настроек IDE" #: lazarusidestrconsts:lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" -msgstr "" +msgstr "Сохранять информацию Рѕ файлах, закрытых РІ редакторе" #: lazarusidestrconsts:lispckeditsavepackage msgid "Save package" msgstr "Сохранить пакет" +#: lazarusidestrconsts:lispkgmangsavepackagelpk +msgid "Save Package %s (*.lpk)" +msgstr "Сохранить пакет %s (*.lpk)" + #: lazarusidestrconsts:lispkgmangsavepackage2 msgid "Save package?" msgstr "Сохранить пакет?" +#: lazarusidestrconsts:lispkgmangsavepackage +msgid "Save Package?" +msgstr "Сохранить пакет?" + +#: lazarusidestrconsts:lismenusaveproject +msgid "Save Project" +msgstr "Сохранить проект" + +#: lazarusidestrconsts:lissaveprojectlpi +msgid "Save Project %s (*.lpi)" +msgstr "Сохранить прокет %s (*.lpi)" + +#: lazarusidestrconsts:lismenusaveprojectas +msgid "Save Project As..." +msgstr "Сохранить проект как..." + #: lazarusidestrconsts:lisposavesessioninformationin msgid "Save session information in" -msgstr "" +msgstr "Сохранять информацию Рѕ сеансе работы РІ" + +#: lazarusidestrconsts:lissavesettings +msgid "Save Settings" +msgstr "Сохранить настройки" #: lazarusidestrconsts:fdmscaleword msgid "Scale" @@ -5798,10 +6033,6 @@ msgstr "Масштаб" msgid "Scaling factor:" msgstr "Масштабный фактор:" -#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure -msgid "Scan Unit for Unit Name and Register procedure" -msgstr "Рскать РІ модуле РёРјСЏ Рё процедуру Register" - #: lazarusidestrconsts:liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "РџРѕРёСЃРє сообщений FPC" @@ -5818,6 +6049,10 @@ msgstr "РџРѕРёСЃРє сообщений компилятора FreePascal РІ РІС‹ msgid "Scan output for make messages" msgstr "РџРѕРёСЃРє сообщений make РІ выводе" +#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure +msgid "Scan Unit for Unit Name and Register procedure" +msgstr "Рскать РІ модуле РёРјСЏ Рё процедуру Register" + #: lazarusidestrconsts:dlgscope msgid "Scope" msgstr "Где" @@ -5854,26 +6089,38 @@ msgstr "Прокрутить влево 1 СЃРёРјРІРѕР»" msgid "Scroll up one line" msgstr "Прокрутить вверх 1 строку" -#: lazarusidestrconsts:lissearchfor -msgid "Search For " -msgstr "Рскать " - -#: lazarusidestrconsts:lismenuviewsearchresults -msgid "Search Results" -msgstr "Результаты РїРѕРёСЃРєР°" - #: lazarusidestrconsts:lissearchagain msgid "Search again" msgstr "Рскать СЃРЅРѕРІР°" +#: lazarusidestrconsts:lisfindfilesearchallfilesinproject +msgid "search all files in project" +msgstr "РїРѕРёСЃРє РІРѕ всех файлах проекта" + +#: lazarusidestrconsts:lisfindfilesearchallopenfiles +msgid "search all open files" +msgstr "РїРѕРёСЃРє РІРѕ всех открытых файлах" + +#: lazarusidestrconsts:lissearchfor +msgid "Search For " +msgstr "Рскать " + #: lazarusidestrconsts:lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Рскать Рё РІ комментариях" +#: lazarusidestrconsts:lisfindfilesearchindirectories +msgid "search in directories" +msgstr "РїРѕРёСЃРє РІ каталогах" + #: lazarusidestrconsts:lispatheditsearchpaths msgid "Search paths:" msgstr "Пути РїРѕРёСЃРєР°:" +#: lazarusidestrconsts:lismenuviewsearchresults +msgid "Search Results" +msgstr "Результаты РїРѕРёСЃРєР°" + #: lazarusidestrconsts:lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "Строка РїРѕРёСЃРєР° '%s' РЅРµ найдена!" @@ -5884,7 +6131,7 @@ msgstr "РџРѕРёСЃРє прерван пользователем." #: lazarusidestrconsts:lisssearchtext msgid "Search text" -msgstr "" +msgstr "РџРѕРёСЃРє текста" #: lazarusidestrconsts:lisfrisearchwhere msgid "Search where" @@ -5892,7 +6139,7 @@ msgstr "Рскать РіРґРµ" #: lazarusidestrconsts:lisssearching msgid "Searching" -msgstr "" +msgstr "РџРѕРёСЃРє" #: lazarusidestrconsts:dlgsearchcaption msgid "Searching..." @@ -5902,30 +6149,50 @@ msgstr "РџРѕРёСЃРє..." msgid "Searching: %s" msgstr "Рщу: %s" +#: lazarusidestrconsts:dlgtimesecondunit +msgid "sec" +msgstr "сек" + +#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor +msgid "secondary config directory, where Lazarus searches for config template files. Default is " +msgstr "вторичный каталог настроек, РіРґРµ Lazarus ищет шаблоны файлов настроек. РџРѕ умолчанию - " + #: lazarusidestrconsts:lislazdocseealsotag msgid "See also" -msgstr "" +msgstr "Смотрите также" #: lazarusidestrconsts:lisseemessages msgid "See messages." msgstr "РЎРј. сообщения." -#: lazarusidestrconsts:srkmecselleft -msgid "SelLeft" -msgstr "SelLeft" - -#: lazarusidestrconsts:srkmecselright -msgid "SelRight" -msgstr "SelRight" - #: lazarusidestrconsts:lismenuselect msgid "Select" msgstr "Выделить" +#: lazarusidestrconsts:lisselectahelpitem +msgid "Select a help item:" +msgstr "Рскать элемент справки:" + +#: lazarusidestrconsts:lisselectanode +msgid "Select a node" +msgstr "Выберите элемент" + +#: lazarusidestrconsts:lisnpselectaprojecttype +msgid "Select a project type" +msgstr "Выберите тип проекта" + +#: lazarusidestrconsts:lismenuselectall +msgid "Select all" +msgstr "Выделить РІСЃРµ" + #: lazarusidestrconsts:srkmecselectall msgid "Select All" msgstr "Выбрать РІСЃРµ" +#: lazarusidestrconsts:lismenuselectcodeblock +msgid "Select code block" +msgstr "Выделить блок РєРѕРґР°" + #: lazarusidestrconsts:lisctselectcodemacro msgid "Select Code Macro" msgstr "" @@ -5934,6 +6201,10 @@ msgstr "" msgid "Select Delphi form files (*.dfm)" msgstr "Выберите файлы форм Delphi (*.dfm)" +#: lazarusidestrconsts:lispatheditselectdirectory +msgid "Select directory" +msgstr "Выбрать каталог" + #: lazarusidestrconsts:srkmecseldown msgid "Select Down" msgstr "Выделить РІРЅРёР·" @@ -5942,6 +6213,14 @@ msgstr "Выделить РІРЅРёР·" msgid "Select Goto XY" msgstr "Выделить переход РїРѕ РєРѕРѕСЂРґ." +#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds +msgid "Select grand childs" +msgstr "" + +#: lazarusidestrconsts:lismenuselectline +msgid "Select line" +msgstr "Выделить строку" + #: lazarusidestrconsts:srkmecsellineend msgid "Select Line End" msgstr "Выделить конец строки" @@ -5978,54 +6257,6 @@ msgstr "Выделить верх страницы" msgid "Select Page Up" msgstr "Выделить страницу сверху" -#: lazarusidestrconsts:lismenueditorselecttemplate -msgid "Select Template:" -msgstr "Выбрать шаблон:" - -#: lazarusidestrconsts:srkmecselup -msgid "Select Up" -msgstr "Выделить вверх" - -#: lazarusidestrconsts:srkmecselwordleft -msgid "Select Word Left" -msgstr "Выделить слово слева" - -#: lazarusidestrconsts:srkmecselwordright -msgid "Select Word Right" -msgstr "Выделить слово справа" - -#: lazarusidestrconsts:lisselectahelpitem -msgid "Select a help item:" -msgstr "Рскать элемент справки:" - -#: lazarusidestrconsts:lisselectanode -msgid "Select a node" -msgstr "Выберите элемент" - -#: lazarusidestrconsts:lisnpselectaprojecttype -msgid "Select a project type" -msgstr "Выберите тип проекта" - -#: lazarusidestrconsts:lismenuselectall -msgid "Select all" -msgstr "Выделить РІСЃРµ" - -#: lazarusidestrconsts:lismenuselectcodeblock -msgid "Select code block" -msgstr "Выделить блок РєРѕРґР°" - -#: lazarusidestrconsts:lispatheditselectdirectory -msgid "Select directory" -msgstr "Выбрать каталог" - -#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds -msgid "Select grand childs" -msgstr "" - -#: lazarusidestrconsts:lismenuselectline -msgid "Select line" -msgstr "Выделить строку" - #: lazarusidestrconsts:lismenuselectparagraph msgid "Select paragraph" msgstr "Выделить абзац" @@ -6034,6 +6265,10 @@ msgstr "Выделить абзац" msgid "Select parent component" msgstr "Выбрать родительский компонент" +#: lazarusidestrconsts:lismenueditorselecttemplate +msgid "Select Template:" +msgstr "Выбрать шаблон:" + #: lazarusidestrconsts:srkmecseleditortop msgid "Select to absolute beginning" msgstr "Выделить РґРѕ самого начала" @@ -6046,22 +6281,34 @@ msgstr "Выделить РґРѕ самого конца" msgid "Select to brace" msgstr "Выделить РґРѕ СЃРєРѕР±РєРё" +#: lazarusidestrconsts:srkmecselup +msgid "Select Up" +msgstr "Выделить вверх" + #: lazarusidestrconsts:lismenuselectword msgid "Select word" -msgstr "" +msgstr "Выбрать слово" + +#: lazarusidestrconsts:srkmecselwordleft +msgid "Select Word Left" +msgstr "Выделить слово слева" + +#: lazarusidestrconsts:srkmecselwordright +msgid "Select Word Right" +msgstr "Выделить слово справа" #: lazarusidestrconsts:liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Выделить элемент:" -#: lazarusidestrconsts:dlgselectedtext -msgid "Selected Text" -msgstr "Р’ выделенном" - #: lazarusidestrconsts:lispckexplisrequiredby msgid "Selected package is required by:" msgstr "Выбранный пакет нужен для:" +#: lazarusidestrconsts:dlgselectedtext +msgid "Selected Text" +msgstr "Р’ выделенном" + #: lazarusidestrconsts:dlgruberbandselectioncolor msgid "Selection" msgstr "Выделение" @@ -6074,25 +6321,29 @@ msgstr "Выбор превышает строковую константу" msgid "Selection tool" msgstr "Рнструмент выбора" +#: lazarusidestrconsts:srkmecselleft +msgid "SelLeft" +msgstr "SelLeft" + +#: lazarusidestrconsts:srkmecselright +msgid "SelRight" +msgstr "SelRight" + #: lazarusidestrconsts:liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Точка СЃ запятой" #: lazarusidestrconsts:dlgposavesession msgid "Session" -msgstr "" - -#: lazarusidestrconsts:srkmecsetmarker -msgid "Set Marker %d" -msgstr "Установить маркер %d" - -#: lazarusidestrconsts:uemsetfreebookmark -msgid "Set a free Bookmark" -msgstr "" +msgstr "Сеанс работы" #: lazarusidestrconsts:lismenusetfreebookmark msgid "Set a free bookmark" -msgstr "" +msgstr "Установить СЃРІРѕР±РѕРґРЅСѓСЋ закладку" + +#: lazarusidestrconsts:uemsetfreebookmark +msgid "Set a free Bookmark" +msgstr "Установить СЃРІРѕР±РѕРґРЅСѓСЋ Закладку" #: lazarusidestrconsts:dlgsetallelementdefault msgid "Set all elements to default" @@ -6102,13 +6353,41 @@ msgstr "Установить РІСЃРµ элементы РїРѕ умолчанию" msgid "Set element to default" msgstr "Установить элемент РїРѕ умолчанию" +#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi +msgid "set FPC mode to DELPHI" +msgstr "установить режим FPC РІ DELPHI" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc +msgid "set FPC mode to GPC" +msgstr "установить режим FPC РІ GPC" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetotp +msgid "set FPC mode to TP" +msgstr "установить режим FPC РІ TP" + +#: lazarusidestrconsts:lisedtdefsetiocheckson +msgid "set IOCHECKS on" +msgstr "Включить IOCHECKS" + +#: lazarusidestrconsts:srkmecsetmarker +msgid "Set Marker %d" +msgstr "Установить маркер %d" + +#: lazarusidestrconsts:lisedtdefsetoverflowcheckson +msgid "set OVERFLOWCHECKS on" +msgstr "Включить OVERFLOWCHECKS" + #: lazarusidestrconsts:dlgsetpropertyvariable msgid "Set property Variable" msgstr "Переменная свойства" +#: lazarusidestrconsts:lisedtdefsetrangecheckson +msgid "set RANGECHECKS on" +msgstr "Включить RANGECHECKS" + #: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" -msgstr "" +msgstr "Установить точку останова РІСЃС‘ равно" #: lazarusidestrconsts:lislazbuildsettobuildall msgid "Set to %sBuild All%s" @@ -6130,54 +6409,14 @@ msgstr "" msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "Должен ли файл быть переименован РІ нижн. рег. РІ %s%s%s%s?" -#: lazarusidestrconsts:lisaf2pshowall -msgid "Show All" -msgstr "Показать РІСЃРµ" - -#: lazarusidestrconsts:lisuishowcodetoolsvalues -msgid "Show CodeTools Values" -msgstr "Показать значения CodeTools" - -#: lazarusidestrconsts:dlgcoshowerr -msgid "Show Errors" -msgstr "Показать ошибки" - -#: lazarusidestrconsts:dlgguidelines -msgid "Show Guide Lines" -msgstr "Показать линии помощи" - -#: lazarusidestrconsts:dlgshowhint -msgid "Show Hints" -msgstr "Показать подсказки" - -#: lazarusidestrconsts:dlghintsunused -msgid "Show Hints for unused units in main source" -msgstr "Подсказки для ненужных модулей РІ главном РёСЃС…РѕРґРЅРёРєРµ" - -#: lazarusidestrconsts:uemshowlinenumbers -msgid "Show Line Numbers" -msgstr "" - -#: lazarusidestrconsts:dlgshownotes -msgid "Show Notes" -msgstr "Показать заметки" - -#: lazarusidestrconsts:dlgcoshowoptions -msgid "Show Options" -msgstr "Показать опции" - -#: lazarusidestrconsts:fdmshowoptions -msgid "Show Options for form editing" -msgstr "Показать настройки для редактирования форм" - -#: lazarusidestrconsts:dlgshowwarnings -msgid "Show Warnings" -msgstr "Показать предупреждения" - #: lazarusidestrconsts:lisa2pshowall msgid "Show all" msgstr "Показать РІСЃРµ" +#: lazarusidestrconsts:lisaf2pshowall +msgid "Show All" +msgstr "Показать РІСЃРµ" + #: lazarusidestrconsts:liscoshowallmessages msgid "Show all messages" msgstr "Показать РІСЃРµ сообщения" @@ -6196,7 +6435,11 @@ msgstr "Показать РєРЅРѕРїРєРё закрытия закладок" #: lazarusidestrconsts:srkmecshowcodecontext msgid "Show code context" -msgstr "" +msgstr "Показывать контекст РєРѕРґР°" + +#: lazarusidestrconsts:lisuishowcodetoolsvalues +msgid "Show CodeTools Values" +msgstr "Показать значения CodeTools" #: lazarusidestrconsts:dlgshowcompiledprocedures msgid "Show compiled procedures" @@ -6226,6 +6469,10 @@ msgstr "Показать определённые макросы" msgid "Show editor hints" msgstr "Показвать подсказки редактора" +#: lazarusidestrconsts:dlgcoshowerr +msgid "Show Errors" +msgstr "Показать ошибки" + #: lazarusidestrconsts:dlgshoweverything msgid "Show everything" msgstr "Показать РІСЃС‘" @@ -6242,22 +6489,50 @@ msgstr "Показать общие сведения" msgid "Show grid" msgstr "Показать сетку" +#: lazarusidestrconsts:dlgguidelines +msgid "Show Guide Lines" +msgstr "Показать линии помощи" + #: lazarusidestrconsts:dlgshowgutterhints msgid "Show gutter hints" -msgstr "" +msgstr "Всплывающие подсказки поля (лев)" + +#: lazarusidestrconsts:dlgshowhint +msgid "Show Hints" +msgstr "Показать подсказки" + +#: lazarusidestrconsts:dlghintsunused +msgid "Show Hints for unused units in main source" +msgstr "Подсказки для ненужных модулей РІ главном РёСЃС…РѕРґРЅРёРєРµ" #: lazarusidestrconsts:lisshowhintsinobjectinspector msgid "Show hints in Object Inspector" -msgstr "" +msgstr "Показывать всплывающие подсказки РІ Рнспекторе Объектов" #: lazarusidestrconsts:dlgshowlinenumbers msgid "Show line numbers" msgstr "Показать номера строк" +#: lazarusidestrconsts:uemshowlinenumbers +msgid "Show Line Numbers" +msgstr "Показать номера строк" + +#: lazarusidestrconsts:dlgshownotes +msgid "Show Notes" +msgstr "Показать заметки" + #: lazarusidestrconsts:dlgshownothing msgid "Show nothing (only errors)" msgstr "Ничего РЅРµ показывать(только ошибки)" +#: lazarusidestrconsts:dlgcoshowoptions +msgid "Show Options" +msgstr "Показать опции" + +#: lazarusidestrconsts:fdmshowoptions +msgid "Show Options for form editing" +msgstr "Показать настройки для редактирования форм" + #: lazarusidestrconsts:dlgshowscrollhint msgid "Show scroll hint" msgstr "" @@ -6274,9 +6549,13 @@ msgstr "" msgid "Show used files" msgstr "Показать используемые файлы" +#: lazarusidestrconsts:dlgshowwarnings +msgid "Show Warnings" +msgstr "Показать предупреждения" + #: lazarusidestrconsts:lissimplesyntax msgid "Simple Syntax" -msgstr "" +msgstr "Простой Синтаксис" #: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" @@ -6288,7 +6567,7 @@ msgstr "Размер" #: lazarusidestrconsts:lisuidsize msgid "Size:" -msgstr "" +msgstr "Размер:" #: lazarusidestrconsts:liscoskipcallingcompiler msgid "Skip calling Compiler" @@ -6296,11 +6575,11 @@ msgstr "РџСЂРѕРїСѓСЃРє вызова компилятора" #: lazarusidestrconsts:lisskipfileandcontinueloading msgid "Skip file and continue loading" -msgstr "" +msgstr "Пропустить файл Рё продолжить загрузку" #: lazarusidestrconsts:lisskiploadinglastproject msgid "Skip loading last project" -msgstr "" +msgstr "Пропустить загрузку предыдущего проекта" #: lazarusidestrconsts:dlgcosmaller msgid "Smaller Code" @@ -6312,16 +6591,16 @@ msgstr "" #: lazarusidestrconsts:dlgsmarttabs msgid "Smart tabs" -msgstr "" - -#: lazarusidestrconsts:dlgsnapguidelines -msgid "Snap to Guide Lines" -msgstr "Выравнивать РїРѕ линиям помощи" +msgstr "Умные ТАБы" #: lazarusidestrconsts:dlgqsnaptogrid msgid "Snap to grid" msgstr "Выравнивать РїРѕ сетке" +#: lazarusidestrconsts:dlgsnapguidelines +msgid "Snap to Guide Lines" +msgstr "Выравнивать РїРѕ линиям помощи" + #: lazarusidestrconsts:srvk_snapshot msgid "Snapshot" msgstr "РЎРЅРёРјРѕРє" @@ -6342,14 +6621,6 @@ msgstr "Рзвините, этот тип ещё РЅРµ реализован" msgid "Sort selection" msgstr "Сортировка выбранного" -#: lazarusidestrconsts:lismenuviewsourceeditor -msgid "Source Editor" -msgstr "Редактор РёСЃС…РѕРґРЅРёРєРѕРІ" - -#: lazarusidestrconsts:srkmcatsrcnotebook -msgid "Source Notebook commands" -msgstr "Команды закладок РёСЃС…РѕРґРЅРёРєР°" - #: lazarusidestrconsts:lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "Рсточник Рё назначение одинаковы:%s%s" @@ -6362,10 +6633,18 @@ msgstr "Точка останова РІ РёСЃС…РѕРґРЅРёРєРµ" msgid "Source directory %s%s%s does not exist." msgstr "" +#: lazarusidestrconsts:lismenuviewsourceeditor +msgid "Source Editor" +msgstr "Редактор РёСЃС…РѕРґРЅРёРєРѕРІ" + #: lazarusidestrconsts:lissourcemodified msgid "Source modified" msgstr "РСЃС…РѕРґРЅРёРє изменён" +#: lazarusidestrconsts:srkmcatsrcnotebook +msgid "Source Notebook commands" +msgstr "Команды закладок РёСЃС…РѕРґРЅРёРєР°" + #: lazarusidestrconsts:lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "РСЃС…РѕРґРЅРёРє страницы %s%s%s изменён. Сохранить?" @@ -6412,7 +6691,7 @@ msgstr "Стандартное меню Справка" #: lazarusidestrconsts:lisstartwithanewproject msgid "Start with a new project" -msgstr "" +msgstr "РџСЂРё запуске начинать новый проект" #: lazarusidestrconsts:lisoipstate msgid "State" @@ -6422,41 +6701,49 @@ msgstr "Состояние" msgid "Static Keyword in Objects" msgstr "Ключевое слово Static РІ объектах" -#: lazarusidestrconsts:lishintstepinto -msgid "Step Into" -msgstr "Шаг СЃРѕ РІС…РѕРґРѕРј" - -#: lazarusidestrconsts:lishintstepover -msgid "Step Over" -msgstr "Шаг РІ РѕР±С…РѕРґ" +#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile +msgid "static packages config file" +msgstr "статический файл настроек пакета" #: lazarusidestrconsts:lismenustepinto msgid "Step into" msgstr "Шаг СЃРѕ РІС…РѕРґРѕРј" +#: lazarusidestrconsts:lishintstepinto +msgid "Step Into" +msgstr "Шаг СЃРѕ РІС…РѕРґРѕРј" + #: lazarusidestrconsts:lismenustepover msgid "Step over" msgstr "Шаг РІ РѕР±С…РѕРґ" +#: lazarusidestrconsts:lishintstepover +msgid "Step Over" +msgstr "Шаг РІ РѕР±С…РѕРґ" + #: lazarusidestrconsts:lismenustop msgid "Stop" msgstr "Останов" -#: lazarusidestrconsts:lisstopdebugging -msgid "Stop Debugging?" -msgstr "Остановить отладку?" - #: lazarusidestrconsts:dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Останов после числа ошибок" #: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" -msgstr "" +msgstr "Остановить текущую отладку Рё пересобрать проект?" #: lazarusidestrconsts:lisstopdebugging2 msgid "Stop debugging?" -msgstr "" +msgstr "Остановить отладку?" + +#: lazarusidestrconsts:lisstopdebugging +msgid "Stop Debugging?" +msgstr "Остановить отладку?" + +#: lazarusidestrconsts:srkmecstopprogram +msgid "stop program" +msgstr "остановить программу" #: lazarusidestrconsts:lisstopthedebugging msgid "Stop the debugging?" @@ -6470,14 +6757,14 @@ msgstr "Префикс STORED" msgid "Streaming error" msgstr "Ошибка потоков" -#: lazarusidestrconsts:lismakeresstrstringconstantinsource -msgid "String Constant in source" -msgstr "Строковая константа РІ РёСЃС…РѕРґРЅРёРєРµ" - #: lazarusidestrconsts:liscodetoolsoptsstringconst msgid "String constant" msgstr "Строковая константа" +#: lazarusidestrconsts:lismakeresstrstringconstantinsource +msgid "String Constant in source" +msgstr "Строковая константа РІ РёСЃС…РѕРґРЅРёРєРµ" + #: lazarusidestrconsts:lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Строки СЃ тем же значением:" @@ -6490,6 +6777,10 @@ msgstr "Вырезать символы РёР· бинарника" msgid "Style:" msgstr "Стиль:" +#: lazarusidestrconsts:dlgedbsubdir +msgid "Sub directory" +msgstr "Подкаталог" + #: lazarusidestrconsts:lissubprocedure msgid "Sub Procedure" msgstr "Подпроцедура" @@ -6498,22 +6789,22 @@ msgstr "Подпроцедура" msgid "Sub Procedure on same level" msgstr "Подпроцедура того же СѓСЂРѕРІРЅСЏ" -#: lazarusidestrconsts:dlgedbsubdir -msgid "Sub directory" -msgstr "Подкаталог" - #: lazarusidestrconsts:dlgsubpropkcolor msgid "Subpropertes" -msgstr "" +msgstr "Подсвойства" -#: lazarusidestrconsts:lisa2pswitchpaths -msgid "Switch Paths" -msgstr "Переключить пути" +#: lazarusidestrconsts:lissvnrevision +msgid "SVN Revision: " +msgstr "Ревизия SVN:" #: lazarusidestrconsts:srkmectoggleformunit msgid "Switch between form and unit" msgstr "Переключить модуль/форму" +#: lazarusidestrconsts:lisa2pswitchpaths +msgid "Switch Paths" +msgstr "Переключить пути" + #: lazarusidestrconsts:liscodetoolsoptssymbol msgid "Symbol" msgstr "РЎРёРјРІРѕР»" @@ -6536,16 +6827,12 @@ msgstr "Проверка синтаксиса" #: lazarusidestrconsts:dlgsyntaxoptions msgid "Syntax options" -msgstr "" +msgstr "Опции синтаксиса" #: lazarusidestrconsts:dlgrunosystemvariables msgid "System variables" msgstr "Системные переменные" -#: lazarusidestrconsts:dlgbp7cptb -msgid "TP/BP 7.0 Compatible" -msgstr "Совместимость СЃ TP/BP 7.0" - #: lazarusidestrconsts:srvk_tab msgid "Tab" msgstr "РўРђР‘" @@ -6560,7 +6847,7 @@ msgstr "" #: lazarusidestrconsts:liseotabwidths msgid "Tab widths" -msgstr "" +msgstr "РЁРёСЂРёРЅР° ТАБа" #: lazarusidestrconsts:dlgtabstospaces msgid "Tabs to spaces" @@ -6578,22 +6865,6 @@ msgstr "Для ЦП:" msgid "Target Directory:" msgstr "Каталог назначения:" -#: lazarusidestrconsts:listargetos -msgid "Target OS" -msgstr "Для какой РћРЎ" - -#: lazarusidestrconsts:liscotargetosspecificoptions -msgid "Target OS specific options" -msgstr "Специфические параметры РћРЎ" - -#: lazarusidestrconsts:lislazbuildtargetos -msgid "Target OS:" -msgstr "Для РћРЎ:" - -#: lazarusidestrconsts:dlgtargetplatform -msgid "Target Platform:" -msgstr "" - #: lazarusidestrconsts:dlgpotargetfilename msgid "Target file name:" msgstr "РРјСЏ исполняемого файла:" @@ -6608,19 +6879,35 @@ msgstr "РРјСЏ файла бинарника проекта" #: lazarusidestrconsts:dlgtargetproc msgid "Target i386" -msgstr "" +msgstr "Цель i386" -#: lazarusidestrconsts:lismenueditortemplatepreview -msgid "Template Preview" -msgstr "Просмотр шаблона" +#: lazarusidestrconsts:listargetos +msgid "Target OS" +msgstr "Для какой РћРЎ" + +#: lazarusidestrconsts:liscotargetosspecificoptions +msgid "Target OS specific options" +msgstr "Специфические параметры РћРЎ" + +#: lazarusidestrconsts:lislazbuildtargetos +msgid "Target OS:" +msgstr "Для РћРЎ:" + +#: lazarusidestrconsts:dlgtargetplatform +msgid "Target Platform:" +msgstr "Целевая Платформа:" #: lazarusidestrconsts:dlgtplfname msgid "Template file name" msgstr "РРјСЏ файла шаблона" +#: lazarusidestrconsts:lismenueditortemplatepreview +msgid "Template Preview" +msgstr "Просмотр шаблона" + #: lazarusidestrconsts:lisctdtemplates msgid "Templates" -msgstr "" +msgstr "Шаблоны" #: lazarusidestrconsts:liscomptest msgid "Test" @@ -6690,77 +6977,13 @@ msgstr "Главный каталог %s, %sРіРґРµ Borland установил РІ msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "Каталог %s проекта,%sсодержащий файлы .dpr, dpk." -#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase -msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для объектного паскаля." - -#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir -msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." -msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC \"%s\" выглядит некорректно. Обычно РѕРЅ содержит каталоги rtl, fcl, packages, compiler, ... ." - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir -msgid "The Free Pascal SVN source directory." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory -msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." -msgstr "" - -#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm -msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "Компилятор FreePascal (РёРјСЏ файла: %s) РЅРµ найден.%sВам рекомендуется установить fpc" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory -msgid "The Free Pascal project directory." -msgstr "Каталог проекта FreePascal." - -#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun -msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC РЅРµ найден.%sОтдельные действия СЃ РєРѕРґРѕРј РЅРµ Р±СѓРґСѓС‚ работать.%sРекомендуется установить его Рё установить путь%sEnvironment -> Environment Options -> Files" - -#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase -msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "LCL - Библиотека компонентов Lazarus - содержит РІСЃРµ основные компоненты для редактирования форм." - -#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis -msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что РѕРЅ содержит некоторые свойства/классы, которых нет РІ текущей версии LCL. Обычно следует убрать эти свойства РёР· lfm Рё (если надо) исправить РєРѕРґ паскаля вручную." - -#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr -msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "Каталог Lazarus РЅРµ найден.%sР’С‹ РЅРµ сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory -msgid "The Lazarus main directory." -msgstr "Главный каталог Lazarus." - -#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid -msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Максимальная версия %s%s%s некорректна.%sРспользуйте формат главная.вторичная.релиз.СЃР±РѕСЂРєР°%sНапример: 1.0.20.10" - -#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion -msgid "The Maximum Version is lower than the Minimim Version." -msgstr "Максимальная версия меньше минимальной." - -#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid -msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Минимальная версия %s%s%s некорректна.%sРспользуйте формат главная.вторичная.релиз.СЃР±РѕСЂРєР°%sНапример: 1.0.20.10" - -#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase -msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." -msgstr "" - -#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt -msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "Пробный каталог РЅРµ найден:%s%s%s%s%s (СЃРј. настройки окружения)" - #: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "Название типа предка %s%s%s совпадает СЃ%sмодулем %s%s%sСЋ" #: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." -msgstr "РўРёРї предка %s%s%s - неправильный идентификатор паскаля" +msgstr "РўРёРї предка %s%s%s - неправильный идентификатор Паскаля" #: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." @@ -6780,7 +7003,7 @@ msgstr "РРјСЏ класса %s%s%s совпадает СЃ %s именем РјРѕРґ #: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." -msgstr "РРјСЏ класса %s%s%s - недопустимый идентификатор паскаля" +msgstr "РРјСЏ класса %s%s%s - недопустимый идентификатор Паскаля" #: lazarusidestrconsts:listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." @@ -6806,6 +7029,14 @@ msgstr "Редактор компонента для класса %s%s%sСЃРІСЏР· msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" msgstr "Редактор компонента для класса %s%s%sвызвал ошибку:%s%s%s%s" +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "%s%s%s.%sРначе проверьте Окружение->Настройки окружения->Файлы" + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" +msgstr "Текущее РёРјСЏ компилятора %s%s%s%s - РЅРµ исполняемый файл.%sПроверьте Environment -> Environment Options -> Files" + #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgstr "Текущий каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC %s%s%s%sвыглядит неправильно.%sПроверьте Environment -> Environment Options -> Files" @@ -6822,14 +7053,6 @@ msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит непр msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Р’С‹ РЅРµ сможете создавать приложения LCL.%sВыберите РћРљ для использования каталога РїРѕ умолчанию %s%s%s,%s или же проверьте Environment -> Environment Options -> Files" -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "%s%s%s.%sРначе проверьте Окружение->Настройки окружения->Файлы" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "Текущее РёРјСЏ компилятора %s%s%s%s - РЅРµ исполняемый файл.%sПроверьте Environment -> Environment Options -> Files" - #: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." msgstr "Текущий путь модуля для файла %s%s%s%s - %s%s%s%s.%s%sПуть Рє модулям LCL %s%s%s отсутствует.%s%sПодсказка для новичков:%sСоздайте приложение lazarus Рё поместите файл РІ каталог проекта." @@ -6862,6 +7085,10 @@ msgstr "" msgid "The directory \"" msgstr "Каталог \"" +#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase +msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." +msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для Объектного Паскаля." + #: lazarusidestrconsts:listhefile msgid "The file %s%s%s" msgstr "Файл %s%s%s" @@ -6946,6 +7173,30 @@ msgstr "" msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" msgstr "РќРµ найдены следующие модули:%s%s%s%s1)Либо этих модулей нет РІ пути РїРѕРёСЃРєР° модулей, тогда прервите операцию сейчас, исправьте пути модулей Рё попробуйте СЃРЅРѕРІР°.%s2) Возможно, модули поступили РёР· регистронезависимой системы (windows/Delphi), Р° сейчас РЅР° регистрозависимой системе (linux, bsd, macosx). Р’ этом случае сейчас прервите операцию, переименуйте модули РІ нижний регистр Рё попробуйте СЃРЅРѕРІР°.%s3) Можно игнорировать отсутствуюзие модули Рё продолжить.%s%sДолжны ли отсутствующие модули быть закомментированы?" +#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir +msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." +msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC \"%s\" выглядит некорректно. Обычно РѕРЅ содержит каталоги rtl, fcl, packages, compiler, ... ." + +#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm +msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." +msgstr "Компилятор FreePascal (РёРјСЏ файла: %s) РЅРµ найден.%sВам рекомендуется установить fpc" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory +msgid "The Free Pascal project directory." +msgstr "Каталог проекта FreePascal." + +#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun +msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" +msgstr "Каталог РёСЃС…РѕРґРЅРёРєРѕРІ FPC РЅРµ найден.%sОтдельные действия СЃ РєРѕРґРѕРј РЅРµ Р±СѓРґСѓС‚ работать.%sРекомендуется установить его Рё установить путь%sEnvironment -> Environment Options -> Files" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir +msgid "The Free Pascal SVN source directory." +msgstr "Каталог РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° Free Pascal РёР· SVN." + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory +msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." +msgstr "Каталог РёСЃС…РѕРґРЅРѕРіРѕ РєРѕРґР° Free Pascal РёР· SVN. РќРµ обязателен. Улучшит РїРѕРёСЃРє объявлений Рё отладку." + #: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "Главное приложение %s%s%s - РЅРµ исполняемый файл." @@ -6958,21 +7209,49 @@ msgstr "" msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "Каталог lazarus \"%s\" выглядит некорректно. Обычно РѕРЅ содержит каталоги lcl, debugger, designer, components, ... ." +#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr +msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" +msgstr "Каталог Lazarus РЅРµ найден.%sР’С‹ РЅРµ сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files" + +#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory +msgid "The Lazarus main directory." +msgstr "Главный каталог Lazarus." + +#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase +msgid "The LCL - Lazarus Component Library contains all base components for form editing." +msgstr "LCL - Библиотека компонентов Lazarus - содержит РІСЃРµ основные компоненты для редактирования форм." + +#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis +msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." +msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что РѕРЅ содержит некоторые свойства/классы, которых нет РІ текущей версии LCL. Обычно следует убрать эти свойства РёР· lfm Рё (если надо) исправить РєРѕРґ Паскаля вручную." + #: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "Файл make \"%s\" - РЅРµ исполняемый файл." +#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid +msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Максимальная версия %s%s%s некорректна.%sРспользуйте формат главная.вторичная.релиз.СЃР±РѕСЂРєР°%sНапример: 1.0.20.10" + #: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "Максимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)" +#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion +msgid "The Maximum Version is lower than the Minimim Version." +msgstr "Максимальная версия меньше минимальной." + +#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid +msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Минимальная версия %s%s%s некорректна.%sРспользуйте формат главная.вторичная.релиз.СЃР±РѕСЂРєР°%sНапример: 1.0.20.10" + #: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "Минимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)" #: lazarusidestrconsts:listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "РРјСЏ %s%s%s - неправильный идентификатор паскаля." +msgstr "РРјСЏ %s%s%s - неправильный идентификатор Паскаля." #: lazarusidestrconsts:lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." @@ -7082,6 +7361,14 @@ msgstr "Строка ресурсов %s%s%s уже есть. %sВыберите msgid "The root component can not be deleted." msgstr "Компонент верхнего СѓСЂРѕРІРЅСЏ РЅРµ может быть удалён." +#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase +msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." +msgstr "RTL - Библиотека Времени Выполнения (Run-Time Library) является РѕСЃРЅРѕРІРѕР№ всех программ Free Pascal." + +#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt +msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" +msgstr "Пробный каталог РЅРµ найден:%s%s%s%s%s (СЃРј. настройки окружения)" + #: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "Модуль %s%s%s уже есть. РџСЂРѕРїСѓСЃРє приведёт Рє переименованию,%sОтмена отменить сохранение этого файла, Р°%sПрервать - отменит сохранение вообще." @@ -7092,7 +7379,7 @@ msgstr "Модуль %s%s%s РЅРµ РІ нижнем регистре.%sРљРѕРјРїРёР» #: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "Модуль уже называется %s%s%s. Рдентификаторы паскаля должны быть уникальны." +msgstr "Модуль уже называется %s%s%s. Рдентификаторы Паскаля должны быть уникальны." #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." @@ -7108,7 +7395,7 @@ msgstr "РРјСЏ модуля %s%s%s РЅРµ соответствует имени С„ #: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "РРјСЏ модуля %s%s%s - недопустимый идентификатор паскаля." +msgstr "РРјСЏ модуля %s%s%s - недопустимый идентификатор Паскаля." #: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." @@ -7138,14 +7425,6 @@ msgstr "Р’ каталоге есть Рё РґСЂСѓРіРёРµ файлы СЃ таким Р¶ msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "Есть РґРІР° модуля СЃ одинаковым именем:%s%s1. %s%s%s РёР· %s%s2. %s%s%s РёР· %s%s%s" -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage -msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "Есть модуль FPC СЃ таким же именем, как Рё пакет:%s%s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom -msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "Есть модуль FPC СЃ таким же именем, как:%s%s%s%s%s РёР· %s%s%s" - #: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "Обнаружен цикл зависимостей пакетов. Смотрите диаграмму пакетов." @@ -7154,6 +7433,14 @@ msgstr "Обнаружен цикл зависимостей пакетов. РЎ msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "РќР° РґРёСЃРєРµ есть файл СЃ таким же именем Рё похожим расширением%sФайл: %s%sПохожий файл: %s%s%sУдалить второй файл?" +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage +msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" +msgstr "Есть модуль FPC СЃ таким же именем, как Рё пакет:%s%s%s%s%s%s" + +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom +msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" +msgstr "Есть модуль FPC СЃ таким же именем, как:%s%s%s%s%s РёР· %s%s%s" + #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Допускается максимум %s инструментов." @@ -7176,7 +7463,7 @@ msgstr "Уже загружен пакет %s%s%s %sРёР· файла %s%s%s.%sРЎ #: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "Уже есть модуль, называемый %s%s%s. Рдентификаторы паскаля должны быть уникальны." +msgstr "Уже есть модуль, называемый %s%s%s. Рдентификаторы Паскаля должны быть уникальны." #: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" @@ -7210,6 +7497,10 @@ msgstr "Этот файл отсутствует РІРѕ всех загружен msgid "This file was automatically created by Lazarus. Do not edit!" msgstr "" +#: lazarusidestrconsts:listhishelpmessage +msgid "this help message" +msgstr "это справочное сообщение" + #: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" @@ -7258,14 +7549,14 @@ msgstr "Настройки ToDo..." msgid "Toggle Form/Unit" msgstr "Переключить форму/модуль" -#: lazarusidestrconsts:srkmectogglemode -msgid "Toggle Mode" -msgstr "Переключить режим" - #: lazarusidestrconsts:lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Переключить форму/модуль" +#: lazarusidestrconsts:srkmectogglemode +msgid "Toggle Mode" +msgstr "Переключить режим" + #: lazarusidestrconsts:liscodetempltoken msgid "Token:" msgstr "" @@ -7280,7 +7571,7 @@ msgstr "Команды меню Рнструменты" #: lazarusidestrconsts:dlgtooltipeval msgid "Tooltip expression evaluation" -msgstr "" +msgstr "Отображать вычисленные значения РІ подсказках" #: lazarusidestrconsts:dlgtooltiptools msgid "Tooltip symbol Tools" @@ -7298,6 +7589,10 @@ msgstr "Верх:" msgid "Tops" msgstr "" +#: lazarusidestrconsts:dlgbp7cptb +msgid "TP/BP 7.0 Compatible" +msgstr "Совместимость СЃ TP/BP 7.0" + #: lazarusidestrconsts:dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Обрезать хвостовые пробелы" @@ -7314,13 +7609,9 @@ msgstr "РўРёРї" msgid "Type:" msgstr "РўРёРї:" -#: lazarusidestrconsts:dlgcdtuppercase -msgid "UPPERCASE" -msgstr "ВЕРХНРР™ РЕГРРЎРўР " - #: lazarusidestrconsts:rslanguageukrainian msgid "Ukrainian" -msgstr "" +msgstr "Украинский" #: lazarusidestrconsts:lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" @@ -7334,14 +7625,14 @@ msgstr "РќРµ РјРѕРіСѓ скопировать компоненты РІ буфер" msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "РќРµ РјРѕРіСѓ добавить %s Рє проекту, С‚.Рє. РІ проекте уже есть модуль СЃ таким именем." -#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably -msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "РќРµ РјРѕРіСѓ добавить ресурс T%s:FORMDATA Рє файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса." - #: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "РќРµ РјРѕРіСѓ добавить комментарий заголовка ресурса Рє файлу ресурса %s%s%s%s.%sВозможно, ошибка синтаксиса." +#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably +msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "РќРµ РјРѕРіСѓ добавить ресурс T%s:FORMDATA Рє файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса." + #: lazarusidestrconsts:lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "РќРµ РјРѕРіСѓ сохранить резервный файл %s%s%s как %s%s%s!" @@ -7436,7 +7727,7 @@ msgstr "РќРµ РјРѕРіСѓ создать каталог цели для lazarus:%s%s #: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." -msgstr "" +msgstr "Невозможно создать временный буфер LFM" #: lazarusidestrconsts:lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" @@ -7456,7 +7747,7 @@ msgstr "РќРµ РјРѕРіСѓ удалить старый файл %s%s%s%s РёР· пак #: lazarusidestrconsts:lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." -msgstr "" +msgstr "Невозможно найти %s РІ потоке LFM" #: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." @@ -7480,11 +7771,11 @@ msgstr "РќРµ РјРѕРіСѓ найти метод. Рсправьте ошибки РІ #: lazarusidestrconsts:lisunabletogathereditorchanges msgid "Unable to gather editor changes." -msgstr "" +msgstr "Невозможно определить изменения РІ редакторе." #: lazarusidestrconsts:lisunabletogetsourcefordesigner msgid "Unable to get source for designer." -msgstr "" +msgstr "Невозможно получить исходный РєРѕРґ для дизайнера." #: lazarusidestrconsts:lisdebugunabletoloadfile msgid "Unable to load file" @@ -7504,7 +7795,7 @@ msgstr "РќРµ РјРѕРіСѓ загрузить пакет" #: lazarusidestrconsts:lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." -msgstr "" +msgstr "Невозможно открыть пакет %s%s%s.%sЭтот пакет был отмечен для установки." #: lazarusidestrconsts:lisunabletoreadfile msgid "Unable to read file" @@ -7528,7 +7819,7 @@ msgstr "РќРµ РјРѕРіСѓ прочитать файл пакета %s%s%s." #: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" -msgstr "" +msgstr "Невозможно прочитать файл состояния %s проекта %s%sОшибка: %s" #: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" @@ -7672,7 +7963,7 @@ msgstr "Откат после сохранения" #: lazarusidestrconsts:dlgundolimit msgid "Undo limit" -msgstr "" +msgstr "Лимит отмен" #: lazarusidestrconsts:srkmecblockunindent msgid "Unindent block" @@ -7714,14 +8005,30 @@ msgstr "Модуль %s%s%s изменён. Сохранить?" msgid "Unit %s%s%s was removed from package" msgstr "Модуль %s%s%s был удалён РёР· пакета" +#: lazarusidestrconsts:dlgunitdepcaption +msgid "Unit dependencies" +msgstr "Зависимости модуля" + +#: lazarusidestrconsts:lisa2punitfilename +msgid "Unit file name:" +msgstr "РРјСЏ файла модуля:" + #: lazarusidestrconsts:lisa2punitfilename2 msgid "Unit File Name:" msgstr "РРјСЏ файла модуля:" +#: lazarusidestrconsts:lisunitidentifierexists +msgid "Unit identifier exists" +msgstr "Рдентификатор модуля существует" + #: lazarusidestrconsts:uemshowunitinfo msgid "Unit Info" msgstr "Сведения Рѕ модуле" +#: lazarusidestrconsts:lisprojaddunitnamealreadyexists +msgid "Unit name already exists" +msgstr "РРјСЏ модуля уже есть" + #: lazarusidestrconsts:lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "РРјСЏ модуля недопустимо" @@ -7734,10 +8041,26 @@ msgstr "РРјСЏ модуля:" msgid "Unit Name: " msgstr "РРјСЏ модуля: " +#: lazarusidestrconsts:lisunitnotfound +msgid "Unit not found" +msgstr "Модуль РЅРµ найден" + +#: lazarusidestrconsts:lispkgsysunitnotfound +msgid "Unit not found: %s%s%s" +msgstr "Модуль РЅРµ найден: %s%s%s" + #: lazarusidestrconsts:lisunitoutputdirectory msgid "Unit Output directory" msgstr "Каталог для генерации модулей" +#: lazarusidestrconsts:dlgunitoutp +msgid "Unit output directory (-FE):" +msgstr "Каталог для генерации модулей (-FE):" + +#: lazarusidestrconsts:lisunitpath +msgid "unit path" +msgstr "путь модуля" + #: lazarusidestrconsts:lispkgdefsunitpath msgid "Unit Path" msgstr "Путь модуля" @@ -7746,34 +8069,6 @@ msgstr "Путь модуля" msgid "Unit Style:" msgstr "Стиль модулей:" -#: lazarusidestrconsts:dlgunitdepcaption -msgid "Unit dependencies" -msgstr "Зависимости модуля" - -#: lazarusidestrconsts:lisa2punitfilename -msgid "Unit file name:" -msgstr "РРјСЏ файла модуля:" - -#: lazarusidestrconsts:lisunitidentifierexists -msgid "Unit identifier exists" -msgstr "Рдентификатор модуля существует" - -#: lazarusidestrconsts:lisprojaddunitnamealreadyexists -msgid "Unit name already exists" -msgstr "РРјСЏ модуля уже есть" - -#: lazarusidestrconsts:lisunitnotfound -msgid "Unit not found" -msgstr "" - -#: lazarusidestrconsts:lispkgsysunitnotfound -msgid "Unit not found: %s%s%s" -msgstr "Модуль РЅРµ найден: %s%s%s" - -#: lazarusidestrconsts:dlgunitoutp -msgid "Unit output directory (-FE):" -msgstr "Каталог для генерации модулей (-FE):" - #: lazarusidestrconsts:lisunitlfmfile msgid "Unit: %s%sLFM file: %s" msgstr "Модуль: %s%sФайл LFM: %s" @@ -7788,7 +8083,7 @@ msgstr "Модуль СЃ таким именем уже РІ проекте" #: lazarusidestrconsts:lisunitsnotfound2 msgid "Units not found" -msgstr "" +msgstr "Модули РЅРµ найдены" #: lazarusidestrconsts:lismenuviewunits msgid "Units..." @@ -7798,6 +8093,10 @@ msgstr "Модули..." msgid "Unknown" msgstr "Неизвестный" +#: lazarusidestrconsts:srkmecunknown +msgid "unknown editor command" +msgstr "неизвестная команда редактора" + #: lazarusidestrconsts:lisunknownerrorpleasereportthisbug msgid "Unknown Error, please report this bug" msgstr "Неизвестная ошибка, сообщите Рѕ ней" @@ -7812,12 +8111,16 @@ msgstr "Вверх" #: lazarusidestrconsts:lisceoupdate msgid "Update" -msgstr "" +msgstr "Обновить" #: lazarusidestrconsts:lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "Обновить/перебрать" +#: lazarusidestrconsts:dlgcdtuppercase +msgid "UPPERCASE" +msgstr "ВЕРХНРР™ РЕГРРЎРўР " + #: lazarusidestrconsts:lismenuuppercaseselection msgid "Uppercase selection" msgstr "Верхний регистр выделения" @@ -7826,26 +8129,14 @@ msgstr "Верхний регистр выделения" msgid "Usage" msgstr "Рспользование" -#: lazarusidestrconsts:dlgcoansistr -msgid "Use Ansi Strings" -msgstr "Рспользовать строки Ansi" - -#: lazarusidestrconsts:lisuseexcludefilter -msgid "Use Exclude Filter" -msgstr "" - -#: lazarusidestrconsts:dlgcoheaptrc -msgid "Use Heaptrc Unit" -msgstr "Рспользовать модуль Heaprc" - -#: lazarusidestrconsts:lisuseincludefilter -msgid "Use Include Filter" -msgstr "" - #: lazarusidestrconsts:dlgusecustomconfig msgid "Use addional Compiler Config File" msgstr "Рспользовать дополнительный файл настроек компилятора" +#: lazarusidestrconsts:dlgcoansistr +msgid "Use Ansi Strings" +msgstr "Рспользовать строки Ansi" + #: lazarusidestrconsts:dlgedusedefcolor msgid "Use default color" msgstr "Цвет РїРѕ умолчанию" @@ -7854,10 +8145,30 @@ msgstr "Цвет РїРѕ умолчанию" msgid "Use display" msgstr "Рспользовать дисплей" +#: lazarusidestrconsts:lisuseexcludefilter +msgid "Use Exclude Filter" +msgstr "Рспользовать Рсключающий фильтр" + +#: lazarusidestrconsts:lisedtdefuseheaptrcunit +msgid "use HeapTrc unit" +msgstr "использовать модуль HeapTrc" + +#: lazarusidestrconsts:dlgcoheaptrc +msgid "Use Heaptrc Unit" +msgstr "Рспользовать модуль Heaprc" + +#: lazarusidestrconsts:lisuseincludefilter +msgid "Use Include Filter" +msgstr "Рспользовать Включающий фильтр" + #: lazarusidestrconsts:dlguselaunchingapp msgid "Use launching application" msgstr "Рспользовать приложение для запуска" +#: lazarusidestrconsts:lisedtdefuselineinfounit +msgid "use LineInfo unit" +msgstr "использовать модуль LineInfo" + #: lazarusidestrconsts:dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "Рспользовать стандартный файл настроек (fpc.cfg)" @@ -7868,16 +8179,12 @@ msgstr "Подсветка синтаксиса" #: lazarusidestrconsts:lispkgmanguseunit msgid "Use unit" -msgstr "" +msgstr "Рспользовать модуль" #: lazarusidestrconsts:rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Взять настройки РґРёСЃРї. РѕРєРѕРЅ" -#: lazarusidestrconsts:srkmecuserfirst -msgid "User First" -msgstr "" - #: lazarusidestrconsts:dlgedcustomext msgid "User defined extension" msgstr "Пользовательское расширение" @@ -7886,6 +8193,10 @@ msgstr "Пользовательское расширение" msgid "User defined extension (.pp.xxx)" msgstr "Расширение пользователя (.pp.xxx)" +#: lazarusidestrconsts:srkmecuserfirst +msgid "User First" +msgstr "" + #: lazarusidestrconsts:dlgrunouseroverrides msgid "User overrides" msgstr "Пользовательские замены" @@ -7938,10 +8249,22 @@ msgstr "Вертикально" msgid "Vertical grid step size" msgstr "Вертикальный шаг сетки" +#: lazarusidestrconsts:srkmecviewanchoreditor +msgid "View anchor editor" +msgstr "Показать редактор РїСЂРёРІСЏР·РѕРє" + #: lazarusidestrconsts:lismenuviewanchoreditor msgid "View Anchor Editor" msgstr "Показать редактор РїСЂРёРІСЏР·РѕРє" +#: lazarusidestrconsts:srkmectogglebreakpoints +msgid "View breakpoints" +msgstr "Просмотр точек останова" + +#: lazarusidestrconsts:srkmectogglecallstack +msgid "View call stack" +msgstr "Просмотр стека вызовов" + #: lazarusidestrconsts:uemviewcallstack msgid "View Call Stack" msgstr "Показать стек вызовов" @@ -7950,9 +8273,21 @@ msgstr "Показать стек вызовов" msgid "View Code Explorer" msgstr "Показать обозреватель РєРѕРґР°" +#: lazarusidestrconsts:srkmectogglecomppalette +msgid "View component palette" +msgstr "Показать палитру компонентов" + #: lazarusidestrconsts:lismenuviewcomponentpalette msgid "View Component Palette" -msgstr "" +msgstr "Показать Палитру Компонентов" + +#: lazarusidestrconsts:srkmectoggledebuggerout +msgid "View debugger output" +msgstr "Просмотр вывода отладчика" + +#: lazarusidestrconsts:srkmecviewforms +msgid "View forms" +msgstr "Показать формы" #: lazarusidestrconsts:lishintviewforms msgid "View Forms" @@ -7960,19 +8295,39 @@ msgstr "Показать формы" #: lazarusidestrconsts:lismenuviewidespeedbuttons msgid "View IDE speed buttons" -msgstr "" +msgstr "Показать РєРЅРѕРїРєРё быстрого доступа IDE" #: lazarusidestrconsts:lismenuviewjumphistory msgid "View Jump-History" msgstr "Просмотр истории переходов" +#: lazarusidestrconsts:srkmectogglelocals +msgid "View local variables" +msgstr "Просмотр локальных переменных" + +#: lazarusidestrconsts:srkmcatviewmenu +msgid "View menu commands" +msgstr "Команды меню Просмотр" + +#: lazarusidestrconsts:srkmectogglemessages +msgid "View messages" +msgstr "Просмотр сообщений" + #: lazarusidestrconsts:srkmectoggleobjectinsp msgid "View Object Inspector" -msgstr "Показать Рнспектор Объектов" +msgstr "Показать Рнспектор объектов" #: lazarusidestrconsts:lispckeditviewpackgesource msgid "View Package Source" -msgstr "Посмотреть РёСЃС…РѕРґРЅРёРє пакета" +msgstr "Показать РёСЃС…РѕРґРЅРёРє пакета" + +#: lazarusidestrconsts:dlgmainviewforms +msgid "View project forms" +msgstr "Показать формы проекта" + +#: lazarusidestrconsts:dlgmainviewunits +msgid "View project units" +msgstr "Показать модули проекта" #: lazarusidestrconsts:lisviewprojectunits msgid "View Project Units" @@ -7988,7 +8343,7 @@ msgstr "Просмотр РёСЃС…РѕРґРЅРёРєР°" #: lazarusidestrconsts:lisviewsourcelfm msgid "View Source (.lfm)" -msgstr "" +msgstr "Показать исходный текст (.lfm)" #: lazarusidestrconsts:srkmectogglesourceeditor msgid "View Source Editor" @@ -7998,74 +8353,30 @@ msgstr "Показать редактор РёСЃС…РѕРґРЅРёРєРѕРІ" msgid "View ToDo List" msgstr "Показать СЃРїРёСЃРѕРє ToDo" -#: lazarusidestrconsts:lismenuviewunitdependencies -msgid "View Unit Dependencies" -msgstr "Показать зависимости модулей" - -#: lazarusidestrconsts:lismenuviewunitinfo -msgid "View Unit Information" -msgstr "Посмотреть сведения Рѕ модуле" - -#: lazarusidestrconsts:lishintviewunits -msgid "View Units" -msgstr "Показать модули" - -#: lazarusidestrconsts:srkmecviewanchoreditor -msgid "View anchor editor" -msgstr "Показать редактор РїСЂРёРІСЏР·РѕРє" - -#: lazarusidestrconsts:srkmectogglebreakpoints -msgid "View breakpoints" -msgstr "Просмотр точек останова" - -#: lazarusidestrconsts:srkmectogglecallstack -msgid "View call stack" -msgstr "Просмотр стека вызовов" - -#: lazarusidestrconsts:srkmectogglecomppalette -msgid "View component palette" -msgstr "" - -#: lazarusidestrconsts:srkmectoggledebuggerout -msgid "View debugger output" -msgstr "Просмотр вывода отладчика" - -#: lazarusidestrconsts:srkmecviewforms -msgid "View forms" -msgstr "Показать формы" - -#: lazarusidestrconsts:srkmectogglelocals -msgid "View local variables" -msgstr "Просмотр локальных переменных" - -#: lazarusidestrconsts:srkmcatviewmenu -msgid "View menu commands" -msgstr "Команды меню Просмотр" - -#: lazarusidestrconsts:srkmectogglemessages -msgid "View messages" -msgstr "Просмотр сообщений" - -#: lazarusidestrconsts:dlgmainviewforms -msgid "View project forms" -msgstr "Показать формы проекта" - -#: lazarusidestrconsts:dlgmainviewunits -msgid "View project units" -msgstr "Показать модули проекта" - #: lazarusidestrconsts:srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Показать зависимости модулей" +#: lazarusidestrconsts:lismenuviewunitdependencies +msgid "View Unit Dependencies" +msgstr "Показать зависимости модулей" + #: lazarusidestrconsts:srkmecviewunitinfo msgid "View unit information" msgstr "Показать сведения Рѕ модуле" +#: lazarusidestrconsts:lismenuviewunitinfo +msgid "View Unit Information" +msgstr "Показать сведения Рѕ модуле" + #: lazarusidestrconsts:srkmecviewunits msgid "View units" msgstr "Показать модули" +#: lazarusidestrconsts:lishintviewunits +msgid "View Units" +msgstr "Показать модули" + #: lazarusidestrconsts:srkmectogglewatches msgid "View watches" msgstr "Показать наблюдения" @@ -8094,6 +8405,10 @@ msgstr "Правая видимая граница" msgid "Warn on compile" msgstr "Предупр. РїСЂРё компиляции" +#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis +msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" +msgstr "Предупреждение: найден двусмысленный файл %s%s%s. РСЃС…РѕРґРЅРёРє: %s%s%s" + #: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Внимание: дополнительный файл настроек компилятора имеет такое же РёРјСЏ, как может называться РѕРґРёРЅ РёР· стандартных файлов настроек компилятора FreePascal. Это приведёт Рє использованию дополнительного файла Рё РїСЂРѕРїСѓСЃРєСѓ стандартного." @@ -8102,10 +8417,6 @@ msgstr "Внимание: дополнительный файл настроек msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Внимание: Файл %s%s%s%sпринадлежит текущему проекту." -#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis -msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" -msgstr "Предупреждение: найден двусмысленный файл %s%s%s. РСЃС…РѕРґРЅРёРє: %s%s%s" - #: lazarusidestrconsts:lismenuviewwatches msgid "Watches" msgstr "РћРєРЅРѕ наблюдений" @@ -8122,14 +8433,14 @@ msgstr "" msgid "Where" msgstr "Где" -#: lazarusidestrconsts:dlgwholewordsonly -msgid "Whole Words Only" -msgstr "Только целые слова" - #: lazarusidestrconsts:lisfindfilewholewordsonly msgid "Whole words only" msgstr "Только целые слова" +#: lazarusidestrconsts:dlgwholewordsonly +msgid "Whole Words Only" +msgstr "Только целые слова" + #: lazarusidestrconsts:dlgwidthpos msgid "Width:" msgstr "РЁРёСЂРёРЅР°:" @@ -8158,17 +8469,13 @@ msgstr "Завершение слов" msgid "Words" msgstr "Слова" -#: lazarusidestrconsts:lisedtexttoolworkingdirectory -msgid "Working Directory:" -msgstr "Рабочий каталог:" - #: lazarusidestrconsts:dlgroworkingdirectory msgid "Working directory" msgstr "Рабочий каталог" -#: lazarusidestrconsts:liswriteerror -msgid "Write Error" -msgstr "Ошибка записи" +#: lazarusidestrconsts:lisedtexttoolworkingdirectory +msgid "Working Directory:" +msgstr "Рабочий каталог:" #: lazarusidestrconsts:dlgwritefpclogo msgid "Write an FPC logo" @@ -8178,319 +8485,23 @@ msgstr "Вывести логотип FPC" msgid "Write error" msgstr "Ошибка записи" +#: lazarusidestrconsts:liswriteerror +msgid "Write Error" +msgstr "Ошибка записи" + #: lazarusidestrconsts:dlgcdtwriteprefix msgid "Write prefix" msgstr "Префикс WRITE" #: lazarusidestrconsts:lisxmlfiles msgid "XML files" -msgstr "" - -#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling -msgid "You can not build lazarus while debugging or compiling." -msgstr "Р’С‹ РЅРµ можете перебрать lazarus РїСЂРё отладке или компиляции." - -#: lazarusidestrconsts:dlgdoesnotexist -msgid "\" does not exist." -msgstr "\" РЅРµ существует." - -#: lazarusidestrconsts:uefilerotext2 -msgid "\" is not writable." -msgstr "\" РЅРµ для записи." - -#: lazarusidestrconsts:srkmecabortbuild -msgid "abort build" -msgstr "прервать СЃР±РѕСЂРєСѓ" - -#: lazarusidestrconsts:srkmecaddbreakpoint -msgid "add break point" -msgstr "добавить точку останова" - -#: lazarusidestrconsts:srkmecaddwatch -msgid "add watch" -msgstr "добавить наблюдение" - -#: lazarusidestrconsts:srvk_apps -msgid "application key" -msgstr "клавиша приложения" - -#: lazarusidestrconsts:lisoipautoinstalldynamic -msgid "auto install dynamic" -msgstr "автоустановить динамически" - -#: lazarusidestrconsts:lisoipautoinstallstatic -msgid "auto install static" -msgstr "автоустановить статически" - -#: lazarusidestrconsts:srkmecbuildall -msgid "build all files of program/project" -msgstr "собрать РІСЃРµ файлы программы/проекта" - -#: lazarusidestrconsts:srkmecbuildfile -msgid "build file" -msgstr "собрать файл" - -#: lazarusidestrconsts:srkmecbuild -msgid "build program/project" -msgstr "собрать программу/проект" - -#: lazarusidestrconsts:dlglefttopclr -msgid "color for left, top" -msgstr "цвет слева сверху" - -#: lazarusidestrconsts:dlgrightbottomclr -msgid "color for right, bottom" -msgstr "цвет справа СЃРЅРёР·Сѓ" - -#: lazarusidestrconsts:srkmeccompileroptions -msgid "compiler options" -msgstr "параметры компилятора" - -#: lazarusidestrconsts:liscodetoolsdefscompilerpath -msgid "compiler path" -msgstr "путь Рє компилятору" - -#: lazarusidestrconsts:srkmecconfigbuildfile -msgid "config build file" -msgstr "файл настроек СЃР±РѕСЂРєРё" - -#: lazarusidestrconsts:liscustomoptions -msgid "custom options" -msgstr "опции пользователя" - -#: lazarusidestrconsts:liscodefault -msgid "default (%s)" -msgstr "РїРѕ умолчанию (%s)" - -#: lazarusidestrconsts:srkmecevaluate -msgid "evaluate/modify" -msgstr "рассчитать/изменить" - -#: lazarusidestrconsts:lisfilewheredebugoutputiswritten -msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr "" - -#: lazarusidestrconsts:lisuidinproject -msgid "in Project:" -msgstr "РІ проекте:" - -#: lazarusidestrconsts:lisfriinallopenpackagesandprojects -msgid "in all open packages and projects" -msgstr "РІРѕ всех открытых пакетах Рё проектах" - -#: lazarusidestrconsts:lisfriincurrentunit -msgid "in current unit" -msgstr "РІ текущем модуле" - -#: lazarusidestrconsts:lisfriinmainproject -msgid "in main project" -msgstr "РІ главном проекте" - -#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit -msgid "in project/package owning current unit" -msgstr "РІ проекте/пакете, содержащем этот модуль" - -#: lazarusidestrconsts:lisincludepath -msgid "include path" -msgstr "путь включаемых" - -#: lazarusidestrconsts:srkmecinspect -msgid "inspect" -msgstr "проверить" - -#: lazarusidestrconsts:lisoipinstalleddynamic -msgid "installed dynamic" -msgstr "установлен динамически" - -#: lazarusidestrconsts:lisoipinstalledstatic -msgid "installed static" -msgstr "установлен статически" - -#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename -msgid "invalid Compiler filename" -msgstr "неправильное РёРјСЏ Компилятора" - -#: lazarusidestrconsts:lislazarusoptionsprojectfilename -msgid "lazarus [options] " -msgstr "lazarus [опции] <РёРјСЏ файла проекта>" - -#: lazarusidestrconsts:srvk_lwin -msgid "left windows key" -msgstr "Левая клавиша Windows" - -#: lazarusidestrconsts:lislibrarypath -msgid "library path" -msgstr "путь Рє библиотекам" - -#: lazarusidestrconsts:lislinkeroptions -msgid "linker options" -msgstr "параметры линкера" - -#: lazarusidestrconsts:dlgcdtlower -msgid "lowercase" -msgstr "нижний регистр" - -#: lazarusidestrconsts:lisprojectmakrounitpath -msgid "makro ProjectUnitPath" -msgstr "" - -#: lazarusidestrconsts:lisoipmissing -msgid "missing" -msgstr "отсутствует" - -#: lazarusidestrconsts:lisoipmodified -msgid "modified" -msgstr "изменён" - -#: lazarusidestrconsts:lisuidno -msgid "no" -msgstr "нет" - -#: lazarusidestrconsts:dlgnoautomaticrenaming -msgid "no automatic renaming" -msgstr "без автопереименования" - -#: lazarusidestrconsts:lisnoname -msgid "noname" -msgstr "без имени" - -#: lazarusidestrconsts:liscodetoolsdefsnoneselected -msgid "none selected" -msgstr "Ничего РЅРµ выбрано" - -#: lazarusidestrconsts:lisobjectpath -msgid "object path" -msgstr "путь объекта" - -#: lazarusidestrconsts:lispckeditpackagenotsaved -msgid "package %s not saved" -msgstr "пакет %s РЅРµ сохранён" - -#: lazarusidestrconsts:lispkgmangpackagemainsourcefile -msgid "package main source file" -msgstr "главный файл-РёСЃС…РѕРґРЅРёРє пакета" - -#: lazarusidestrconsts:srkmecpause -msgid "pause program" -msgstr "приостановить программу" - -#: lazarusidestrconsts:lisctpleaseselectamacro -msgid "please select a macro" -msgstr "" - -#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig -msgid "primary config directory, where Lazarus stores its config files. Default is " -msgstr "" - -#: lazarusidestrconsts:lisoipreadonly -msgid "readonly" -msgstr "только чтение" - -#: lazarusidestrconsts:srkmecremovebreakpoint -msgid "remove break point" -msgstr "удалить точку останова" - -#: lazarusidestrconsts:srkmecresetdebugger -msgid "reset debugger" -msgstr "СЃР±СЂРѕСЃ отладчика" - -#: lazarusidestrconsts:srvk_rwin -msgid "right windows key" -msgstr "правая клавиша Windows" - -#: lazarusidestrconsts:srkmecrunfile -msgid "run file" -msgstr "запуск файла" - -#: lazarusidestrconsts:srkmecrunparameters -msgid "run parameters" -msgstr "параметры запуска" - -#: lazarusidestrconsts:srkmecrun -msgid "run program" -msgstr "запустить программу" - -#: lazarusidestrconsts:lissaveallmodified -msgid "save all modified files" -msgstr "Сохранить РІСЃРµ измененные файлы" - -#: lazarusidestrconsts:lissavecurrenteditorfile -msgid "save current editor file" -msgstr "Сохранить текущий файл редактора" - -#: lazarusidestrconsts:lisfindfilesearchallfilesinproject -msgid "search all files in project" -msgstr "РїРѕРёСЃРє РІРѕ всех файлах проекта" - -#: lazarusidestrconsts:lisfindfilesearchallopenfiles -msgid "search all open files" -msgstr "РїРѕРёСЃРє РІРѕ всех открытых файлах" - -#: lazarusidestrconsts:lisfindfilesearchindirectories -msgid "search in directories" -msgstr "РїРѕРёСЃРє РІ каталогах" - -#: lazarusidestrconsts:dlgtimesecondunit -msgid "sec" -msgstr "сек" - -#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor -msgid "secondary config directory, where Lazarus searches for config template files. Default is " -msgstr "" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi -msgid "set FPC mode to DELPHI" -msgstr "установить режим FPC РІ DELPHI" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc -msgid "set FPC mode to GPC" -msgstr "установить режим FPC РІ GPC" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetotp -msgid "set FPC mode to TP" -msgstr "установить режим FPC РІ TP" - -#: lazarusidestrconsts:lisedtdefsetiocheckson -msgid "set IOCHECKS on" -msgstr "Включить IOCHECKS" - -#: lazarusidestrconsts:lisedtdefsetoverflowcheckson -msgid "set OVERFLOWCHECKS on" -msgstr "Включить OVERFLOWCHECKS" - -#: lazarusidestrconsts:lisedtdefsetrangecheckson -msgid "set RANGECHECKS on" -msgstr "Включить RANGECHECKS" - -#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile -msgid "static packages config file" -msgstr "статический файл настроек пакета" - -#: lazarusidestrconsts:srkmecstopprogram -msgid "stop program" -msgstr "остановить программу" - -#: lazarusidestrconsts:listhishelpmessage -msgid "this help message" -msgstr "это справочное сообщение" - -#: lazarusidestrconsts:lisunitpath -msgid "unit path" -msgstr "путь модуля" - -#: lazarusidestrconsts:srkmecunknown -msgid "unknown editor command" -msgstr "Неизвестная команда редактора" - -#: lazarusidestrconsts:lisedtdefuseheaptrcunit -msgid "use HeapTrc unit" -msgstr "использовать модуль HeapTrc" - -#: lazarusidestrconsts:lisedtdefuselineinfounit -msgid "use LineInfo unit" -msgstr "использовать LineInfo" +msgstr "Файлы XML" #: lazarusidestrconsts:lisuidyes msgid "yes" msgstr "РґР°" +#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling +msgid "You can not build lazarus while debugging or compiling." +msgstr "Р’С‹ РЅРµ можете перебрать lazarus РїСЂРё отладке или компиляции." + diff --git a/languages/lazaruside.ruold.po b/languages/lazaruside.ruold.po deleted file mode 100644 index b67f31ff9e..0000000000 --- a/languages/lazaruside.ruold.po +++ /dev/null @@ -1,8496 +0,0 @@ -#: lazarusidestrconsts:srkmcommand1 -msgid " command1 \"" -msgstr " ЛПНБОДБ1 \"" - -#: lazarusidestrconsts:srkmcommand2 -msgid " command2 \"" -msgstr " ЛПНБОДБ2 \"" - -#: lazarusidestrconsts:liscodetemplatokenalreadyexists -msgid " A token %s%s%s already exists! " -msgstr "ьМЕНЕОФ %s%s%s ХЦЕ УХЭЕУФЧХЕФ! " - -#: lazarusidestrconsts:srkmalreadyconnected -msgid " The key \"%s\" is already connected to \"%s\"." -msgstr "лМБЧЙЛБ \"%s\" ХЦЕ УПРПУФБЧМЕОБ У \"%s\"." - -#: lazarusidestrconsts:srkmconflicw -msgid " conflicts with " -msgstr " ЛПОЖМЙЛФХЕФ У " - -#: lazarusidestrconsts:liscompiling -msgid "%s (compiling ...)" -msgstr "%s (ЛПНРЙМЙТХА ...)" - -#: lazarusidestrconsts:lisdebugging -msgid "%s (debugging ...)" -msgstr "%s (ЙДЈФ ПФМБДЛБ ...)" - -#: lazarusidestrconsts:lisnewproject -msgid "%s - (new project)" -msgstr "%s - (ОПЧЩК РТПЕЛФ)" - -#: lazarusidestrconsts:lislazarusversionstring -msgid "%s beta" -msgstr "" - -#: lazarusidestrconsts:lisuidbytes -msgid "%s bytes" -msgstr "%s ВБКФ" - -#: lazarusidestrconsts:liscodetoolsdefsdirectory -msgid "%s directory" -msgstr "%s - ЬФП ЛБФБМПЗ" - -#: lazarusidestrconsts:lisisalreadypartoftheproject -msgid "%s is already part of the Project." -msgstr "%s - ХЦЕ ЮБУФШ РТПЕЛФБ." - -#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 -msgid "%s project directory" -msgstr "лБФБМПЗ РТПЕЛФБ %s" - -#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject -msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "%s%s%s - ОЕЛПТТЕЛФОПЕ ЙНС РТПЕЛФБ.%s чЩВЕТЙФЕ ДТХЗПЕ (ОБРТ., project1.lpi)" - -#: lazarusidestrconsts:lissvuoisnotavalididentifier -msgid "%s%s%s is not a valid identifier." -msgstr "%s%s%s - ОЕЛПТТЕЛФОЩК ЙДЕОФЙЖЙЛБФПТ." - -#: lazarusidestrconsts:lisa2pisnotavalidunitname -msgid "%s%s%s is not a valid unit name." -msgstr "%s%s%s - ОЕЛПТТЕЛФОПЕ ОБЪЧБОЙЕ НПДХМС" - -#: lazarusidestrconsts:liscoclickokifaresuretodothat -msgid "%s%sClick OK if you are sure to do that." -msgstr "" - -#: lazarusidestrconsts:lispkgsysfilename -msgid "%s%sFile Name: %s%s%s" -msgstr "%s%sйНС ЖБКМБ: %s%s%s" - -#: lazarusidestrconsts:lisunabletochangeclassofto -msgid "%s%sUnable to change class of %s to %s" -msgstr "" - -#: lazarusidestrconsts:lispkgsysunitname -msgid "%s%sUnit Name: %s%s%s" -msgstr "%s%sйНС НПДХМС: %s%s%s" - -#: lazarusidestrconsts:lispckeditpage -msgid "%s, Page: %s" -msgstr "%s, уФТБОЙГБ: %s" - -#: lazarusidestrconsts:liscodetoolsdefsautogenerated -msgid "%s, auto generated" -msgstr "%s, БЧФПУПЪДБО" - -#: lazarusidestrconsts:liscodetoolsdefsprojectspecific -msgid "%s, project specific" -msgstr "%s, УЧСЪБО У РТПЕЛФПН" - -#: lazarusidestrconsts:lisuereadonly -msgid "%s/ReadOnly" -msgstr "%s/ФПМШЛП ЮФЕОЙЕ" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage -msgid "%sAdding new Dependency for package %s: package %s%s" -msgstr "%sдПВБЧМЕОЙЕ ОПЧПК ЪБЧЙУЙНПУФЙ РБЛЕФБ %s: РБЛЕФ %s%s" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage -msgid "%sAdding new Dependency for project %s: package %s%s" -msgstr "%sдПВБЧМЕОЙЕ ОПЧПК ЪБЧЙУЙНПУФЙ РТПЕЛФБ %s: РБЛЕФ %s%s" - -#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu -msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." -msgstr "%sпВБ РБЛЕФБ УЧСЪБОЩ. ьФП ЪОБЮЙФ, ЮФП МЙВП ПДЙО ЙЪ ОЙИ ЙУРПМШЪХЕФ ДТХЗПК, МЙВП ПВБ ПОЙ ЙУРПМШЪХАФУС ФТЕФШЙН РБЛЕФПН." - -#: lazarusidestrconsts:lisoipdescriptiondescription -msgid "%sDescription: %s" -msgstr "%sпРЙУБОЙЕ: %s" - -#: lazarusidestrconsts:lisa2pexistingfile -msgid "%sExisting file: %s%s%s" -msgstr "%sуХЭЕУФЧХАЭЙК ЖБКМ: %s%s%s" - -#: lazarusidestrconsts:lisseeprojectprojectinspector -msgid "%sSee Project -> Project Inspector" -msgstr "%sуН. рТПЕЛФ -> йОУРЕЛФПТ РТПЕЛФБ" - -#: lazarusidestrconsts:lispckexplstate -msgid "%sState: " -msgstr "%sуПУФПСОЙЕ: " - -#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof -msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "%sуМЕДХАЭЙЕ НПДХМЙ ВХДХФ ДПВБЧМЕОЩ Л УЕЛГЙЙ uses %s%s:%s%s%s" - -#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound -msgid "%sThis package is installed, but the lpk file was not found" -msgstr "%sьФПФ РБЛЕФ ХУФБОПЧМЕО, ОП ЖБКМ lpk ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated -msgid "%sThis package was automatically created" -msgstr "%sьФПФ РБЛЕФ ВЩМ УПЪДБО БЧФПНБФЙЮЕУЛЙ" - -#: lazarusidestrconsts:uemaddbreakpoint -msgid "&Add Breakpoint" -msgstr "&дПВБЧ. ФПЮЛХ ПУФБОПЧБ" - -#: lazarusidestrconsts:uemclosepage -msgid "&Close Page" -msgstr "&ъБЛТЩФШ УФТБОЙГХ" - -#: lazarusidestrconsts:lismenucomponents -msgid "&Components" -msgstr "лПНРПОЕОФЩ" - -#: lazarusidestrconsts:lismenuedit -msgid "&Edit" -msgstr "&рТБЧЛБ" - -#: lazarusidestrconsts:lismenufile -msgid "&File" -msgstr "&жБКМ" - -#: lazarusidestrconsts:uemfinddeclaration -msgid "&Find Declaration" -msgstr "&оБКФЙ ПРЙУБОЙЕ" - -#: lazarusidestrconsts:uemgotobookmark -msgid "&Goto Bookmark" -msgstr "&рЕТЕИПД РП ЪБЛМБДЛЕ" - -#: lazarusidestrconsts:lismenuhelp -msgid "&Help" -msgstr "&уРТБЧЛБ" - -#: lazarusidestrconsts:uemopenfileatcursor -msgid "&Open file at cursor" -msgstr "&пФЛТЩФШ ЖБКМ Х ЛХТУПТБ" - -#: lazarusidestrconsts:lismenuproject -msgid "&Project" -msgstr "рТП&ЕЛФ" - -#: lazarusidestrconsts:dlgreplacewith -msgid "&Replace With" -msgstr "&ъБНЕОЙФШ ОБ" - -#: lazarusidestrconsts:lismenurun -msgid "&Run" -msgstr "&ъБРХУЛ" - -#: lazarusidestrconsts:uemruntocursor -msgid "&Run to Cursor" -msgstr "&рХУЛ ДП ЛХТУПТБ" - -#: lazarusidestrconsts:lismenusearch -msgid "&Search" -msgstr "&рПЙУЛ" - -#: lazarusidestrconsts:uemsetbookmark -msgid "&Set Bookmark" -msgstr "&хУФБОПЧЙФШ ЪБЛМБДЛХ" - -#: lazarusidestrconsts:dlgtexttofing -msgid "&Text to Find" -msgstr "&оБКФЙ ФЕЛУФ" - -#: lazarusidestrconsts:lismenutools -msgid "&Tools" -msgstr "&йОУФТХНЕОФЩ" - -#: lazarusidestrconsts:lismenuview -msgid "&View" -msgstr "&рТПУНПФТ" - -#: lazarusidestrconsts:lismenuwindows -msgid "&Windows" -msgstr "&пЛОБ" - -#: lazarusidestrconsts:liscefilter -msgid "(Filter)" -msgstr "" - -#: lazarusidestrconsts:dlgbaknosubdirectory -msgid "(no subdirectory)" -msgstr "" - -#: lazarusidestrconsts:listmunknownmacro -msgid "(unknown macro: %s)" -msgstr "(ОЕЙЪЧЕУФОЩК НБЛТПУ: %s)" - -#: lazarusidestrconsts:lislazdocnotagcaption -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisa2pchooseanexistingfile -msgid "" -msgstr "<ЧЩВЕТЙФЕ УХЭЕУФЧХАЭЙК ЖБКМ>" - -#: lazarusidestrconsts:lisctdefnovariableselected -msgid "" -msgstr "<оЕ ЧЩВТБОП РЕТЕНЕООЩИ>" - -#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen -msgid "A %s can not hold TControls.%sYou can only put non visual components on it." -msgstr "%s ОЕ НПЦЕФ УПДЕТЦБФШ ЛПНРПОЕОФЩ TControl.%sч ОЕЗП НПЦОП РПНЕЭБФШ ФПМШЛП ОЕЧЙЪХБМШОЩЕ ЛПНРПОЕОФЩ." - -#: lazarusidestrconsts:lisafilealreadyexistsreplaceit -msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "жБКМ %s%s%s ХЦЕ УХЭЕУФЧХЕФ.%s ъБНЕОЙФШ?" - -#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas -msgid "A pascal unit must have the extension .pp or .pas" -msgstr "нПДХМШ РБУЛБМС ДПМЦЕО ЙНЕФШ ТБУЫЙТЕОЙЕ .pp ЙМЙ .pas" - -#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound -msgid "A required packages was not found. See package graph." -msgstr "фТЕВХЕНЩК РБЛЕФ ОЕ ОБКДЕО. уН. ДЙБЗТБННХ РБЛЕФПЧ." - -#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi -msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." -msgstr "" - -#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename -msgid "A valid tool needs at least a title and a filename." -msgstr "оПТНБМШОЩК ЙОУФТХНЕОФ ПВСЪБФЕМШОП ДПМЦЕО ЙНЕФШ ЪБЗПМПЧПЛ Й ЙНС ЖБКМБ." - -#: lazarusidestrconsts:lispdabort -msgid "Abort" -msgstr "" - -#: lazarusidestrconsts:lismenuabortbuild -msgid "Abort Build" -msgstr "рТЕТЧБФШ УВПТЛХ" - -#: lazarusidestrconsts:lisabortall -msgid "Abort all" -msgstr "" - -#: lazarusidestrconsts:lisabortallloading -msgid "Abort all loading" -msgstr "" - -#: lazarusidestrconsts:lisabortloadingproject -msgid "Abort loading project" -msgstr "" - -#: lazarusidestrconsts:lismenutemplateabout -msgid "About" -msgstr "п " - -#: lazarusidestrconsts:lismenuaboutlazarus -msgid "About Lazarus" -msgstr "п РТПЕЛФЕ Lazarus" - -#: lazarusidestrconsts:srvk_accept -msgid "Accept" -msgstr "рТЙОСФШ" - -#: lazarusidestrconsts:liscodetoolsdefsaction -msgid "Action: %s" -msgstr "дЕКУФЧЙЕ: %s" - -#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme -msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "бЛФЙЧЙТПЧБФШ УЙОФБЛУЙУ ТЕЗХМСТОЩИ ЧЩТБЦЕОЙК ДМС ФЕЛУФБ Й ЪБНЕОЩ (РПЮФЙ ЛБЛ Ч perl)" - -#: lazarusidestrconsts:liscodetempladd -msgid "Add" -msgstr "дПВБЧЙФШ" - -#: lazarusidestrconsts:lisaddtoproject -msgid "Add %s to project?" -msgstr "дПВБЧЙФШ %s Л РТПЕЛФХ?" - -#: lazarusidestrconsts:uemaddwatchatcursor -msgid "Add &Watch At Cursor" -msgstr "дПВБЧЙФШ &ОБВМАДЕОЙЕ Х ЛХТУПТБ" - -#: lazarusidestrconsts:lisa2paddfile -msgid "Add File" -msgstr "дПВБЧЙФШ ЖБКМ" - -#: lazarusidestrconsts:lisa2paddfiles -msgid "Add Files" -msgstr "дПВБЧЙФШ ЖБКМЩ" - -#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist -msgid "Add LFM, LRS files, if they exist" -msgstr "дПВБЧЙФШ LFM, LRS ЖБКМЩ, ЕУМЙ ЕУФШ" - -#: lazarusidestrconsts:lisa2paddunit -msgid "Add Unit" -msgstr "дПВБЧЙФШ НПДХМШ" - -#: lazarusidestrconsts:lismenuaddcurunittopkg -msgid "Add active unit to a package" -msgstr "дПВБЧЙФШ БЛФЙЧОЩК НПДХМШ Л РТПЕЛФХ" - -#: lazarusidestrconsts:lispckeditaddanitem -msgid "Add an item" -msgstr "дПВБЧЙФШ ЬМЕНЕОФ" - -#: lazarusidestrconsts:lismenuaddbreakpoint -msgid "Add breakpoint" -msgstr "дПВБЧЙФШ ФПЮЛХ ПУФБОПЧБ" - -#: lazarusidestrconsts:liscodetempladdcodetemplate -msgid "Add code template" -msgstr "дПВБЧЙФШ ЫБВМПО ЛПДБ" - -#: lazarusidestrconsts:lismenuaddtoproject -msgid "Add editor file to Project" -msgstr "дПВБЧЙФШ ЖБКМ ТЕДБЛФПТБ Л рТПЕЛФХ" - -#: lazarusidestrconsts:lisprojaddeditorfile -msgid "Add editor files" -msgstr "дПВБЧЙФШ ЖБКМЩ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:lisaf2paddfiletoapackage -msgid "Add file to a package" -msgstr "дПВБЧЙФШ ЖБКМ Л РБЛЕФХ" - -#: lazarusidestrconsts:lisprojaddaddfiletoproject -msgid "Add file to project:" -msgstr "дПВБЧЙФШ ЖБКМ Л РТПЕЛФХ" - -#: lazarusidestrconsts:lisprojaddfiles -msgid "Add files" -msgstr "дПВБЧЙФШ ЖБКМЩ" - -#: lazarusidestrconsts:lisa2paddfilestopackage -msgid "Add files to package" -msgstr "дПВБЧЙФШ ЖБКМЩ Л РБЛЕФХ" - -#: lazarusidestrconsts:srkmecaddjumppoint -msgid "Add jump point" -msgstr "дПВБЧЙФШ ФПЮЛХ РЕТЕИПДБ" - -#: lazarusidestrconsts:lismenuaddjumppointtohistory -msgid "Add jump point to history" -msgstr "дПВБЧЙФШ ФПЮЛХ РЕТЕИПДБ Ч ЙУФПТЙА" - -#: lazarusidestrconsts:lislazdocaddlinkbutton -msgid "Add link" -msgstr "" - -#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects -msgid "Add options to dependent packages and projects" -msgstr "дПВБЧЙФШ РБТБНЕФТЩ Л ЪБЧЙУЙНЩН РБЛЕФБН Й РТПЕЛФБН" - -#: lazarusidestrconsts:lislazdocaddpathbutton -msgid "Add path" -msgstr "" - -#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects -msgid "Add paths to dependent packages/projects" -msgstr "дПВБЧЙФШ РХФЙ Л ЪБЧЙУЙНЩН РБЛЕФБН/РТПЕЛФБН" - -#: lazarusidestrconsts:lisoifaddtofavouriteproperties -msgid "Add to favourite properties" -msgstr "" - -#: lazarusidestrconsts:lisa2paddtopackage -msgid "Add to package" -msgstr "дПВБЧЙФШ Л РБЛЕФХ" - -#: lazarusidestrconsts:lisprojaddtoproject -msgid "Add to project" -msgstr "дПВБЧЙФШ Л РТПЕЛФХ" - -#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit -msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." -msgstr "" - -#: lazarusidestrconsts:lismenuaddwatch -msgid "Add watch ..." -msgstr "дПВБЧЙФШ ОБВМАДЕОЙЕ..." - -#: lazarusidestrconsts:dlgedadd -msgid "Add..." -msgstr "дПВБЧ." - -#: lazarusidestrconsts:dlgadditionalsrcpath -msgid "Additional Source search path for all projects (.pp;.pas)" -msgstr "дПРПМОЙФЕМШОЩЕ РХФЙ ЙУИПДОЙЛПЧ ДМС ЧУЕИ РТПЕЛФПЧ (.pp;.pas)" - -#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages -msgid "Additional compiler options inherited from packages" -msgstr "дПРПМОЙФЕМШОЩЕ РБТБНЕФТЩ ЛПНРЙМСФПТБ, ХОБУМЕДПЧБООЩЕ ПФ РБЛЕФПЧ" - -#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp -msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "дПРПМОЙФЕМШОЩЕ ЖБКМЩ ДМС РПЙУЛБ (ОБРТ. /path/*.pas;/path2/*.pp)" - -#: lazarusidestrconsts:dlgadjusttopline -msgid "Adjust top line due to comment in front" -msgstr "чЩТПЧОСФШ ЧЕТИОАА УФТПЛХ РП ЛПННЕОФБТЙА" - -#: lazarusidestrconsts:fdmalignword -msgid "Align" -msgstr "чЩТБЧОЙЧБОЙЕ" - -#: lazarusidestrconsts:lisalignment -msgid "Alignment" -msgstr "чЩТБЧОЙЧБОЙЕ" - -#: lazarusidestrconsts:lisallfiles -msgid "All Files" -msgstr "" - -#: lazarusidestrconsts:dlgallfiles -msgid "All files" -msgstr "чУЕ ЖБКМЩ" - -#: lazarusidestrconsts:lisedtdefallpackages -msgid "All packages" -msgstr "чУЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lisedtdefsallprojects -msgid "All projects" -msgstr "" - -#: lazarusidestrconsts:dlglabelgoto -msgid "Allow LABEL and GOTO" -msgstr "тБЪТЕЫЙФШ LABEL Й GOTO" - -#: lazarusidestrconsts:lisallowsearchingformultiplelines -msgid "Allow searching for multiple lines" -msgstr "тБЪТЕЫЙФШ РПЙУЛ ДМС ОЕУЛПМШЛЙИ УФТПЛ" - -#: lazarusidestrconsts:dlgalphabetically -msgid "Alphabetically" -msgstr "рП БМЖБЧЙФХ" - -#: lazarusidestrconsts:lisedtexttoolalt -msgid "Alt" -msgstr "Alt" - -#: lazarusidestrconsts:dlgaltsetclmode -msgid "Alt-Key sets column mode" -msgstr "лОПРЛБ Alt - ТЕЦЙН ЛПМПОПЛ" - -#: lazarusidestrconsts:srkmalternkey -msgid "Alternative Key" -msgstr "бМШФЕТОБФЙЧОБС ЛМБЧЙЫБ" - -#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged -msgid "Always build (even if nothing changed)" -msgstr "" - -#: lazarusidestrconsts:lisa2pambiguousancestortype -msgid "Ambiguous Ancestor Type" -msgstr "оЕСУОЩК ФЙР РТЕДЛБ" - -#: lazarusidestrconsts:lisa2pambiguousclassname -msgid "Ambiguous Class Name" -msgstr "оЕСУОПЕ ЙНС ЛМБУУБ" - -#: lazarusidestrconsts:lisa2pambiguousunitname -msgid "Ambiguous Unit Name" -msgstr "дЧХУНЩУМЕООПЕ ЙНС НПДХМС" - -#: lazarusidestrconsts:lisambiguousunitfound -msgid "Ambiguous Unit found" -msgstr "оБКДЕО НПДХМШ У ФЕН ЦЕ ЙНЕОЕН" - -#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile -msgid "Ambiguous additional compiler config file" -msgstr "оБКДЕО ДПРПМОЙФЕМШОЩК ЖБКМ ОБУФТПЕЛ ЛПНРЙМСФПТБ У ФЕН ЦЕ ЙНЕОЕН" - -#: lazarusidestrconsts:dlgambigfileact -msgid "Ambiguous file action:" -msgstr "оЕСУОПЕ ДЕКУФЧЙЕ У ЖБКМПН:" - -#: lazarusidestrconsts:lisambiguousfilefound -msgid "Ambiguous file found" -msgstr "оБКДЕОЩ ТБЪОЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete -msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" -msgstr "оБКДЕО ОЕРТБЧЙМШОЩК ЖБКМ: %s%s%s%sпО НПЦЕФ ВЩФШ РЕТЕРХФБО У %s%s%s%s%sхДБМЙФШ ЬФПФ ЖБКМ?" - -#: lazarusidestrconsts:lisambiguousfilesfound -msgid "Ambiguous files found" -msgstr "оБКДЕОЩ ТБЪОЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:lispkgmangambiguousunitsfound -msgid "Ambiguous units found" -msgstr "оБКДЕОЩ НПДХМЙ У ПДЙОБЛПЧП ПРПЪОБЧБЕНЩНЙ ЙНЕОБНЙ" - -#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro -msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" -msgstr "" - -#: lazarusidestrconsts:lisa2pancestortype -msgid "Ancestor Type" -msgstr "фЙР РТЕДЛБ" - -#: lazarusidestrconsts:lismakeresstrappendtosection -msgid "Append to section" -msgstr "дПВБЧЙФШ Л УЕЛГЙЙ" - -#: lazarusidestrconsts:dlgpoapplication -msgid "Application" -msgstr "рТЙМПЦЕОЙЕ" - -#: lazarusidestrconsts:dlgapplicationsettings -msgid "Application Settings" -msgstr "рБТБНЕФТЩ РТЙМПЦЕОЙС" - -#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra -msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "рТЙМПЦЕОЙЕ%sзТБЖЙЮЕУЛБС РТПЗТБННБ ОБ lcl/freepascal. рТПЗТБННОЩК ЖБКМ БЧФПНБФЙЮЕУЛЙ РПДДЕТЦЙЧБЕФУС lazarus." - -#: lazarusidestrconsts:dlgbutapply -msgid "Apply" -msgstr "рТЙНЕОЙФШ" - -#: lazarusidestrconsts:lispckeditapplychanges -msgid "Apply changes" -msgstr "рТЙНЕОЙФШ" - -#: lazarusidestrconsts:rslanguagearabic -msgid "Arabic" -msgstr "бТБВУЛЙК" - -#: lazarusidestrconsts:dlgcoasis -msgid "As-Is" -msgstr "лБЛ-ЕУФШ" - -#: lazarusidestrconsts:lissortselascending -msgid "Ascending" -msgstr "оБУМЕДХЕНЩК" - -#: lazarusidestrconsts:dlgenvask -msgid "Ask" -msgstr "уРТПУЙФШ" - -#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext -msgid "Ask before replacing each found text" -msgstr "уРТПУЙФШ РЕТЕД ЪБНЕОПК ЛБЦДПЗП ЖТБЗНЕОФБ" - -#: lazarusidestrconsts:liscodetoolsoptsat -msgid "At" -msgstr "At" - -#: lazarusidestrconsts:lispckoptsauthor -msgid "Author:" -msgstr "бЧФПТ:" - -#: lazarusidestrconsts:dlgautoform -msgid "Auto create form when opening unit" -msgstr "бЧФПУПЪДБОЙЕ ЖПТН РТЙ ПФЛТЩФЙЙ НПДХМС" - -#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly -msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." -msgstr "бЧФПУПЪДБЧБЕНЩЕ ЬМЕНЕОФЩ ОЕ НПЗХФ ОЙ ТЕДБЛФЙТПЧБФШУС,%s ОЙ УПДЕТЦБФШ ОЕБЧФПУПЪДБЧБЕНЩЕ ДПЮЕТОЙЕ ЬМЕНЕОФЩ" - -#: lazarusidestrconsts:dlgautodel -msgid "Auto delete file" -msgstr "бЧФПХДБМЕОЙЕ ЖБКМПЧ" - -#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited -msgid "Auto generated nodes can not be edited." -msgstr "бЧФПУПЪДБЧБЕНЩЕ ЬМЕНЕОФЩ ОЕ НПЗХФ ТЕДБЛФЙТПЧБФШУС." - -#: lazarusidestrconsts:dlgautoident -msgid "Auto indent" -msgstr "бЧФПЧЩДЕМЕОЙЕ" - -#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall -msgid "Auto rebuild when rebuilding all" -msgstr "рЕТЕУПВТБФШ РТЙ РЕТЕУВПТЛЕ ЧУЕИ" - -#: lazarusidestrconsts:dlgautoren -msgid "Auto rename file lowercase" -msgstr "бЧФПРЕТЕЙНЕОПЧБОЙЕ Ч ОЙЦОЙК ТЕЗЙУФТ" - -#: lazarusidestrconsts:dlgautosave -msgid "Auto save" -msgstr "бЧФПУПИТБОЕОЙЕ" - -#: lazarusidestrconsts:dlgautocreateforms -msgid "Auto-create forms:" -msgstr "бЧФПУПЪДБЧБЕНЩЕ ЖПТНЩ:" - -#: lazarusidestrconsts:lispckexplautocreated -msgid "AutoCreated" -msgstr "бЧФПУПЪДБО" - -#: lazarusidestrconsts:rslanguageautomatic -msgid "Automatic (or english)" -msgstr "бЧФПНБФЙЮЕУЛЙ (ЙМЙ БОЗМЙКУЛЙК)" - -#: lazarusidestrconsts:lisautomaticfeatures -msgid "Automatic features" -msgstr "" - -#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild -msgid "Automatically increment version on build" -msgstr "бЧФПНБФЙЮЕУЛЙ ХЧЕМЙЮЙФШ ЧЕТУЙА РТЙ УВПТЛЕ" - -#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages -msgid "Automatically installed packages" -msgstr "бЧФПХУФБОПЧМЕООЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded -msgid "Automatically rebuild as needed" -msgstr "бЧФПНБФЙЮЕУЛЙ РЕТЕУПВЙТБФШ РП ОЕПВИПДЙНПУФЙ" - -#: lazarusidestrconsts:dlgavailableforms -msgid "Available forms:" -msgstr "дПУФХРОЩЕ ЖПТНЩ:" - -#: lazarusidestrconsts:lisavailablepackages -msgid "Available packages" -msgstr "дПУФХРОЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:dlgedback -msgid "Back" -msgstr "оБЪБД" - -#: lazarusidestrconsts:fdmorderbackone -msgid "Back one" -msgstr "" - -#: lazarusidestrconsts:dlgbackcolor -msgid "Background" -msgstr "" - -#: lazarusidestrconsts:srvk_back -msgid "Backspace" -msgstr "ъБВПК" - -#: lazarusidestrconsts:dlgenvbckup -msgid "Backup" -msgstr "тЕЪЕТЧЙТПЧБОЙЕ" - -#: lazarusidestrconsts:lisbackupfilefailed -msgid "Backup file failed" -msgstr "тЕЪЕТЧЙТПЧБОЙЕ ОЕ ХДБМПУШ" - -#: lazarusidestrconsts:lisfrbackwardsearch -msgid "Backward search" -msgstr "пВТБФОЩК РПЙУЛ" - -#: lazarusidestrconsts:dlgbehindmethods -msgid "Behind methods" -msgstr "рПУМЕ НЕФПДПЧ" - -#: lazarusidestrconsts:lispkgfiletypebinary -msgid "Binary" -msgstr "дЧПЙЮОЩК" - -#: lazarusidestrconsts:liscodetoolsdefsblock -msgid "Block" -msgstr "вМПЛ" - -#: lazarusidestrconsts:dlgblockindent -msgid "Block indent" -msgstr "" - -#: lazarusidestrconsts:dlgedbold -msgid "Bold" -msgstr "цЙТОЩК" - -#: lazarusidestrconsts:uembookmarkn -msgid "Bookmark" -msgstr "ъБЛМБДЛБ" - -#: lazarusidestrconsts:lisbottomspaceequally -msgid "Bottom space equally" -msgstr "" - -#: lazarusidestrconsts:lisbottoms -msgid "Bottoms" -msgstr "" - -#: lazarusidestrconsts:dlgbrachighlight -msgid "Bracket highlighting" -msgstr "рПДУЧЕФЛБ УЛПВПЛ" - -#: lazarusidestrconsts:lismenubeaklinesinselection -msgid "Break Lines in selection" -msgstr "тБЪТЩЧ УФТПЛ Ч ЧЩДЕМЕООПН" - -#: lazarusidestrconsts:srkmeclinebreak -msgid "Break line and move cursor" -msgstr "тБЪПТЧБФШ УФТПЛХ, УДЧЙОХФШ ЛХТУПТ" - -#: lazarusidestrconsts:srkmecinsertline -msgid "Break line, leave cursor" -msgstr "тБЪПТЧБФШ УФТПЛХ, ПУФБЧЙФШ ЛХТУПТ" - -#: lazarusidestrconsts:lismenuviewbreakpoints -msgid "BreakPoints" -msgstr "фПЮЛЙ ПУФБОПЧБ" - -#: lazarusidestrconsts:lisa2pbrokendependencies -msgid "Broken Dependencies" -msgstr "оБТХЫЕООЩЕ ЪБЧЙУЙНПУФЙ" - -#: lazarusidestrconsts:lispkgmangbrokendependency -msgid "Broken dependency" -msgstr "оБТХЫЕООБС ЪБЧЙУЙНПУФШ" - -#: lazarusidestrconsts:lispatheditbrowse -msgid "Browse" -msgstr "пВЪПТ" - -#: lazarusidestrconsts:lisbrowseforcompiler -msgid "Browse for Compiler (%s)" -msgstr "пВЪПТ (РПЙУЛ ЛПНРЙМСФПТБ) (%s)" - -#: lazarusidestrconsts:dlgunitdepbrowse -msgid "Browse..." -msgstr "пВЪПТ..." - -#: lazarusidestrconsts:lismenubuild -msgid "Build" -msgstr "уВПТЛБ" - -#: lazarusidestrconsts:lisbuildcodetools -msgid "Build CodeTools" -msgstr "уПВТБФШ CodeTools" - -#: lazarusidestrconsts:lisbuildcomponent -msgid "Build Component" -msgstr "уПВТБФШ ЛПНРПОЕОФ" - -#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools -msgid "Build Components (SynEdit, CodeTools)" -msgstr "уПВТБФШ ЛПНРПОЕОФЩ (SynEdit, CodeTools)" - -#: lazarusidestrconsts:lisbuildexamples -msgid "Build Examples" -msgstr "уПВТБФШ РТЙНЕТЩ" - -#: lazarusidestrconsts:lismenubuildfile -msgid "Build File" -msgstr "уПВТБФШ ЖБКМ" - -#: lazarusidestrconsts:lisbuildide -msgid "Build IDE" -msgstr "уПВТБФШ IDE" - -#: lazarusidestrconsts:lisbuildideintf -msgid "Build IDE Interface" -msgstr "уПВТБФШ ЙОФЕТЖЕКУ IDE" - -#: lazarusidestrconsts:lisbuildjitform -msgid "Build JIT Form" -msgstr "уПВТБФШ JIT Form" - -#: lazarusidestrconsts:lislazbuildbuildjitform -msgid "Build JITForm" -msgstr "уПВТБФШ JITForm" - -#: lazarusidestrconsts:lisbuildlcl -msgid "Build LCL" -msgstr "уПВТБФШ LCL" - -#: lazarusidestrconsts:lismenubuildlazarus -msgid "Build Lazarus" -msgstr "уПВТБФШ Lazarus" - -#: lazarusidestrconsts:lisbuildnumber -msgid "Build Number" -msgstr "оПНЕТ УВПТЛЙ" - -#: lazarusidestrconsts:lisbuildpkgreg -msgid "Build Package Registration" -msgstr "ъБТЕЗЙУФТЙТПЧБФШ РБЛЕФ" - -#: lazarusidestrconsts:lisbuildstarter -msgid "Build Starter" -msgstr "уПВТБФШ ъБЗТХЪЮЙЛ" - -#: lazarusidestrconsts:lisbuildsynedit -msgid "Build SynEdit" -msgstr "уПВТБФШ SynEdit" - -#: lazarusidestrconsts:lismenubuildall -msgid "Build all" -msgstr "уПВТБФШ ЧУЕ" - -#: lazarusidestrconsts:srkmecbuildlazarus -msgid "Build lazarus" -msgstr "уПВТБФШ lazarus" - -#: lazarusidestrconsts:lisbuildnewproject -msgid "Build new project" -msgstr "уПВТБФШ ОПЧЩК РТПЕЛФ" - -#: lazarusidestrconsts:dlgcmacro -msgid "C Style Macros (global)" -msgstr "нБЛТПУЩ УФЙМС C (ЗМПВБМШОП)" - -#: lazarusidestrconsts:dlgcocops -msgid "C Style Operators (*=, +=, /= and -=)" -msgstr "пРЕТБФПТЩ УФЙМС C (*=, +=, /= and -=)" - -#: lazarusidestrconsts:dlgcppinline -msgid "C++ Styled INLINE" -msgstr "INLINE УФЙМС C++" - -#: lazarusidestrconsts:lismenuinsertcvskeyword -msgid "CVS keyword" -msgstr "лМАЮ CVS" - -#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit -msgid "Call %sRegister%s procedure of selected unit" -msgstr "чЩЪЧБФШ РТПГЕДХТХ %sRegister%s ЧЩВТБООПЗП НПДХМС" - -#: lazarusidestrconsts:lismenuviewcallstack -msgid "Call Stack" -msgstr "уФЕЛ ЧЩЪПЧПЧ" - -#: lazarusidestrconsts:liscocallon -msgid "Call on:" -msgstr "чЩЪПЧ:" - -#: lazarusidestrconsts:liscannotcopytoplevelcomponent -msgid "Can not copy top level component." -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЛПНРПОЕОФ ЧЕТИОЕЗП ХТПЧОС." - -#: lazarusidestrconsts:liscannotcreatefile -msgid "Can not create file %s%s%s" -msgstr "оЕ НПЗХ УПЪДБФШ ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit -msgid "Can not register components without unit" -msgstr "оЕ НПЗХ ЪБТЕЗЙУФТЙТПЧБФШ ЛПНРПОЕОФЩ ВЕЪ НПДХМС" - -#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents -msgid "Can only change the class of TComponents." -msgstr "" - -#: lazarusidestrconsts:dlgcancel -msgid "Cancel" -msgstr "пФНЕОБ" - -#: lazarusidestrconsts:liscancelloadingunit -msgid "Cancel loading unit" -msgstr "" - -#: lazarusidestrconsts:liscancelrenaming -msgid "Cancel renaming" -msgstr "" - -#: lazarusidestrconsts:lisaboutnocontributors -msgid "Cannot find contributors list." -msgstr "" - -#: lazarusidestrconsts:liscannotfindlazarusstarter -msgid "Cannot find lazarus starter:%s%s" -msgstr "оЕ НПЗХ ОБКФЙ РХУЛБФЕМШ lazarus:%s%s" - -#: lazarusidestrconsts:srvk_capital -msgid "Capital" -msgstr "ъБЗМБЧОЩК" - -#: lazarusidestrconsts:dlgcaretskipsselection -msgid "Caret skips selection" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgcaseinsensitive -msgid "Case Insensitive" -msgstr "оЕЮХЧУФЧЙФЕМШОЩК Л ТЕЗЙУФТХ" - -#: lazarusidestrconsts:dlgcasesensitive -msgid "Case Sensitive" -msgstr "у ХЮЕФПН ТЕЗЙУФТБ" - -#: lazarusidestrconsts:lisfindfilecasesensitive -msgid "Case sensitive" -msgstr "у ХЮЈФПН ТЕЗЙУФТБ" - -#: lazarusidestrconsts:rslanguagecatalan -msgid "Catalan" -msgstr "лБФБМБОУЛЙК" - -#: lazarusidestrconsts:dlgcentercursorline -msgid "Center Cursor Line" -msgstr "лХТУПТ Ч ГЕОФТЕ" - -#: lazarusidestrconsts:liscenterinwindow -msgid "Center in window" -msgstr "гЕОФТ ПЛОБ" - -#: lazarusidestrconsts:liscenters -msgid "Centers" -msgstr "гЕОФТЩ" - -#: lazarusidestrconsts:liscodetemplchange -msgid "Change" -msgstr "йЪНЕОЙФШ" - -#: lazarusidestrconsts:lischangeclass -msgid "Change Class" -msgstr "йЪНЕОЙФШ ЛМБУУ" - -#: lazarusidestrconsts:lismenuinsertchangelogentry -msgid "ChangeLog entry" -msgstr "ьМЕНЕОФ ChangeLog" - -#: lazarusidestrconsts:lisdiskdiffchangedfiles -msgid "Changed files:" -msgstr "йЪНЕОЈООЩЕ ЖБКМЩ:" - -#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies -msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "йЪНЕОЕОЙЕ ЙНЕОЙ РБЛЕФБ ЙМЙ ЧЕТУЙЙ ОБТХЫЙФ ЪБЧЙУЙНПУФЙ. йЪНЕОЙФШ МЙ ЬФЙ ЪБЧЙУЙНПУФЙ?%sчЩВЕТЙФЕ дБ ДМС ЪБНЕОЩ ЧУЕИ РЕТЕЮЙУМЕООЩИ ЪБЧЙУЙНПУФЕК.%sрТПРХУЛ - ДМС ТБЪТЩЧБ ЪБЧЙУЙНПУФЕК Й РТПДПМЦЕОЙС." - -#: lazarusidestrconsts:srkmecchar -msgid "Char" -msgstr "уЙНЧПМ" - -#: lazarusidestrconsts:lischaractermap -msgid "Character Map" -msgstr "фБВМЙГБ УЙНЧПМПЧ" - -#: lazarusidestrconsts:lismenuchecklfm -msgid "Check LFM file in editor" -msgstr "рТПЧЕТЙФШ ЖБКМ LFM Ч ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:lischeckchangesondiskwithloading -msgid "Check changes on disk with loading" -msgstr "" - -#: lazarusidestrconsts:dlgcheckconsistency -msgid "Check consistency" -msgstr "гЕМПУФОПУФШ?" - -#: lazarusidestrconsts:dlgcochecks -msgid "Checks:" -msgstr "рТПЧЕТЛБ:" - -#: lazarusidestrconsts:lischoosedelphiproject -msgid "Choose Delphi project (*.dpr)" -msgstr "чЩВЕТЙФЕ РТПЕЛФ Delphi (*.dpr)" - -#: lazarusidestrconsts:lischoosedelphiunit -msgid "Choose Delphi unit (*.pas)" -msgstr "чЩВЕТЙФЕ НПДХМШ Delphi (*.pas)" - -#: lazarusidestrconsts:lisctdefchoosedirectory -msgid "Choose Directory" -msgstr "чЩВЕТЙФЕ ЛБФБМПЗ" - -#: lazarusidestrconsts:lischoosefpcsourcedir -msgid "Choose FPC source directory" -msgstr "чЩВЕТЙФЕ ЛБФБМПЗ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:lischooselazarussourcedirectory -msgid "Choose Lazarus Directory" -msgstr "чЩВЕТЙФЕ ЛБФБМПЗ Lazarus" - -#: lazarusidestrconsts:lisedoptschoosescheme -msgid "Choose Scheme" -msgstr "чЩВТБФШ УИЕНХ" - -#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty -msgid "Choose a base class for the favourite property %s%s%s." -msgstr "" - -#: lazarusidestrconsts:lischooseadifferentname -msgid "Choose a different name" -msgstr "чЩВЕТЙФЕ ДТХЗПЕ ЙНС" - -#: lazarusidestrconsts:dlgchscodetempl -msgid "Choose code template file (*.dci)" -msgstr "чЩВЕТЙФЕ ЖБКМ ЫБВМПОПЧ ЛПДБ (*.dci)" - -#: lazarusidestrconsts:lischoosecompilerpath -msgid "Choose compiler filename (%s)" -msgstr "чЩВЕТЙФЕ ЙНС ЛПНРЙМСФПТБ (%s)" - -#: lazarusidestrconsts:lischoosedebuggerpath -msgid "Choose debugger filename" -msgstr "чЩВЕТЙФЕ ЙНС ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lischoosedirectory -msgid "Choose directory" -msgstr "чЩВПТ ЛБФБМПЗБ" - -#: lazarusidestrconsts:lischoosemakepath -msgid "Choose make path" -msgstr "чЩВЕТЙФЕ РХФШ make" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile -msgid "Choose one of these items to create a new File" -msgstr "" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage -msgid "Choose one of these items to create a new Package" -msgstr "" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject -msgid "Choose one of these items to create a new Project" -msgstr "" - -#: lazarusidestrconsts:lischooseprogramsourcepppaslpr -msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "чЩВЕТЙФЕ ЙУИПДОЙЛ РТПЗТБННЩ (*.pp,*.pas,*.lpr)" - -#: lazarusidestrconsts:lischoosestructuretoencloseselection -msgid "Choose structure to enclose selection" -msgstr "чЩВЕТЙФЕ УФТХЛФХТХ ДМС ЪБЛМАЮЕОЙС Ч ОЕЈ ЧЩДЕМЕОЙС" - -#: lazarusidestrconsts:lischoosetestbuilddir -msgid "Choose the directory for tests" -msgstr "чЩВЕТЙФЕ ЛБФБМПЗ ДМС РТПВ" - -#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies -msgid "Circle in package dependencies" -msgstr "гЙЛМЙЮЕУЛБС ЪБЧЙУЙНПУФШ РБЛЕФПЧ" - -#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste -msgid "Class %s%s%s is not a registered component class.%sUnable to paste." -msgstr "лМБУУ %s%s%s - ОЕ ЪБТЕЗЙУФТЙТПЧБООЩК ЛМБУУ ЛПНРПОЕОФБ.%sоЕ НПЗХ ЧУФБЧЙФШ." - -#: lazarusidestrconsts:lisoifclassnotfound -msgid "Class %s%s%s not found." -msgstr "" - -#: lazarusidestrconsts:lisa2pclassnamealreadyexists -msgid "Class Name already exists" -msgstr "йНС ЛМБУУБ ХЦЕ УХЭЕУФЧХЕФ" - -#: lazarusidestrconsts:lisclassnotfound -msgid "Class not found" -msgstr "лМБУУ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:dlgcdtclassorder -msgid "Class order" -msgstr "ч РПТСДЛЕ ЛМБУУПЧ" - -#: lazarusidestrconsts:dlgclassinsertpolicy -msgid "Class part insert policy" -msgstr "рПМЙФЙЛБ ЧУФБЧЛЙ ЮБУФЕК ЛМБУУБ" - -#: lazarusidestrconsts:liscldircleandirectory -msgid "Clean Directory" -msgstr "пЮЙУФЙФШ ЛБФБМПЗ" - -#: lazarusidestrconsts:liscleanlazarussource -msgid "Clean Lazarus Source" -msgstr "пЮЙУФЙФШ ЙУИПДОЙЛЙ Lazarus" - -#: lazarusidestrconsts:lislazbuildcleanall -msgid "Clean all" -msgstr "пЮЙУФЙФШ ЧУЈ" - -#: lazarusidestrconsts:lismenucleandirectory -msgid "Clean directory" -msgstr "пЮЙУФЙФШ ЛБФБМПЗ" - -#: lazarusidestrconsts:liscldircleansubdirectories -msgid "Clean sub directories" -msgstr "пЮЙУФЙФШ РПДЛБФБМПЗЙ" - -#: lazarusidestrconsts:liscleanupunitpath -msgid "Clean up unit path?" -msgstr "" - -#: lazarusidestrconsts:lislazbuildcleanbuild -msgid "Clean+Build" -msgstr "пЮЙУФЙФШ+уПВТБФШ" - -#: lazarusidestrconsts:srvk_clear -msgid "Clear" -msgstr "пЮЙУФЙФШ" - -#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff -msgid "Click on one of the above items to see the diff" -msgstr "чЩВЕТЙФЕ ПДЙО ЙЪ ЬМЕНЕОФПЧ ЧЩЫЕ, ЮФПВЩ ХЧЙДЕФШ ТБЪОЙГХ" - -#: lazarusidestrconsts:lismenuclose -msgid "Close" -msgstr "ъБЛТЩФШ" - -#: lazarusidestrconsts:srkmeccloseall -msgid "Close all" -msgstr "ъБЛТЩФШ ЧУЕ" - -#: lazarusidestrconsts:lismenucloseall -msgid "Close all editor files" -msgstr "ъБЛТЩФШ ЧУЕ ЖБКМЩ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:dlgcodegeneration -msgid "Code" -msgstr "лПД" - -#: lazarusidestrconsts:dlgcodecreation -msgid "Code Creation" -msgstr "уПЪДБОЙЕ ЛПДБ" - -#: lazarusidestrconsts:lismenuviewcodeexplorer -msgid "Code Explorer" -msgstr "пВПЪТЕЧБФЕМШ ЛПДБ" - -#: lazarusidestrconsts:lismenueditcodetemplates -msgid "Code Templates" -msgstr "" - -#: lazarusidestrconsts:dlgcodetoolstab -msgid "Code Tools" -msgstr "CodeTools" - -#: lazarusidestrconsts:dlgusecodefolding -msgid "Code folding (experimental)" -msgstr "" - -#: lazarusidestrconsts:dlgedcodeparams -msgid "Code parameters" -msgstr "рБТБНЕФТЩ ЛПДБ" - -#: lazarusidestrconsts:srkmecautocompletion -msgid "Code template completion" -msgstr "ъБЧЕТЫЕОЙЕ ЫБВМПОПЧ ЛПДБ" - -#: lazarusidestrconsts:dlgedcodetempl -msgid "Code templates" -msgstr "ыБВМПОЩ ЛПДБ" - -#: lazarusidestrconsts:lisceocodeexplorer -msgid "CodeExplorer Options" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor -msgid "CodeTools Defines Editor" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview -msgid "CodeTools Defines Preview" -msgstr "рТПУНПФТ ОБУФТПЕЛ CodeTools" - -#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues -msgid "CodeTools Directory Values" -msgstr "рБТБНЕФТЩ ЛБФБМПЗПЧ CodeTools" - -#: lazarusidestrconsts:dlgcodetoolsopts -msgid "CodeTools Options" -msgstr "оБУФТПКЛЙ CodeTools" - -#: lazarusidestrconsts:srkmcatcodetools -msgid "CodeTools commands" -msgstr "лПНБОДЩ CodeTools" - -#: lazarusidestrconsts:lismenucodetoolsdefineseditor -msgid "CodeTools defines editor" -msgstr "оБУФТПКЛЙ ТЕДБЛФПТБ CodeTools" - -#: lazarusidestrconsts:lismenucodetoolsoptions -msgid "CodeTools options" -msgstr "оБУФТПКЛЙ CodeTools" - -#: lazarusidestrconsts:srkmeccodetoolsdefinesed -msgid "Codetools defines editor" -msgstr "" - -#: lazarusidestrconsts:srkmeccodetoolsoptions -msgid "Codetools options" -msgstr "оБУФТПКЛЙ Codetools" - -#: lazarusidestrconsts:lismenucollectpofil -msgid "Collect .po files" -msgstr "уПВТБФШ ЖБКМЩ .po" - -#: lazarusidestrconsts:liscodetoolsoptscolon -msgid "Colon" -msgstr "лПМПОЛБ" - -#: lazarusidestrconsts:dlgedcolor -msgid "Color" -msgstr "гЧЕФ" - -#: lazarusidestrconsts:dlgclrscheme -msgid "Color Scheme:" -msgstr "гЧЕФПЧБС УИЕНБ:" - -#: lazarusidestrconsts:dlgenvcolors -msgid "Colors" -msgstr "гЧЕФБ" - -#: lazarusidestrconsts:srkmeccolumnselect -msgid "Column selection mode" -msgstr "тЕЦЙН ЧЩВПТБ ЛПМПОЛЙ" - -#: lazarusidestrconsts:liscodetoolsoptscomma -msgid "Comma" -msgstr "ъБРСФБС" - -#: lazarusidestrconsts:srkmcommand -msgid "Command " -msgstr "лПНБОДБ" - -#: lazarusidestrconsts:liscommandafter -msgid "Command after" -msgstr "" - -#: lazarusidestrconsts:liscommandafterinvalid -msgid "Command after invalid" -msgstr "лПНБОДБ \"РПУМЕ\" ОЕЛПТТЕЛФОБ" - -#: lazarusidestrconsts:liscommandafterpublishingmodule -msgid "Command after publishing module" -msgstr "лПНБОДБ РПУМЕ ХУФБОПЧЛЙ НПДХМС" - -#: lazarusidestrconsts:srkmcatcmdcmd -msgid "Command commands" -msgstr "лПНБОДБ ЛПНБОДЩ" - -#: lazarusidestrconsts:dlgcommandlineparams -msgid "Command line parameters (without application name)" -msgstr "рБТБНЕФТЩ ЛПНБОДОПК УФТПЛЙ (ВЕЪ ЙНЕОЙ РТЙМПЦЕОЙС)" - -#: lazarusidestrconsts:liscommandlineparamsofprogram -msgid "Command line parameters of program" -msgstr "рБТБНЕФТЩ ЛПНБОДОПК УФТПЛЙ РТПЗТБННЩ" - -#: lazarusidestrconsts:liscocommand -msgid "Command:" -msgstr "лПНБОДБ:" - -#: lazarusidestrconsts:lismenucommentselection -msgid "Comment selection" -msgstr "ъБЛПННЕОФЙТПЧБФШ" - -#: lazarusidestrconsts:liscodetemplcomment -msgid "Comment:" -msgstr "лПННЕОФБТЙК:" - -#: lazarusidestrconsts:dlgcocompilation -msgid "Compilation" -msgstr "лПНРЙМСГЙС" - -#: lazarusidestrconsts:liscocalloncompile -msgid "Compile" -msgstr "лПНРЙМЙТПЧБФШ" - -#: lazarusidestrconsts:liscompileidewithoutlinking -msgid "Compile IDE (without linking)" -msgstr "лПНРЙМСГЙС IDE (ВЕЪ УВПТЛЙ)" - -#: lazarusidestrconsts:lispckeditcompileeverything -msgid "Compile everything?" -msgstr "уПВТБФШ ЧУЈ?" - -#: lazarusidestrconsts:lispckeditcompilepackage -msgid "Compile package" -msgstr "уПВТБФШ РБЛЕФ" - -#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition -msgid "CompiledSrcPath addition" -msgstr "ДПВБЧМЕОЙЕ CompiledSrcPath" - -#: lazarusidestrconsts:liscompiler -msgid "Compiler" -msgstr "лПНРЙМСФПТ" - -#: lazarusidestrconsts:dlgcompileroptions -msgid "Compiler Options" -msgstr "пРГЙЙ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:lispckeditcompileroptionsforpackage -msgid "Compiler Options for Package %s" -msgstr "рБТБНЕФТЩ ЛПНРЙМСФПТБ ДМС РБЛЕФБ %s" - -#: lazarusidestrconsts:liscompileroptionsforproject -msgid "Compiler Options for Project: %s" -msgstr "рБТБНЕФТЩ ЛПНРЙМСФПТБ ДМС РТПЕЛФБ: %s" - -#: lazarusidestrconsts:lismenucompileroptions -msgid "Compiler Options..." -msgstr "рБТБНЕФТЩ ЛПНРЙМСФПТБ..." - -#: lazarusidestrconsts:liscompilererror -msgid "Compiler error" -msgstr "пЫЙВЛБ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:liscompilerfilename -msgid "Compiler filename" -msgstr "йНС ЖБКМБ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:dlgfpcpath -msgid "Compiler path (%s)" -msgstr "рХФШ ЛПНРЙМСФПТБ (%s)" - -#: lazarusidestrconsts:lismenucompletecode -msgid "Complete Code" -msgstr "ъБЧЕТЫЙФШ ЛПД" - -#: lazarusidestrconsts:srkmeccompletecode -msgid "Complete code" -msgstr "ъБЧЕТЫЙФШ ЛПД" - -#: lazarusidestrconsts:dlgcompleteproperties -msgid "Complete properties" -msgstr "ъБЧЕТЫБФШ УЧПКУФЧБ" - -#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined -msgid "Component Class %s%s%s already defined" -msgstr "лМБУУ ЛПНРПОЕОФБ %s%s%s ХЦЕ ПРТЕДЕМЈО" - -#: lazarusidestrconsts:liscomponentnameiskeyword -msgid "Component name %s%s%s is keyword" -msgstr "йНС ЛПНРПОЕОФБ %s%s%s ЪБТЕЪЕТЧЙТПЧБОП" - -#: lazarusidestrconsts:liscomponentnameisnotavalididentifier -msgid "Component name %s%s%s is not a valid identifier" -msgstr "йНС ЛПНРПОЕОФБ %s%s%s - ОЕЛПТТЕЛФОЩК ЙДЕОФЙЖЙЛБФПТ" - -#: lazarusidestrconsts:srkmcatcomponentsmenu -msgid "Components menu commands" -msgstr "лПНБОДЩ ЛПНРПОЕОФПЧ НЕОА" - -#: lazarusidestrconsts:dlgconfigfiles -msgid "Config Files:" -msgstr "жБКМЩ ОБУФТПЕЛ:" - -#: lazarusidestrconsts:lisconfigurebuildlazarus -msgid "Configure %sBuild Lazarus%s" -msgstr "оБУФТПЙФШ %sуПВТБФШ Lazarus%s" - -#: lazarusidestrconsts:lismenuconfigbuildfile -msgid "Configure Build+Run File" -msgstr "оБУФТПЙФШ уПВТБФШ+ъБРХУФЙФШ жБКМ" - -#: lazarusidestrconsts:lismenuconfigurehelp -msgid "Configure Help" -msgstr "оБУФТПЙФШ уРТБЧЛХ" - -#: lazarusidestrconsts:lismenuconfigurebuildlazarus -msgid "Configure \"Build Lazarus\"" -msgstr "оБУФТПЙФШ \"уПВТБФШ Lazarus\"" - -#: lazarusidestrconsts:lismenuconfigcustomcomps -msgid "Configure custom components" -msgstr "оБУФТПЙФШ ЛПНРПОЕОФЩ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:lismenusettings -msgid "Configure custom tools ..." -msgstr "оБУФТПЙФШ ЙОУФТХНЕОФЩ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:lismenueditinstallpkgs -msgid "Configure installed packages" -msgstr "оБУФТПЙФШ ХУФБОПЧМЕООЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lislazbuildconfirmbuild -msgid "Confirm Before ReBuild Lazarus" -msgstr "" - -#: lazarusidestrconsts:lisconfirmchanges -msgid "Confirm changes" -msgstr "рПДФЧЕТДЙФШ ЙЪНЕОЕОЙС" - -#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency -msgid "Confirm deleting dependency" -msgstr "рПДФЧЕТДЙФЕ ХДБМЕОЙЕ ЪБЧЙУЙНПУФЙ" - -#: lazarusidestrconsts:lisprojinspconfirmremovingfile -msgid "Confirm removing file" -msgstr "рПДФЧЕТДЙФЕ ХДБМЕОЙЕ ЖБКМБ" - -#: lazarusidestrconsts:srkmconflic -msgid "Conflict " -msgstr "лПОЖМЙЛФ " - -#: lazarusidestrconsts:dlginitdoneonly -msgid "Constructor name must be 'init' (destructor must be 'done')" -msgstr "лПОУФТХЛФПТ ДПМЦЕО ВЩФШ 'init' (ДЕУФТХЛФПТ - 'done')" - -#: lazarusidestrconsts:lismenutemplatecontents -msgid "Contents" -msgstr "уПДЕТЦБОЙЕ" - -#: lazarusidestrconsts:lismenucontexthelp -msgid "Context sensitive Help" -msgstr "уРТБЧЛБ, ЪБЧЙУЙНБС ПФ ЛПОФЕЛУФБ" - -#: lazarusidestrconsts:liscontinue -msgid "Continue" -msgstr "" - -#: lazarusidestrconsts:liscontinuewithoutloadingform -msgid "Continue without loading form" -msgstr "" - -#: lazarusidestrconsts:liscontributors -msgid "Contributors" -msgstr "" - -#: lazarusidestrconsts:srvk_control -msgid "Control" -msgstr "ьМЕНЕОФ ХРТБЧМЕОЙС" - -#: lazarusidestrconsts:liscontrolneedsparent -msgid "Control needs parent" -msgstr "ьМЕНЕОФ ХРТБЧМЕОЙС ФТЕВХЕФ \"ТПДЙФЕМС\"" - -#: lazarusidestrconsts:lismakeresstrconversionoptions -msgid "Conversion Options" -msgstr "оБУФТПКЛЙ РТЕПВТБЪПЧБОЙК" - -#: lazarusidestrconsts:lisconversionerror -msgid "Conversion error" -msgstr "пЫЙВЛБ РТЕПВТБЪПЧБОЙС" - -#: lazarusidestrconsts:srvk_convert -msgid "Convert" -msgstr "рТЕПВТБЪПЧБФШ" - -#: lazarusidestrconsts:lismenuconvertdfmtolfm -msgid "Convert DFM file to LFM" -msgstr "рТЕПВТБЪПЧБФШ DFM Ч LFM" - -#: lazarusidestrconsts:lismenuconvertdelphiproject -msgid "Convert Delphi Project to Lazarus Project" -msgstr "рТЕПВТБЪПЧБФШ РТПЕЛФ Delphi Ч РТПЕЛФ Lazarus" - -#: lazarusidestrconsts:lismenuconvertdelphiunit -msgid "Convert Delphi unit to Lazarus unit" -msgstr "рТЕПВТБЪПЧБФШ НПДХМШ Delphi Ч Lazarus" - -#: lazarusidestrconsts:liscodetoolsdefsconvertnode -msgid "Convert node" -msgstr "рТЕПВТБЪПЧБФШ ЬМЕНЕОФ" - -#: lazarusidestrconsts:srkmecselectiontabs2spaces -msgid "Convert tabs to spaces in selection" -msgstr "рТЕПВТБЪПЧБФШ фбв Ч РТПВЕМЩ Ч ЧЩДЕМЕООПН" - -#: lazarusidestrconsts:lismenucopy -msgid "Copy" -msgstr "лПРЙТПЧБФШ" - -#: lazarusidestrconsts:liscopyerror -msgid "Copy Error" -msgstr "пЫЙВЛБ ЛПРЙТПЧБОЙС" - -#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard -msgid "Copy all and hidden messages to clipboard" -msgstr "" - -#: lazarusidestrconsts:liscopyallmessagestoclipboard -msgid "Copy all messages to clipboard" -msgstr "уЛПРЙТПЧБФШ ЧУЕ УППВЭЕОЙС Ч ВХЖЕТ" - -#: lazarusidestrconsts:liscopyerror2 -msgid "Copy error" -msgstr "пЫЙВЛБ ЛПРЙТПЧБОЙС" - -#: lazarusidestrconsts:lisdsgcopycomponents -msgid "Copy selected components to clipboard" -msgstr "уЛПРЙТПЧБФШ ЧЩВТБООЩЕ ЛПНРПОЕОФЩ Ч ВХЖЕТ" - -#: lazarusidestrconsts:liscopyselectedmessagestoclipboard -msgid "Copy selected messages to clipboard" -msgstr "" - -#: lazarusidestrconsts:srkmeccopy -msgid "Copy selection to clipboard" -msgstr "лПРЙТПЧБФШ ЧЩДЕМЕОЙЕ Ч ВХЖЕТ" - -#: lazarusidestrconsts:dlgcopywordatcursoroncopynone -msgid "Copy word on copy none" -msgstr "уМПЧП РТЙ РХУФПН ЛПРЙТПЧБОЙЙ" - -#: lazarusidestrconsts:liscopyingawholeformisnotimplemented -msgid "Copying a whole form is not implemented." -msgstr "лПРЙТПЧБОЙЕ ЧУЕК ЖПТНЩ ОЕ ТЕБМЙЪПЧБОП." - -#: lazarusidestrconsts:lisgplnotice -msgid "Copyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" - -#: lazarusidestrconsts:lislgplnotice -msgid "Copyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "бЧФПТУЛПЕ РТБЧП (у) <ЗПД> <ЙНС БЧФПТБ>%sьФБ ВЙВМЙПФЕЛБ - ВЕУРМБФОПЕ рп; чЩ НПЦЕФЕ ТБУРТПУФТБОСФШ ЕЈ Й/ЙМЙ ЙЪНЕОСФШ РП ХУМПЧЙСН GNU Library General Public License ЛБЛ ПРХВМЙЛПЧБОП Free Software Foundation; ЙМЙ ЧЕТУЙЙ 2 мЙГЕОЪЙЙ, ЙМЙ (ОБ чБЫ ЧЩВПТ) МАВПК РПЪДОЕК ЧЕТУЙЙ. %sьФБ РТПЗТБННБ ТБУРТПУФТБОСЕФУС У ОБДЕЦДПК ВЩФШ РПМЕЪОПК, ОП веъп чуслпк збтбофйй; ДБЦЕ ВЕЪ РПДТБЪХНЕЧБЕНПК фптзпчпк ЗБТБОФЙЙ ЙМЙ уппфчефуфчйс пртедеміоопк гемй. уН. GNU Library General Public License ДМС ДБМШОЕКЫЕК ЙОЖПТНБГЙЙ. %sчЩ ДПМЦОЩ ВЩМЙ РПМХЮЙФШ ЛПРЙА GNU Library General Public License У ЬФПК ВЙВМЙПФЕЛПК; ЕУМЙ ОЕФ, РЙЫЙФЕ Ч Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, уыб." - -#: lazarusidestrconsts:dlgsmbcounter -msgid "Counter (.pp;1)" -msgstr "уЮЕФЮЙЛ (.pp;1)" - -#: lazarusidestrconsts:lisnpcreate -msgid "Create" -msgstr "уПЪДБФШ" - -#: lazarusidestrconsts:lismenucreatepofile -msgid "Create .po files" -msgstr "уПЪДБФШ ЖБКМЩ .po" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory -msgid "Create Defines for %s Directory" -msgstr "уПЪДБФШ ОБУФТПКЛЙ ДМС %s лБФБМПЗБ" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject -msgid "Create Defines for %s Project" -msgstr "уПЪДБФШ ОБУФТПКЛЙ ДМС %s рТПЕЛФБ" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler -msgid "Create Defines for Free Pascal Compiler" -msgstr "уПЪДБФШ ОБУФТПКЛЙ ДМС ЛПНРЙМСФПТБ FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources -msgid "Create Defines for Free Pascal SVN Sources" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir -msgid "Create Defines for Lazarus Directory" -msgstr "уПЪДБФШ ОБУФТПКЛЙ ДМС ЛБФБМПЗБ Lazarus" - -#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory -msgid "Create FPC Macros and paths for a fpc project directory" -msgstr "уПЪДБФШ НБЛТПУЩ FPC Й РХФЙ Л ЛБФБМПЗХ РТПЕЛФБ FPC" - -#: lazarusidestrconsts:lispckeditcreatemakefile -msgid "Create Makefile" -msgstr "" - -#: lazarusidestrconsts:lismenueditorcreatesubmenu -msgid "Create Submenu" -msgstr "уПЪДБФШ РПДНЕОА" - -#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained -msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "уПЪДБФШ ОПЧПЕ РТЙМПЦЕОЙЕ cgi.%sжБКМ РТПЗТБННЩ РПДДЕТЦЙЧБЕФУС Lazarus" - -#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype -msgid "Create a new editor file.%sChoose a type." -msgstr "уПЪДБФШ ОПЧЩК ЖБКМ ТЕДБЛФПТБ.%s чЩВЕТЙФЕ ФЙР." - -#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile -msgid "Create a new empty text file." -msgstr "уПЪДБФШ ОПЧЩК РХУФПК ФЕЛУФПЧЩК ЖБКМ." - -#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication -msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "уПЪДБФШ ОПЧПЕ ЗТБЖЙЮЕУЛПЕ РТЙМПЦЕОЙЕ.%sьФБ РТПЗТБННБ РПДДЕТЦЙЧБЕФУС Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "уПЪДБФШ НПДХМШ РБУЛБМС." - -#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram -msgid "Create a new program." -msgstr "уПЪДБФШ РТПЗТБННХ." - -#: lazarusidestrconsts:lisnewdlgcreateanewprogram -msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "уПЪДБФШ РТПЗТБННХ.%sжБКМ РТПЗТБННЩ РПДДЕТЦЙЧБЕФУС Lazarus." - -#: lazarusidestrconsts:lisnpcreateanewproject -msgid "Create a new project" -msgstr "уПЪДБФШ ОПЧЩК РТПЕЛФ" - -#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype -msgid "Create a new project.%sChoose a type." -msgstr "уПЪДБФШ РТПЕЛФ.%sчЩВЕТЙФЕ ФЙР." - -#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun -msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "уПЪДБФШ УФБОДБТФОЩК РБЛЕФ%sрБЛЕФ - ЬФП ОБВПТ НПДХМЕК Й ЛПНРПОЕОФПЧ." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform -msgid "Create a new unit with a LCL form." -msgstr "уПЪДБФШ НПДХМШ У ЖПТНПК LCL." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule -msgid "Create a new unit with a datamodule." -msgstr "уПЪДБФШ НПДХМШ У НПДХМЕН ДБООЩИ." - -#: lazarusidestrconsts:liscreateaprojectfirst -msgid "Create a project first!" -msgstr "уПЪДБКФЕ УРЕТЧБ РТПЕЛФ!" - -#: lazarusidestrconsts:lisa2pcreatenewfile -msgid "Create new file" -msgstr "" - -#: lazarusidestrconsts:dlgruberbandcreationcolor -msgid "Creation" -msgstr "уПЪДБОЙЕ" - -#: lazarusidestrconsts:lisedtexttoolctrl -msgid "Ctrl" -msgstr "Ctrl" - -#: lazarusidestrconsts:lisedtdefcurrentproject -msgid "Current Project" -msgstr "фЕЛХЭЙК РТПЕЛФ" - -#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory -msgid "Current Project Directory" -msgstr "лБФБМПЗ ФЕЛХЭЕЗП РТПЕЛФБ" - -#: lazarusidestrconsts:lismenuinsertdatetime -msgid "Current date and time" -msgstr "фЕЛХЭЙЕ ДБФБ Й ЧТЕНС" - -#: lazarusidestrconsts:lismenuinsertusername -msgid "Current username" -msgstr "фЕЛХЭЕЕ ЙНС РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:dlgcursorbeyondeol -msgid "Cursor beyond EOL" -msgstr "лХТУПТ ЧОЕ ЛПОГБ УФТПЛЙ" - -#: lazarusidestrconsts:liscursorcolumnincurrenteditor -msgid "Cursor column in current editor" -msgstr "лПМПОЛБ ЛХТУПТБ Ч ЬФПН ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:srkmcatcursormoving -msgid "Cursor moving commands" -msgstr "лПНБОДЩ РЕТЕНЕЭЕОЙС ЛХТУПТБ" - -#: lazarusidestrconsts:liscursorrowincurrenteditor -msgid "Cursor row in current editor" -msgstr "тСД ЛХТУПТБ Ч ЬФПН ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:lispckoptscustom -msgid "Custom" -msgstr "рПМШЪПЧБФЕМШУЛЙК" - -#: lazarusidestrconsts:lismakeresstrcustomidentifier -msgid "Custom Identifier" -msgstr "рПМШЪПЧБФЕМШУЛЙК ID" - -#: lazarusidestrconsts:liscustomprogram -msgid "Custom Program" -msgstr "рТПЗТБННБ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:liscustomprogramafreepascalprogram -msgid "Custom Program%sA freepascal program." -msgstr "рТПЗТБННБ РПМШЪПЧБФЕМС%sрТПЗТБННБ ОБ СЪЩЛЕ FreePascal" - -#: lazarusidestrconsts:liskeycatcustom -msgid "Custom commands" -msgstr "лПНБОДЩ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:liscustomoptions2 -msgid "Custom options" -msgstr "рБТБНЕФТЩ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:rsiwpcustomposition -msgid "Custom position" -msgstr "рПМШЪПЧБФЕМШУЛБС РПЪЙГЙС" - -#: lazarusidestrconsts:srkmeccustomtool -msgid "Custom tool %d" -msgstr "йОУФТХНЕОФ РПМШЪПЧБФЕМС %d" - -#: lazarusidestrconsts:lismenucut -msgid "Cut" -msgstr "чЩТЕЪБФШ" - -#: lazarusidestrconsts:lisdsgcutcomponents -msgid "Cut selected components to clipboard" -msgstr "чЩТЕЪБФШ ЧЩВТБООЩЕ ЛПНРПОЕОФЩ Ч ВХЖЕТ" - -#: lazarusidestrconsts:srkmeccut -msgid "Cut selection to clipboard" -msgstr "чЩТЕЪБФШ ЧЩДЕМЕОЙЕ Ч ВХЖЕТ" - -#: lazarusidestrconsts:lishlpoptsdatabases -msgid "Databases" -msgstr "вБЪЩ ДБООЩИ" - -#: lazarusidestrconsts:lisdate -msgid "Date" -msgstr "дБФБ" - -#: lazarusidestrconsts:uemdebugword -msgid "Debug" -msgstr "пФМБДЛБ" - -#: lazarusidestrconsts:lismenuviewdebugoutput -msgid "Debug output" -msgstr "чЩЧПД ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lismenudebugwindows -msgid "Debug windows" -msgstr "пЛОП ПФМБДЛЙ..." - -#: lazarusidestrconsts:lismendebuggeroptions -msgid "Debugger Options" -msgstr "рБТБНЕФТЩ ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lisdebuggererror -msgid "Debugger error" -msgstr "пЫЙВЛБ ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate -msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "пЫЙВЛБ ПФМБДЮЙЛБ%sпР, ПФМБДЮЙЛ ОБИПДЙФУС Ч ОЕТБВПЮЕН УПУФПСОЙЙ%sуПИТБОЙФЕ ТБВПФХ!%sоБЦНЙФЕ уФПР Й ОБДЕКФЕУШ ОБ МХЮЫЕЕ!" - -#: lazarusidestrconsts:lisdebuggerinvalid -msgid "Debugger invalid" -msgstr "оЕРТБЧЙМШОЩК ПФМБДЮЙЛ" - -#: lazarusidestrconsts:dlgcodebugpath -msgid "Debugger path addition (none):" -msgstr "дПРПМОЕОЙС Л РХФСН ПФМБДЮЙЛБ (ОЕФ):" - -#: lazarusidestrconsts:dlgdebugtype -msgid "Debugger type and path" -msgstr "фЙР ПФМБДЮЙЛБ Й РХФШ" - -#: lazarusidestrconsts:dlgcodebugging -msgid "Debugging:" -msgstr "пФМБДЛБ:" - -#: lazarusidestrconsts:rsiwpdefault -msgid "Default" -msgstr "рП ХНПМЮБОЙА" - -#: lazarusidestrconsts:dlgdefaulteditorfont -msgid "Default editor font" -msgstr "ыТЙЖФ ТЕДБЛФПТБ РП ХНПМЮБОЙА" - -#: lazarusidestrconsts:dlgpasext -msgid "Default pascal extension" -msgstr "уФБОДБТФОПЕ ТБУЫЙТЕОЙЕ РБУЛБМС" - -#: lazarusidestrconsts:dlgdefvaluecolor -msgid "Default value" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsdefine -msgid "Define" -msgstr "пРТЕДЕМЕОЙЕ" - -#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse -msgid "Define Recurse" -msgstr "пРТЕДЕМЙФШ ТЕЛХТУЙЧОП" - -#: lazarusidestrconsts:dlgeddelay -msgid "Delay" -msgstr "ъБДЕТЦЛБ" - -#: lazarusidestrconsts:dlgeddelete -msgid "Delete" -msgstr "хДБМЙФШ" - -#: lazarusidestrconsts:lismenueditordeletefromtemplate -msgid "Delete From Template..." -msgstr "хДБМЙФШ ЫБВМПО ЖПТНЩ" - -#: lazarusidestrconsts:lismenueditordeleteitem -msgid "Delete Item" -msgstr "хДБМЙФШ ЬМЕНЕОФ" - -#: lazarusidestrconsts:srkmecdeletelastchar -msgid "Delete Last Char" -msgstr "хДБМЙФШ РПУМЕДОЙК УЙНЧПМ" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile -msgid "Delete Old Package File?" -msgstr "хДБМЙФШ УФБТЩК ЖБКМ РБЛЕФБ?" - -#: lazarusidestrconsts:lisdeleteallthesefiles -msgid "Delete all these files?" -msgstr "" - -#: lazarusidestrconsts:lisdeleteambiguousfile -msgid "Delete ambiguous file?" -msgstr "хДБМЙФШ ЖБКМ У РПДПВОЩН ЙНЕОЕН?" - -#: lazarusidestrconsts:srkmecdeletechar -msgid "Delete char at cursor" -msgstr "хДБМЙФШ УЙНЧПМ Х ЛХТУПТБ" - -#: lazarusidestrconsts:srkmecdeleteline -msgid "Delete current line" -msgstr "хДБМЙФШ ФЕЛХЭХА УФТПЛХ" - -#: lazarusidestrconsts:lisprojinspdeletedependencyfor -msgid "Delete dependency for %s?" -msgstr "хДБМЙФШ ЪБЧЙУЙНПУФШ ДМС %s?" - -#: lazarusidestrconsts:lispkgmangdeletefailed -msgid "Delete failed" -msgstr "хДБМЕОЙЕ ОЕ ХДБМПУШ" - -#: lazarusidestrconsts:lisdeletefilefailed -msgid "Delete file failed" -msgstr "хДБМЕОЙЕ ЖБКМБ ОЕ ХДБМПУШ" - -#: lazarusidestrconsts:lislazdocdeletelinkbutton -msgid "Delete link" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsdeletenode -msgid "Delete node" -msgstr "хДБМЙФШ ЬМЕНЕОФ" - -#: lazarusidestrconsts:lisdeleteoldfile -msgid "Delete old file %s%s%s?" -msgstr "хДБМЙФШ УФБТЩК ЖБКМ %s%s%s?" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 -msgid "Delete old package file %s%s%s?" -msgstr "хДБМЙФШ УФБТЩК ЖБКМ РБЛЕФБ %s%s%s?" - -#: lazarusidestrconsts:fdmdeleteselection -msgid "Delete selection" -msgstr "хДБМЙФШ ЧЩВТБООПЕ" - -#: lazarusidestrconsts:dlgdeltemplate -msgid "Delete template " -msgstr "хДБМЙФШ ЫБВМПО " - -#: lazarusidestrconsts:srkmecdeletebol -msgid "Delete to beginning of line" -msgstr "хДБМЙФШ ДП ОБЮБМБ УФТПЛЙ" - -#: lazarusidestrconsts:srkmecdeleteeol -msgid "Delete to end of line" -msgstr "хДБМЙФШ ДП ЛПОГБ УФТПЛЙ" - -#: lazarusidestrconsts:srkmecdeleteword -msgid "Delete to end of word" -msgstr "хДБМЙФШ ДП ЛПОГБ УМПЧБ" - -#: lazarusidestrconsts:srkmecdeletelastword -msgid "Delete to start of word" -msgstr "хДБМЙФШ ДП ОБЮБМБ УМПЧБ" - -#: lazarusidestrconsts:srkmecclearall -msgid "Delete whole text" -msgstr "хДБМЙФШ ЧЕУШ ФЕЛУФ" - -#: lazarusidestrconsts:lisdeletingoffilefailed -msgid "Deleting of file %s%s%s failed." -msgstr "хДБМЕОЙЕ ЖБКМБ %s%s%s ОЕ ХДБМПУШ." - -#: lazarusidestrconsts:dlgdelphi2ext -msgid "Delphi 2 Extensions" -msgstr "тБУЫЙТЕОЙС Delphi 2" - -#: lazarusidestrconsts:dlgdeplhicomp -msgid "Delphi Compatible" -msgstr "уПЧНЕУФЙНПУФШ У Delphi" - -#: lazarusidestrconsts:lisdelphiproject -msgid "Delphi project" -msgstr "" - -#: lazarusidestrconsts:lisa2pdependency -msgid "Dependency" -msgstr "ъБЧЙУЙНПУФШ" - -#: lazarusidestrconsts:lispckeditdependencyproperties -msgid "Dependency Properties" -msgstr "уЧПКУФЧБ ЪБЧЙУЙНПУФЙ" - -#: lazarusidestrconsts:lisprojadddependencyalreadyexists -msgid "Dependency already exists" -msgstr "ъБЧЙУЙНПУФШ ХЦЕ ЕУФШ" - -#: lazarusidestrconsts:lispkgmangdependencywithoutowner -msgid "Dependency without Owner: %s" -msgstr "ъБЧЙУЙНПУФШ ВЕЪ ЧМБДЕМШГБ:%s" - -#: lazarusidestrconsts:lissortseldescending -msgid "Descending" -msgstr "рП ХВЩЧБОЙА" - -#: lazarusidestrconsts:listodoldescription -msgid "Description" -msgstr "пРЙУБОЙЕ" - -#: lazarusidestrconsts:lispckoptsdescriptionabstract -msgid "Description/Abstract" -msgstr "пРЙУБОЙЕ/ЛТБФЛП" - -#: lazarusidestrconsts:liscodetoolsdefsdescription -msgid "Description:" -msgstr "пРЙУБОЙЕ:" - -#: lazarusidestrconsts:lisoipdescription -msgid "Description: " -msgstr "пРЙУБОЙЕ: " - -#: lazarusidestrconsts:liskeycatdesigner -msgid "Designer commands" -msgstr "лПНБОДЩ ДЙЪБКОЕТБ" - -#: lazarusidestrconsts:lispckoptsdesigntimeandruntime -msgid "Designtime and Runtime" -msgstr "рТЙ ТБЪТБВПФЛЕ Й ЪБРХУЛЕ" - -#: lazarusidestrconsts:lispckoptsdesigntimeonly -msgid "Designtime only" -msgstr "фПМШЛП ДМС ТБЪТБВПФЛЙ" - -#: lazarusidestrconsts:dlgdesktop -msgid "Desktop" -msgstr "тБВПЮЙК УФПМ" - -#: lazarusidestrconsts:dlgdesktopfiles -msgid "Desktop files" -msgstr "жБКМЩ ТБВПЮЕЗП УФПМБ" - -#: lazarusidestrconsts:lisaf2pdestinationpackage -msgid "Destination Package" -msgstr "рБЛЕФ ОБЪОБЮЕОЙС" - -#: lazarusidestrconsts:lisdestinationdirectory -msgid "Destination directory" -msgstr "" - -#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete -msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." -msgstr "лБФБМПЗ %s%s%s ОЕЛПТТЛЕФЕО.%sчЩВЕТЙФЕ РХФШ Л ЛПНРЙМСФПТХ." - -#: lazarusidestrconsts:lismenudiff -msgid "Diff" -msgstr "тБЪОЙГБ Diff" - -#: lazarusidestrconsts:dlgdirection -msgid "Direction" -msgstr "оБРТБЧМЕОЙЕ" - -#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory -msgid "Directory" -msgstr "лБФБМПЗ" - -#: lazarusidestrconsts:dlgdirectorydoesnotexist -msgid "Directory does not exist" -msgstr "лБФБМПЗ ОЕ УХЭЕУФЧХЕФ" - -#: lazarusidestrconsts:dlgtestprjdir -msgid "Directory for building test projects" -msgstr "лБФБМПЗ ДМС УВПТЛЙ РТПВОЩИ РТПЕЛФПЧ" - -#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound -msgid "Directory not found" -msgstr "лБФБМПЗ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lisfindfiledirectoryoptions -msgid "Directory options" -msgstr "оБУФТПКЛЙ ЛБФБМПЗПЧ" - -#: lazarusidestrconsts:lisdiscardchanges -msgid "Discard changes" -msgstr "" - -#: lazarusidestrconsts:dlgeddisplay -msgid "Display" -msgstr "дЙУРМЕК" - -#: lazarusidestrconsts:dlgrunodisplay -msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" -msgstr "дЙУРМЕК (ОЕ ДМС win32, ОБРТ., 198.112.45.11:0, x.org:1, hydra:0.1)" - -#: lazarusidestrconsts:dlglnumsbct -msgid "Display Line Numbers in Run-time Error Backtraces" -msgstr "чЩДБФШ ОПНЕТБ УФТПЛ Ч ПЫЙВЛБИ ЧТЕНЕОЙ ЙУРПМОЕОЙС" - -#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda -msgid "Distinguish big and small letters e.g. A and a" -msgstr "тБЪМЙЮБФШ ТЕЗЙУФТ ВХЛЧ, ОБРТЙНЕТ, б Й Б" - -#: lazarusidestrconsts:lisdonotclosetheide -msgid "Do not close the IDE" -msgstr "" - -#: lazarusidestrconsts:lispodonotsaveanysessioninfo -msgid "Do not save any session info" -msgstr "" - -#: lazarusidestrconsts:lisdonotshowsplashscreen -msgid "Do not show splash screen" -msgstr "" - -#: lazarusidestrconsts:dlgnotsplitlinefront -msgid "Do not split line In front of:" -msgstr "оЕ ТБЪТЩЧБФШ УФТПЛХ РЕТЕД:" - -#: lazarusidestrconsts:dlgnotsplitlineafter -msgid "Do not split line after:" -msgstr "оЕ ТБЪТЩЧБФШ УФТПЛХ РПУМЕ:" - -#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand -msgid "Do you really want to forget all changes to package %s and reload it from file?" -msgstr "чЩ ДЕКУФЧЙФЕМШОП ИПФЙФЕ УВТПУЙФШ ЧУЕ ЙЪНЕОЕОЙС Ч РБЛЕФЕ %s Й ЪБЗТХЪЙФШ ЕЗП ЙЪ ЖБКМБ?" - -#: lazarusidestrconsts:lisconfirmlazarusrebuild -msgid "Do you want to rebuild Lazarus?" -msgstr "" - -#: lazarusidestrconsts:rsiwpdocked -msgid "Docked" -msgstr "рТЙЛТЕРМЈО" - -#: lazarusidestrconsts:lisdocumentationeditor -msgid "Documentation Editor" -msgstr "тЕДБЛФПТ ДПЛХНЕОФБГЙЙ" - -#: lazarusidestrconsts:lislazdocnodocumentation -msgid "Documentation entry does not exist" -msgstr "" - -#: lazarusidestrconsts:lissortseldomain -msgid "Domain" -msgstr "" - -#: lazarusidestrconsts:dlgdoubleclickline -msgid "Double click line" -msgstr "чЩДЕМЙФШ УФТПЛХ ДЧ. ЭЕМЮЛПН" - -#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick -msgid "Double click on messages jumps (otherwise: single click)" -msgstr "дЧПКОПК ЭЕМЮЈЛ ОБ РЕТЕИПДБИ РП УППВЭЕОЙСН (ЙОБЮЕ - ПДЙОБТОЩК)" - -#: lazarusidestrconsts:dlgdownword -msgid "Down" -msgstr "чОЙЪ" - -#: lazarusidestrconsts:dlgdragdroped -msgid "Drag Drop editing" -msgstr "" - -#: lazarusidestrconsts:dlgdropfiles -msgid "Drop files" -msgstr "вТПУЙФШ ЖБКМЩ" - -#: lazarusidestrconsts:rslanguagedutch -msgid "Dutch" -msgstr "" - -#: lazarusidestrconsts:lismenuenvironent -msgid "E&nvironment" -msgstr "&пЛТХЦЕОЙЕ" - -#: lazarusidestrconsts:liscodetoolsdefsedit -msgid "Edit" -msgstr "рТБЧЛБ" - -#: lazarusidestrconsts:lispckediteditgeneraloptions -msgid "Edit General Options" -msgstr "йЪНЕОЙФШ ПВЭЙЕ ОБУФТПКЛЙ" - -#: lazarusidestrconsts:srkmeditkeys -msgid "Edit Keys" -msgstr "йЪНЕОЙФШ ЛМБЧЙЫЙ" - -#: lazarusidestrconsts:lispckediteditoptionstocompilepackage -msgid "Edit Options to compile package" -msgstr "йЪНЕОЙФШ ОБУФТПКЛЙ ДМС ЛПНРЙМСГЙЙ РБЛЕФБ" - -#: lazarusidestrconsts:lisedtexttooledittool -msgid "Edit Tool" -msgstr "йОУФТХНЕОФ РТБЧЛЙ" - -#: lazarusidestrconsts:liscodetempleditcodetemplate -msgid "Edit code template" -msgstr "рТБЧЙФШ ЫБВМПОЩ ЛПДБ" - -#: lazarusidestrconsts:srkmeditforcmd -msgid "Edit keys for command" -msgstr "рТБЧЙФШ ЛМБЧЙЫЙ ДМС ЛПНБОДЩ" - -#: lazarusidestrconsts:dlgededit -msgid "Edit..." -msgstr "рТБЧЛБ" - -#: lazarusidestrconsts:dlgedfiles -msgid "Editor files" -msgstr "жБКМЩ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:dlgeditorfont -msgid "Editor font" -msgstr "ыТЙЖФ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:dlgeditorfontheight -msgid "Editor font height" -msgstr "чЩУПФБ ЫТЙЖФБ" - -#: lazarusidestrconsts:lismenueditoroptions -msgid "Editor options" -msgstr "оБУФТПКЛЙ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:uemeditorproperties -msgid "Editor properties" -msgstr "оБУФТПКЛЙ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:dlgedelement -msgid "Element" -msgstr "ьМЕНЕОФ" - -#: lazarusidestrconsts:liscodetoolsdefselse -msgid "Else" -msgstr "Else" - -#: lazarusidestrconsts:liscodetoolsdefselseif -msgid "ElseIf" -msgstr "ElseIf" - -#: lazarusidestrconsts:lisenablemakros -msgid "Enable Makros" -msgstr "" - -#: lazarusidestrconsts:lisenclose -msgid "Enclose" -msgstr "ъБЛМАЮЙФШ" - -#: lazarusidestrconsts:uemencloseselection -msgid "Enclose Selection" -msgstr "ъБЛМАЮЙФШ ЧЩДЕМЕООПЕ" - -#: lazarusidestrconsts:lismenuencloseselection -msgid "Enclose selection" -msgstr "ъБЛМАЮЙФШ ЧЩДЕМЕОЙЕ Ч..." - -#: lazarusidestrconsts:srvk_end -msgid "End" -msgstr "End" - -#: lazarusidestrconsts:rslanguageenglish -msgid "English" -msgstr "бОЗМЙКУЛЙК" - -#: lazarusidestrconsts:lismacropromptenterdata -msgid "Enter data" -msgstr "чЧЕДЙФЕ ДБООЩЕ" - -#: lazarusidestrconsts:lismacropromptenterrunparameters -msgid "Enter run parameters" -msgstr "чЧЕДЙФЕ РБТБНЕФТЩ ЪБРХУЛБ" - -#: lazarusidestrconsts:lisentertransla -msgid "Enter translation language" -msgstr "чЧЕДЙФЕ СЪЩЛ РЕТЕЧПДБ" - -#: lazarusidestrconsts:dlgentirescope -msgid "Entire Scope" -msgstr "у ОБЮБМБ" - -#: lazarusidestrconsts:dlgrunoenvironment -msgid "Environment" -msgstr "пЛТХЦЕОЙС" - -#: lazarusidestrconsts:srkmcatenvmenu -msgid "Environment menu commands" -msgstr "лПНБОДЩ НЕОА ПЛТХЦЕОЙС" - -#: lazarusidestrconsts:lismenugeneraloptions -msgid "Environment options" -msgstr "рБТБНЕФТЩ ПЛТХЦЕОЙС" - -#: lazarusidestrconsts:liscodetemplerror -msgid "Error" -msgstr "пЫЙВЛБ" - -#: lazarusidestrconsts:lispkgmangerrorreadingpackage -msgid "Error Reading Package" -msgstr "пЫЙВЛБ ЮФЕОЙС РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmangerrorwritingpackage -msgid "Error Writing Package" -msgstr "пЫЙВЛБ ЪБРЙУЙ РБЛЕФБ" - -#: lazarusidestrconsts:liserrorcreatingfile -msgid "Error creating file" -msgstr "пЫЙВЛБ УПЪДБОЙС ЖБКМБ" - -#: lazarusidestrconsts:liserrorcreatinglrs -msgid "Error creating lrs" -msgstr "пЫЙВЛБ УПЪДБОЙС lrs" - -#: lazarusidestrconsts:liserrordeletingfile -msgid "Error deleting file" -msgstr "пЫЙВЛБ ХДБМЕОЙС ЖБКМБ" - -#: lazarusidestrconsts:liserrorin -msgid "Error in %s" -msgstr "пЫЙВЛБ Ч %s" - -#: lazarusidestrconsts:lisueerrorinregularexpression -msgid "Error in regular expression" -msgstr "пЫЙВЛБ Ч ТЕЗХМСТОПН ЧЩТБЦЕОЙЙ" - -#: lazarusidestrconsts:liserrorinitializingprogramserrors -msgid "Error initializing program%s%s%s%s%sError: %s" -msgstr "пЫЙВЛБ ЙОЙГЙБМЙЪБГЙЙ РТПЗТБННЩ %s%s%s%s%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:liserrormovingcomponent -msgid "Error moving component" -msgstr "пЫЙВЛБ РЕТЕНЕЭЕОЙС ЛПНРПОЕОФБ" - -#: lazarusidestrconsts:liserrormovingcomponent2 -msgid "Error moving component %s:%s" -msgstr "пЫЙВЛБ РЕТЕНЕЭЕОЙС ЛПНРПОЕОФБ %s:%s" - -#: lazarusidestrconsts:liserrorparsinglfmcomponentstream -msgid "Error parsing lfm component stream." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefserrorreading -msgid "Error reading %s%s%s%s%s" -msgstr "пЫЙВЛБ ЮФЕОЙС %s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangerrorreadingfile -msgid "Error reading file" -msgstr "пЫЙВЛБ ЮФЕОЙС ЖБКМБ" - -#: lazarusidestrconsts:lisdiskdifferrorreadingfile -msgid "Error reading file: %s" -msgstr "пЫЙВЛБ ЮФЕОЙС ЖБКМБ: %s" - -#: lazarusidestrconsts:liserrorreadingpackagelistfromfile -msgid "Error reading package list from file%s%s%s%s" -msgstr "пЫЙВЛБ ЮФЕОЙС УРЙУЛБ РБЛЕФПЧ ЙЪ ЖБКМБ%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile -msgid "Error reading project info file %s%s%s%s%s" -msgstr "пЫЙВЛБ ЮФЕОЙС ЖБКМБ УЧЕДЕОЙК РТПЕЛФБ %s%s%s%s%s" - -#: lazarusidestrconsts:liserrorrenamingfile -msgid "Error renaming file" -msgstr "пЫЙВЛБ РЕТЕЙНЕОПЧБОЙС ЖБКМБ" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting -msgid "Error while writing %s%s%s%s%s" -msgstr "пЫЙВЛБ ЪБРЙУЙ %s%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile -msgid "Error while writing project info file %s%s%s%s%s" -msgstr "пЫЙВЛБ ЪБРЙУЙ РТПЕЛФБ Ч ЖБКМ %s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangerrorwritingfile -msgid "Error writing file" -msgstr "пЫЙВЛБ ЪБРЙУЙ ЖБКМБ" - -#: lazarusidestrconsts:liserrorwritingpackagelisttofile -msgid "Error writing package list to file%s%s%s%s" -msgstr "пЫЙВЛБ ЪБРЙУЙ УРЙУЛБ РБЛЕФПЧ Ч ЖБКМ%s%s%s%s" - -#: lazarusidestrconsts:liserror -msgid "Error: " -msgstr "пЫЙВЛБ:" - -#: lazarusidestrconsts:liscompilererrorinvalidcompiler -msgid "Error: invalid compiler: %s" -msgstr "пЫЙВЛБ: ОЕРТБЧЙМШОЩК ЛПНРЙМСФПТ:%s" - -#: lazarusidestrconsts:liserrors -msgid "Errors" -msgstr "пЫЙВЛЙ" - -#: lazarusidestrconsts:srvk_escape -msgid "Escape" -msgstr "Escape" - -#: lazarusidestrconsts:lismenuevaluate -msgid "Evaluate/Modify ..." -msgstr "чЩЮЙУМЙФШ/йЪНЕОЙФШ..." - -#: lazarusidestrconsts:lislazdocexampletag -msgid "Example" -msgstr "" - -#: lazarusidestrconsts:lisexcludefilter -msgid "Exclude Filter" -msgstr "" - -#: lazarusidestrconsts:srvk_execute -msgid "Execute" -msgstr "чЩРПМОЙФШ" - -#: lazarusidestrconsts:liscoexecuteafter -msgid "Execute after" -msgstr "чЩРПМОЙФШ РПУМЕ" - -#: lazarusidestrconsts:liscoexecutebefore -msgid "Execute before" -msgstr "чЩРПМОЙФШ РЕТЕД" - -#: lazarusidestrconsts:lisexecutingcommandafter -msgid "Executing command after" -msgstr "чЩРПМОЙФШ ЛПНБОДХ РПУМЕ" - -#: lazarusidestrconsts:lisexecutingcommandbefore -msgid "Executing command befor" -msgstr "чЩРПМОЙФШ ЛПНБОДХ ДП" - -#: lazarusidestrconsts:lisexecutionpaused -msgid "Execution paused" -msgstr "чЩРПМОЕОЙЕ РТЙПУФБОПЧМЕОП" - -#: lazarusidestrconsts:lisexecutionpausedadress -msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" -msgstr "чЩРПМОЕОЙЕ ПУФБОПЧМЕОП%s бДТЕУ: %s%s рТПГЕДХТБ: %s%s жБКМ: %s%s(лПЗДБ-ОЙВХДШ ЪДЕУШ РПСЧЙФУС ПЛОП БУУЕНВМЕТБ :)%s" - -#: lazarusidestrconsts:lisexecutionstopped -msgid "Execution stopped" -msgstr "чЩРПМОЕОЙЕ ПУФБОПЧМЕОП" - -#: lazarusidestrconsts:lisexecutionstoppedon -msgid "Execution stopped%s" -msgstr "чЩРПМОЕОЙЕ ПУФБОПЧМЕОП %s" - -#: lazarusidestrconsts:liscodetoolsdefsexit -msgid "Exit" -msgstr "чЩИПД" - -#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave -msgid "Exit without Save" -msgstr "чЩИПД ВЕЪ УПИТБОЕОЙС" - -#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor -msgid "Expanded filename of current editor file" -msgstr "рПМОПЕ ЙНС ЖБКМБ Ч ДБООПН ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:lisexportlist -msgid "Export list" -msgstr "уРЙУПЛ ЬЛУРПТФБ" - -#: lazarusidestrconsts:lisextendunitpath -msgid "Extend unit path?" -msgstr "" - -#: lazarusidestrconsts:lisexttoolexternaltools -msgid "External Tools" -msgstr "чОЕЫОЙЕ ЙОУФТХНЕОФЩ" - -#: lazarusidestrconsts:srkmecexttool -msgid "External tool %d" -msgstr "чОЕЫОЙК ЙОУФТХНЕОФ %d" - -#: lazarusidestrconsts:srkmecexttoolsettings -msgid "External tools settings" -msgstr "оБУФТПКЛЙ ЧОЕЫОЕЗП ЙОУФТХНЕОФБ" - -#: lazarusidestrconsts:dlgextralinespacing -msgid "Extra line spacing" -msgstr "нЕЦУФТПЮОЩК ЙОФЕТЧБМ" - -#: lazarusidestrconsts:lisextract -msgid "Extract" -msgstr "йЪЧМЕЮШ" - -#: lazarusidestrconsts:uemextractproc -msgid "Extract Procedure" -msgstr "чЩДЕМЙФШ РТПГЕДХТХ" - -#: lazarusidestrconsts:lismenuextractproc -msgid "Extract procedure" -msgstr "чЩДЕМЙФШ РТПГЕДХТХ" - -#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory -msgid "FPC SVN source directory" -msgstr "" - -#: lazarusidestrconsts:lisfpcsourcedirectoryerror -msgid "FPC Source Directory error" -msgstr "пЫЙВЛБ ЛБФБМПЗБ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:dlgfpcsrcpath -msgid "FPC source directory" -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg -msgid "FPC source directory \"%s\" not found." -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FPC \"%s\" ОЕ ОБКДЕО." - -#: lazarusidestrconsts:lisexttoolfailedtoruntool -msgid "Failed to run tool" -msgstr "оЕ ХДБМПУШ ЪБРХУФЙФШ ЙОУФТХНЕОФ" - -#: lazarusidestrconsts:dlgcofast -msgid "Faster Code" -msgstr "вЩУФТЩК ЛПД" - -#: lazarusidestrconsts:listodolfile -msgid "File" -msgstr "жБКМ" - -#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject -msgid "File %s%s%s already exists in the project." -msgstr "жБКМ %s%s%s ХЦЕ ЕУФШ Ч РТПЕЛФЕ." - -#: lazarusidestrconsts:lisfilehaschangedsave -msgid "File %s%s%s has changed. Save?" -msgstr "жБКМ %s%s%s ЙЪНЕОЈО. уПИТБОЙФШ?" - -#: lazarusidestrconsts:lisfileisvirtual -msgid "File %s%s%s is virtual." -msgstr "жБКМ %s%s%s ЧЙТФХБМШОЩК." - -#: lazarusidestrconsts:lispkgmangfilenotfound -msgid "File %s%s%s not found." -msgstr "жБКМ %s%s%s ОЕ ОБКДЕО." - -#: lazarusidestrconsts:lisfilenotfound2 -msgid "File %s%s%s not found.%s" -msgstr "жБКМ %s%s%s ОЕ ОБКДЕО.%s" - -#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit -msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "жБКМ %s%s%s ОЕ ОБКДЕО.%sуПЪДБФШ ЕЗП?%s" - -#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway -msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "жБКМ %s%s%s%sОЕ РПИПЦ ОБ ФЕЛУФПЧЩК.%sчУЈ ТБЧОП ПФЛТЩФШ?" - -#: lazarusidestrconsts:lispckeditfileproperties -msgid "File Properties" -msgstr "уЧПКУФЧБ ЖБКМБ" - -#: lazarusidestrconsts:lisaf2pfiletype -msgid "File Type" -msgstr "фЙР ЖБКМБ" - -#: lazarusidestrconsts:lisa2pfilealreadyexists -msgid "File already exists" -msgstr "жБКМ ХЦЕ УХЭЕУФЧХЕФ" - -#: lazarusidestrconsts:lisa2pfilealreadyinpackage -msgid "File already in package" -msgstr "жБКМ ХЦЕ Ч РБЛЕФЕ" - -#: lazarusidestrconsts:dlgfileexts -msgid "File extensions:" -msgstr "тБУЫ-С ЖБКМПЧ:" - -#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage -msgid "File is already in package" -msgstr "жБКМ ХЦЕ ЕУФШ Ч РБЛЕФЕ" - -#: lazarusidestrconsts:lispkgmangfileisinproject -msgid "File is in Project" -msgstr "жБКМ Ч РТПЕЛФЕ" - -#: lazarusidestrconsts:lisfileisnotwritable -msgid "File is not writable" -msgstr "ч ЖБКМ ОЕМШЪС РЙУБФШ" - -#: lazarusidestrconsts:uefilerocap -msgid "File is readonly" -msgstr "жБКМ ФПМШЛП ДМС ЮФЕОЙС" - -#: lazarusidestrconsts:lisa2pfileisused -msgid "File is used" -msgstr "жБКМ ЙУРПМШЪХЕФУС" - -#: lazarusidestrconsts:lisfindfilefilemaskbak -msgid "File mask (*;*.*;*.bak?)" -msgstr "нБУЛБ ЖБКМБ (*;*.*;*.bak?)" - -#: lazarusidestrconsts:srkmcatfilemenu -msgid "File menu commands" -msgstr "лПНБОДЩ НЕОА ЖБКМ" - -#: lazarusidestrconsts:lisa2pfilename -msgid "File name:" -msgstr "йНС ЖБКМБ:" - -#: lazarusidestrconsts:lisrunparamsfilenotexecutable -msgid "File not executable" -msgstr "жБКМ ОЕ ЙУРПМОСЕНЩК" - -#: lazarusidestrconsts:lisfilenotfound -msgid "File not found" -msgstr "жБКМ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lisfilenotlowercase -msgid "File not lowercase" -msgstr "жБКМ ОЕ Ч ОЙЦОЕН ТЕЗЙУФТЕ" - -#: lazarusidestrconsts:lispkgmangfilenotsaved -msgid "File not saved" -msgstr "жБКМ ОЕ УПИТБОЈО" - -#: lazarusidestrconsts:lisfilenottext -msgid "File not text" -msgstr "жБКМ ОЕ ФЕЛУФПЧЩК" - -#: lazarusidestrconsts:lisa2pfilenotunit -msgid "File not unit" -msgstr "жБКМ - ОЕ НПДХМШ" - -#: lazarusidestrconsts:lisa2pfilename2 -msgid "Filename" -msgstr "йНС ЖБКМБ" - -#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename -msgid "Filename differs from Packagename" -msgstr "йНС ЖБКМБ ПФМЙЮБЕФУС ПФ ЙНЕОЙ РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage -msgid "Filename is used by other package" -msgstr "йНС ЖБКМБ ЙУРПМШЪПЧБОП ДТХЗЙН РБЛЕФПН" - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject -msgid "Filename is used by project" -msgstr "йНС ЖБКМБ ЙУРПМШЪПЧБОП РТПЕЛФПН" - -#: lazarusidestrconsts:lisoipfilename -msgid "Filename: %s" -msgstr "йНС ЖБКМБ: %s" - -#: lazarusidestrconsts:dlgenvfiles -msgid "Files" -msgstr "жБКМЩ" - -#: lazarusidestrconsts:srvk_final -msgid "Final" -msgstr "жЙОБМШОЩК" - -#: lazarusidestrconsts:lismenufind -msgid "Find" -msgstr "оБКФЙ" - -#: lazarusidestrconsts:lismenufindnext -msgid "Find &Next" -msgstr "оБКФЙ ЧРЕТЕДЙ" - -#: lazarusidestrconsts:lismenufindprevious -msgid "Find &Previous" -msgstr "оБКФЙ УЪБДЙ" - -#: lazarusidestrconsts:lismenufindinfiles -msgid "Find &in files" -msgstr "рПЙУЛ Ч ЖБКМБИ" - -#: lazarusidestrconsts:lismenufinddeclarationatcursor -msgid "Find Declaration at cursor" -msgstr "оБКФЙ ПРЙУБОЙЕ РПД ЛХТУПТБ" - -#: lazarusidestrconsts:lismenufindidentifierrefs -msgid "Find Identifier References" -msgstr "оБКФЙ УУЩМЛЙ ОБ ЙДЕОФЙЖЙЛБФПТ" - -#: lazarusidestrconsts:lismenutemplatefindnext -msgid "Find Next" -msgstr "оБКФЙ ДБМЕЕ" - -#: lazarusidestrconsts:lisfrifindreferences -msgid "Find References" -msgstr "оБКФЙ УУЩМЛЙ" - -#: lazarusidestrconsts:srkmecfindblockotherend -msgid "Find block other end" -msgstr "оБКФЙ ДТХЗПК ЛПОЕГ ВМПЛБ" - -#: lazarusidestrconsts:srkmecfindblockstart -msgid "Find block start" -msgstr "оБКФЙ ОБЮБМП ВМПЛБ" - -#: lazarusidestrconsts:lismenufindcodeblockstart -msgid "Find code block start" -msgstr "оБКФЙ ОБЮБМП ВМПЛБ ЛПДБ" - -#: lazarusidestrconsts:srkmecfinddeclaration -msgid "Find declaration" -msgstr "оБКФЙ ПРЙУБОЙЕ" - -#: lazarusidestrconsts:srkmecfindidentifierrefs -msgid "Find identifier references" -msgstr "оБКФЙ УУЩМЛЙ ОБ ЙДЕОФЙЖЙЛБФПТ" - -#: lazarusidestrconsts:srkmecfindinfiles -msgid "Find in files" -msgstr "оБКФЙ Ч ЖБКМБИ" - -#: lazarusidestrconsts:srkmecfindnext -msgid "Find next" -msgstr "оБКФЙ ДБМЕЕ" - -#: lazarusidestrconsts:lisfrifindorrenameidentifier -msgid "Find or Rename Identifier" -msgstr "оБКФЙ ЙМЙ РЕТЕЙНЕОПЧБФШ ID" - -#: lazarusidestrconsts:lismenufindblockotherendofcodeblock -msgid "Find other end of code block" -msgstr "оБКФЙ ДТХЗПК ЛПОЕГ ВМПЛБ ЛПДБ" - -#: lazarusidestrconsts:srkmecfindprevious -msgid "Find previous" -msgstr "оБКФЙ РТЕДЩДХЭЕЕ" - -#: lazarusidestrconsts:srkmecfindproceduredefinition -msgid "Find procedure definiton" -msgstr "оБКФЙ ПРЙУБОЙЕ РТПГЕДХТЩ" - -#: lazarusidestrconsts:srkmecfindproceduremethod -msgid "Find procedure method" -msgstr "оБКФЙ НЕФПД РТПГЕДХТЩ" - -#: lazarusidestrconsts:srkmecfind -msgid "Find text" -msgstr "оБКФЙ ФЕЛУФ" - -#: lazarusidestrconsts:dlgfindtextatcursor -msgid "Find text at cursor" -msgstr "оБКФЙ ФЕЛУФ РПД ЛХТУПТПН" - -#: lazarusidestrconsts:rslanguagefinnish -msgid "Finnish" -msgstr "жЙОУЛЙК" - -#: lazarusidestrconsts:lisfixlfmfile -msgid "Fix LFM file" -msgstr "йУРТБЧЙФШ ЖБКМ LFM" - -#: lazarusidestrconsts:srkmecjumptoeditor -msgid "Focus to source editor" -msgstr "жПЛХУ Ч ТЕДБЛФПТ ЙУИПДОЙЛПЧ" - -#: lazarusidestrconsts:liscefollowcursor -msgid "Follow cursor" -msgstr "" - -#: lazarusidestrconsts:lisforcerenaming -msgid "Force renaming" -msgstr "" - -#: lazarusidestrconsts:dlgforecolor -msgid "Foreground color" -msgstr "гЧЕФ ФЕЛУФБ" - -#: lazarusidestrconsts:dlgfrmeditor -msgid "Form Editor" -msgstr "тЕДБЛФПТ ЖПТН" - -#: lazarusidestrconsts:lisformloaderror -msgid "Form load error" -msgstr "пЫЙВЛБ ЪБЗТХЪЛЙ ЖПТНЩ" - -#: lazarusidestrconsts:lisformaterror -msgid "Format error" -msgstr "пЫЙВЛБ ЖПТНБФЙТПЧБОЙС" - -#: lazarusidestrconsts:dlgpofroms -msgid "Forms" -msgstr "жПТНЩ" - -#: lazarusidestrconsts:lismenuviewforms -msgid "Forms..." -msgstr "жПТНЩ..." - -#: lazarusidestrconsts:fdmorderforwardone -msgid "Forward one" -msgstr "" - -#: lazarusidestrconsts:lisfrforwardsearch -msgid "Forward search" -msgstr "рПЙУЛ ЧРЕТЈД" - -#: lazarusidestrconsts:lisfreepascalcompilernotfound -msgid "Free Pascal Compiler not found" -msgstr "лПНРЙМСФПТ FreePascal ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lisfreepascalsourcesnotfound -msgid "Free Pascal Sources not found" -msgstr "оЕ ОБКДЕОЩ ЙУИПДОЙЛЙ FreePascal" - -#: lazarusidestrconsts:lisfreepascalsourcefile -msgid "FreePascal source file" -msgstr "" - -#: lazarusidestrconsts:lisfreepascalsourcedirectory -msgid "Freepascal source directory" -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FreePascal" - -#: lazarusidestrconsts:rslanguagefrench -msgid "French" -msgstr "жТБОГХЪУЛЙК" - -#: lazarusidestrconsts:dlgfromcursor -msgid "From Cursor" -msgstr "пФ ЛХТУПТБ" - -#: lazarusidestrconsts:listmfunctionappendpathdelimiter -msgid "Function: append path delimiter" -msgstr "жХОЛГЙС: ДПВБЧЙФШ ТБЪДЕМЙФЕМШ РХФЕК" - -#: lazarusidestrconsts:listmfunctionchomppathdelimiter -msgid "Function: chomp path delimiter" -msgstr "жХОЛГЙС: ХВТБФШ ТБЪДЕМЙФЕМШ РХФЕК" - -#: lazarusidestrconsts:listmfunctionextractfileextension -msgid "Function: extract file extension" -msgstr "жХОЛГЙС: ЙЪЧМЕЮШ ТБУЫЙТЕОЙЕ ЖБКМБ" - -#: lazarusidestrconsts:listmfunctionextractfilenameonly -msgid "Function: extract file name only" -msgstr "жХОЛГЙС: ЙЪЧМЕЮШ ФПМШЛП ЙНС ЖБКМБ" - -#: lazarusidestrconsts:listmfunctionextractfilenameextension -msgid "Function: extract file name+extension" -msgstr "жХОЛГЙС: ЙЪЧМЕЮШ ЙНС ЖБКМБ У ТБУЫЙТЕОЙЕН" - -#: lazarusidestrconsts:listmfunctionextractfilepath -msgid "Function: extract file path" -msgstr "жХОЛГЙС: ЙЪЧМЕЮШ РХФШ ЖБКМБ" - -#: lazarusidestrconsts:dlggpccomp -msgid "GPC (GNU Pascal Compiler) Compatible" -msgstr "уПЧНЕУФЙНПУФШ У GPC (GNU Pascal Compiler)" - -#: lazarusidestrconsts:lismenuinsertgplnotice -msgid "GPL notice" -msgstr "ъБНЕФЛБ GPL" - -#: lazarusidestrconsts:lismenuinsertgeneral -msgid "General" -msgstr "пВЭЙЕ" - -#: lazarusidestrconsts:lispckeditgeneraloptions -msgid "General Options" -msgstr "пВЭЙЕ ОБУФТПКЛЙ" - -#: lazarusidestrconsts:srkmecenvironmentoptions -msgid "General environment options" -msgstr "пВЭЙЕ ОБУФТПКЛЙ ПЛТХЦЕОЙС" - -#: lazarusidestrconsts:dlgcodbx -msgid "Generate Debugging Info For DBX (Slows Compiling)" -msgstr "зЕОЕТЙТПЧБФШ ЙОЖПТНБГЙА ДМС DBX (ЪБНЕДМСЕФ УВПТЛХ)" - -#: lazarusidestrconsts:dlgcogdb -msgid "Generate Debugging Info For GDB (Slows Compiling)" -msgstr "зЕОЕТЙТПЧБФШ ЙОЖПТНБГЙА ДМС GDB (ЪБНЕДМСЕФ УВПТЛХ)" - -#: lazarusidestrconsts:dlggprof -msgid "Generate code for gprof" -msgstr "уПЪДБФШ ЛПД ДМС gprof" - -#: lazarusidestrconsts:dlgcovalgrind -msgid "Generate code for valgrind" -msgstr "уПЪДБФШ ЛПД ДМС valgrind" - -#: lazarusidestrconsts:dlgcogenerate -msgid "Generate:" -msgstr "уПЪДБФШ:" - -#: lazarusidestrconsts:rslanguagegerman -msgid "German" -msgstr "" - -#: lazarusidestrconsts:dlggetposition -msgid "Get position" -msgstr "рТЙОСФШ РПЪЙГЙА" - -#: lazarusidestrconsts:dlgglobal -msgid "Global" -msgstr "чЕЪДЕ" - -#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition -msgid "Global Source Path addition" -msgstr "зМПВБМШОП ДПВБЧЙФШ РХФШ ЙУИПДОЙЛПЧ" - -#: lazarusidestrconsts:srkmecgotomarker -msgid "Go to Marker %d" -msgstr "рЕТЕИПД Л НБТЛЕТХ %d" - -#: lazarusidestrconsts:srkmecgotoeditor -msgid "Go to editor %d" -msgstr "рЕТЕИПД Л ТЕДБЛФПТХ %d" - -#: lazarusidestrconsts:srkmecgotolinenumber -msgid "Go to line number" -msgstr "рЕТЕИПД Л УФТПЛЕ ОПНЕТ" - -#: lazarusidestrconsts:srkmecmatchbracket -msgid "Go to matching bracket" -msgstr "рЕТЕИПД Л УППФЧ. УЛПВЛЕ" - -#: lazarusidestrconsts:srkmecnexteditor -msgid "Go to next editor" -msgstr "рЕТЕИПД Л УМЕДХАЭЕНХ ТЕДБЛФПТХ" - -#: lazarusidestrconsts:srkmecpreveditor -msgid "Go to prior editor" -msgstr "рЕТЕИПД Л РТЕДЩДХЭЕНХ ТЕДБЛФПТХ" - -#: lazarusidestrconsts:srkmecgotoincludedirective -msgid "Go to to include directive of current include file" -msgstr "рЕТЕИПД РП ДЙТЕЛФЙЧЕ include ФЕЛХЭЕЗП ЧЛМАЮБЕНПЗП ЖБКМБ" - -#: lazarusidestrconsts:srkmecgotoxy -msgid "Goto XY" -msgstr "рЕТЕИПД РП ЛППТДЙОБФЕ" - -#: lazarusidestrconsts:lismenugotoincludedirective -msgid "Goto include directive" -msgstr "рЕТЕИПД РП ДЙТЕЛФЙЧЕ $I" - -#: lazarusidestrconsts:lismenugotoline -msgid "Goto line" -msgstr "рЕТЕИПД Л УФТПЛЕ" - -#: lazarusidestrconsts:lisuegotoline -msgid "Goto line :" -msgstr "уФТПЛБ :" - -#: lazarusidestrconsts:uemnextbookmark -msgid "Goto next Bookmark" -msgstr "" - -#: lazarusidestrconsts:uemprevbookmark -msgid "Goto previous Bookmark" -msgstr "" - -#: lazarusidestrconsts:listodolistgotoline -msgid "Goto selected source line" -msgstr "рЕТЕИПД Л ЧЩДЕМЕООПК УФТПЛЕ ЙУИПДОЙЛБ" - -#: lazarusidestrconsts:srkmgrabkey -msgid "Grab Key" -msgstr "ъБИЧБФ ЛМБЧЙЫ" - -#: lazarusidestrconsts:dlggrabbercolor -msgid "Grabber color" -msgstr "гЧЕФ ЧЩДЕМЕОЙС" - -#: lazarusidestrconsts:dlgenvgrid -msgid "Grid" -msgstr "уЕФЛБ" - -#: lazarusidestrconsts:dlggridcolor -msgid "Grid color" -msgstr "гЧЕФ УЕФЛЙ" - -#: lazarusidestrconsts:dlggridx -msgid "Grid size X" -msgstr "тБЪНЕТ X УЕФЛЙ" - -#: lazarusidestrconsts:dlggridy -msgid "Grid size Y" -msgstr "тБЪНЕТ Y УЕФЛЙ" - -#: lazarusidestrconsts:srkmecguessmisplacedifdef -msgid "Guess misplaced $IFDEF" -msgstr "рТЕДРПМПЦЙФШ ПФУХФУФЧЙЕ $IFDEF" - -#: lazarusidestrconsts:lismenuguessmisplacedifdef -msgid "Guess misplaced IFDEF/ENDIF" -msgstr "йУРТБЧЙФШ ОЕУППФЧЕФУФЧЙЕ IFDEF/ENDIF" - -#: lazarusidestrconsts:lismenuguessunclosedblock -msgid "Guess unclosed block" -msgstr "йУРТБЧЙФШ ОЕЪБЛПОЮЕООЩК ВМПЛ" - -#: lazarusidestrconsts:dlgenvlguidelines -msgid "Guide lines" -msgstr "мЙОЙЙ РПНПЭЙ" - -#: lazarusidestrconsts:dlgguttercolor -msgid "Gutter color" -msgstr "гЧЕФ РПМС (МЕЧ)" - -#: lazarusidestrconsts:dlggutterwidth -msgid "Gutter width" -msgstr "ыЙТЙОБ РПМС (МЕЧ)" - -#: lazarusidestrconsts:dlghalfpagescroll -msgid "Half page scroll" -msgstr "рТПЛТХФЛБ ОБ РПМПЧЙОХ УФТБОЙГЩ" - -#: lazarusidestrconsts:lismenueditorhandleonclickevent -msgid "Handle OnClick Event" -msgstr "пВТБВПФБФШ УПВЩФЙЕ OnClick" - -#: lazarusidestrconsts:srvk_hanja -msgid "Hanja" -msgstr "Hanja" - -#: lazarusidestrconsts:lisaf2phasregisterprocedure -msgid "Has Register procedure" -msgstr "йНЕЕФ РТПГ-ТХ Register" - -#: lazarusidestrconsts:lisheadercommentforclass -msgid "Header comment for class" -msgstr "лПННЕОФБТЙК-ЪБЗПМПЧПЛ ДМС ЛМБУУБ" - -#: lazarusidestrconsts:dlgheapsize -msgid "Heap Size" -msgstr "тБЪНЕТ ЛХЮЙ" - -#: lazarusidestrconsts:rslanguagehebrew -msgid "Hebrew" -msgstr "" - -#: lazarusidestrconsts:dlgheightpos -msgid "Height:" -msgstr "чЩУПФБ:" - -#: lazarusidestrconsts:srvk_help -msgid "Help" -msgstr "уРТБЧЛБ" - -#: lazarusidestrconsts:lishelpcontextnotfound -msgid "Help Context not found" -msgstr "лПОФЕЛУФ УРТБЧЛЙ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lishelpdatabasenotfound -msgid "Help Database not found" -msgstr "вБЪБ ДБООЩИ УРТБЧЛЙ ОЕ ОБКДЕОБ" - -#: lazarusidestrconsts:lishlpoptshelpoptions -msgid "Help Options" -msgstr "рБТБНЕФТЩ УРТБЧЛЙ" - -#: lazarusidestrconsts:lishelpselectorerror -msgid "Help Selector Error" -msgstr "пЫЙВЛБ ЧЩВПТБ УРТБЧЛЙ" - -#: lazarusidestrconsts:lishelpviewererror -msgid "Help Viewer Error" -msgstr "пЫЙВЛБ РТПУНПФТБ УРТБЧЛЙ" - -#: lazarusidestrconsts:lishelpviewernotfound -msgid "Help Viewer not found" -msgstr "рТПУНПФТЭЙЛ УРТБЧЛЙ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:srkmcarhelpmenu -msgid "Help menu commands" -msgstr "лПНБОДЩ НЕОА уРТБЧЛБ" - -#: lazarusidestrconsts:lishelpnotfound -msgid "Help not found" -msgstr "уРТБЧЛЙ ОЕ ОБКДЕОП" - -#: lazarusidestrconsts:dlghideideonrun -msgid "Hide IDE windows on run" -msgstr "уЛТЩФШ ПЛОБ IDE РТЙ РХУЛЕ" - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 -msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." -msgstr "рПДУЛБЪЛБ: ЖХОЛГЙС уПЪДБФШ УФТПЛХ ТЕУХТУПЧ ФТЕВХЕФ УФТПЛПЧПК ЛПОУФБОФЩ.%sчЩВЕТЙФЕ ФПМШЛП УФТПЛПЧПЕ ЧЩТБЦЕОЙЕ Й РПРТПВХКФЕ УОПЧБ." - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon -msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." -msgstr "рПДУЛБЪЛБ: ЖХОЛГЙС уПЪДБФШ УФТПЛХ ТЕУХТУПЧ ФТЕВХЕФ УФТПЛПЧПК ЛПОУФБОФЩ.%sчЩВЕТЙФЕ ЧЩТБЦЕОЙЕ Й РПРТПВХКФЕ УОПЧБ." - -#: lazarusidestrconsts:dlgedhintcommand -msgid "Hint: click on the command you want to edit" -msgstr "рПДУЛБЪЛБ: ЭЕМЛОЙФЕ РП ЛПНБОДЕ, ЛПФПТБС чБН ОХЦОБ" - -#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath -msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "рПДУЛБЪЛБ: чЩ НПЦЕФЕ ЪБДБФШ РХФШ ЛПНРЙМСФПТБ Ч пЛТХЦЕОЙЕ->рБТБНЕФТЩ ПЛТХЦЕОЙС->жБКМЩ->рХФШ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:dlgpalhints -msgid "Hints for component palette" -msgstr "рПДУЛБЪЛЙ РБМЙФТЩ ЛПНРПОЕОФПЧ" - -#: lazarusidestrconsts:dlgspbhints -msgid "Hints for main speed buttons (open, save, ...)" -msgstr "рПДУЛБЪЛЙ ЛПНБОДОЩИ ЛОПРПЛ (ПФЛТЩФШ, УПИТБОЙФШ Й Ф.Д.)" - -#: lazarusidestrconsts:srvk_home -msgid "Home" -msgstr "Home" - -#: lazarusidestrconsts:dlghomekeyjumpstoneareststart -msgid "Home key jumps to nearest start" -msgstr "" - -#: lazarusidestrconsts:lishorizontal -msgid "Horizontal" -msgstr "зПТЙЪПОФБМШОП" - -#: lazarusidestrconsts:dlggridxhint -msgid "Horizontal grid step size" -msgstr "ыБЗ УЕФЛЙ РП ЗПТЙЪПОФБМЙ" - -#: lazarusidestrconsts:dlghostapplication -msgid "Host application" -msgstr "зМБЧОПЕ РТЙМПЦЕОЙЕ" - -#: lazarusidestrconsts:uenotimplcapagain -msgid "I told You: Not implemented yet" -msgstr "чБН УЛБЪБОП - ОЕ ТЕБМЙЪПЧБОП" - -#: lazarusidestrconsts:lispckoptsideintegration -msgid "IDE Integration" -msgstr "чУФТБЙЧБОЙЕ Ч IDE" - -#: lazarusidestrconsts:lisideoptions -msgid "IDE Options:" -msgstr "рБТБНЕФТЩ IDE:" - -#: lazarusidestrconsts:uepins -msgid "INS" -msgstr "чуф" - -#: lazarusidestrconsts:liscodetoolsoptsidentifier -msgid "Identifier" -msgstr "йДЕОФЙЖЙЛБФПТ" - -#: lazarusidestrconsts:lismakeresstridentifierlength -msgid "Identifier Length:" -msgstr "дМЙОБ ЙДЕОФЙЖЙЛБФПТБ:" - -#: lazarusidestrconsts:lismakeresstridentifierprefix -msgid "Identifier Prefix:" -msgstr "рТЕЖЙЛУ ЙДЕОФЙЖЙЛБФПТБ:" - -#: lazarusidestrconsts:dlgedidcomlet -msgid "Identifier completion" -msgstr "ъБЧЕТЫЕОЙЕ ЙДЕОФЙЖЙЛБФПТПЧ" - -#: lazarusidestrconsts:dlgidentifierpolicy -msgid "Identifier policy" -msgstr "рПМЙФЙЛБ ЙДЕОФЙЖЙЛБФПТПЧ" - -#: lazarusidestrconsts:lisfriidentifier -msgid "Identifier: %s" -msgstr "йДЕОФЙЖЙЛБФПТ: %s" - -#: lazarusidestrconsts:liscodetoolsdefsif -msgid "If" -msgstr "If" - -#: lazarusidestrconsts:uenotimpltext -msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "еУМЙ чЩ НПЦЕФЕ РПНПЮШ ОБН ТЕБМЙЪПЧБФШ ЬФХ ЖХОЛГЙА, РЙЫЙФЕ lazarus@miraclec.com" - -#: lazarusidestrconsts:liscodetoolsdefsifdef -msgid "IfDef" -msgstr "IfDef" - -#: lazarusidestrconsts:liscodetoolsdefsifndef -msgid "IfNDef" -msgstr "IfNDef" - -#: lazarusidestrconsts:dlgignoreverb -msgid "Ignore" -msgstr "рТПРХУЛ" - -#: lazarusidestrconsts:lissortselignorespace -msgid "Ignore Space" -msgstr "йЗОПТЙТПЧБФШ РТПВЕМЩ" - -#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd -msgid "Ignore amount of space chars" -msgstr "йЗОПТЙТПЧБФШ ЛПМЙЮЕУФЧП РТПВЕМПЧ" - -#: lazarusidestrconsts:lisignorebinaries -msgid "Ignore binaries" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe -msgid "Ignore difference in line ends (e.g. #10 = #13#10)" -msgstr "йЗОПТЙТПЧБФШ ТБЪОЩЕ ЛПОГЩ УФТПЛ (ОБРТ., #10 = #13#10)" - -#: lazarusidestrconsts:lisdiskdiffignorediskchanges -msgid "Ignore disk changes" -msgstr "йЗОПТЙТПЧБФШ ЙЪНЕОЕОЙС ОБ ДЙУЛЕ" - -#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd -msgid "Ignore if empty lines were added or removed" -msgstr "йЗОПТЙТПЧБФШ ДПВБЧМЕОЙЕ/ХДБМЕОЙЕ РХУФЩИ УФТПЛ" - -#: lazarusidestrconsts:lisignoremissingfile -msgid "Ignore missing file" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgignorespaces -msgid "Ignore spaces (newline chars not included)" -msgstr "йЗОПТЙТПЧБФШ РТПВЕМЩ (ОЕ ЧЛМАЮБС РЕТЕЧПД УФТПЛЙ)" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline -msgid "Ignore spaces at end of line" -msgstr "йЗОПТЙТПЧБФШ РТПВЕМЩ Ч ЛПОГЕ УФТПЛЙ" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline -msgid "Ignore spaces at start of line" -msgstr "йЗОПТЙТПЧБФШ РТПВЕМЩ Ч ОБЮБМЕ УФТПЛЙ" - -#: lazarusidestrconsts:srkmecimestr -msgid "Ime Str" -msgstr "" - -#: lazarusidestrconsts:lisimportlist -msgid "Import list" -msgstr "уРЙУПЛ ЙНРПТФБ" - -#: lazarusidestrconsts:dlginfrontofmethods -msgid "In front of methods" -msgstr "рЕТЕД НЕФПДБНЙ" - -#: lazarusidestrconsts:lispckoptsinclude -msgid "Include" -msgstr "чЛМАЮБЕФ" - -#: lazarusidestrconsts:dlgassertcode -msgid "Include Assertion Code" -msgstr "чЛМАЮЙФШ ЛПД Assert" - -#: lazarusidestrconsts:dlgcoincfiles -msgid "Include Files (-Fi):" -msgstr "чЛМАЮБЕНЩЕ ЖБКМЩ (-Fi):" - -#: lazarusidestrconsts:lisincludefilter -msgid "Include Filter" -msgstr "" - -#: lazarusidestrconsts:lispkgfiletypeinclude -msgid "Include file" -msgstr "чЛМАЮБЕНЩК ЖБКМ:" - -#: lazarusidestrconsts:lisfindfileincludesubdirectories -msgid "Include sub directories" -msgstr "чЛМАЮЙФШ РПДЛБФБМПЗЙ" - -#: lazarusidestrconsts:dlgincludesystemvariables -msgid "Include system variables" -msgstr "чЛМАЮЙФШ УЙУФЕНОЩЕ РЕТЕНЕООЩЕ" - -#: lazarusidestrconsts:lisuidincludedby -msgid "Included by:" -msgstr "чЛМАЮЈО:" - -#: lazarusidestrconsts:lismenuincrementalfind -msgid "Incremental Find" -msgstr "рПЙУЛ У ОБТБУФБОЙЕН" - -#: lazarusidestrconsts:srkmecblockindent -msgid "Indent block" -msgstr "пФДЕМЙФШ ВМПЛ" - -#: lazarusidestrconsts:dlgindentcodeto -msgid "Indent code to" -msgstr "чЩТПЧОСФШ ЛПД РП" - -#: lazarusidestrconsts:lismenuindentselection -msgid "Indent selection" -msgstr "уДЧЙОХФШ ВМПЛ ЧРТБЧП" - -#: lazarusidestrconsts:lisinformationaboutunit -msgid "Information about %s" -msgstr "йОЖПТНБГЙС П %s" - -#: lazarusidestrconsts:dlgcoinherited -msgid "Inherited" -msgstr "хОБУМЕДПЧБО" - -#: lazarusidestrconsts:srvk_insert -msgid "Insert" -msgstr "чУФБЧЙФШ" - -#: lazarusidestrconsts:lismenuconditionalselection -msgid "Insert $IFDEF..." -msgstr "чУФБЧЙФШ $IFDEF..." - -#: lazarusidestrconsts:srkmecinsertcvsauthor -msgid "Insert CVS keyword Author" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Author" - -#: lazarusidestrconsts:srkmecinsertcvsdate -msgid "Insert CVS keyword Date" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Date" - -#: lazarusidestrconsts:srkmecinsertcvsheader -msgid "Insert CVS keyword Header" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Header" - -#: lazarusidestrconsts:srkmecinsertcvsid -msgid "Insert CVS keyword ID" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS ID" - -#: lazarusidestrconsts:srkmecinsertcvslog -msgid "Insert CVS keyword Log" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Log" - -#: lazarusidestrconsts:srkmecinsertcvsname -msgid "Insert CVS keyword Name" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Name" - -#: lazarusidestrconsts:srkmecinsertcvsrevision -msgid "Insert CVS keyword Revision" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Revision" - -#: lazarusidestrconsts:srkmecinsertcvssource -msgid "Insert CVS keyword Source" -msgstr "чУФБЧЙФШ ЛМАЮЕЧПЕ УМПЧП CVS Source" - -#: lazarusidestrconsts:srkmecinsertchangelogentry -msgid "Insert ChangeLog entry" -msgstr "чУФБЧЙФШ ЬМЕНЕОФ ChangeLog" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp -msgid "Insert Delphi 5 Compiler Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛПНРЙМСФПТБ Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem -msgid "Insert Delphi 5 Directory Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛБФБМПЗБ Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl -msgid "Insert Delphi 5 Project Template" -msgstr "чУФБЧЙФШ ЫБВМПО РТПЕЛФБ Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp -msgid "Insert Delphi 6 Compiler Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛПНРЙМСФПТБ Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem -msgid "Insert Delphi 6 Directory Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛБФБМПЗБ Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl -msgid "Insert Delphi 6 Project Template" -msgstr "чУФБЧЙФШ ЫБВМПО РТПЕЛФБ Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp -msgid "Insert Delphi 7 Compiler Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛПНРЙМСФПТБ Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem -msgid "Insert Delphi 7 Directory Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛБФБМПЗБ Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl -msgid "Insert Delphi 7 Project Template" -msgstr "чУФБЧЙФШ ЫБВМПО РТПЕЛФБ Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert -msgid "Insert Free Pascal Compiler Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛПНРЙМСФПТБ FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte -msgid "Insert Free Pascal Project Template" -msgstr "чУФБЧЙФШ ЫБВМПО РТПЕЛФБ FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource -msgid "Insert Free Pascal SVN Source Template" -msgstr "" - -#: lazarusidestrconsts:lismenueditorinsertfromtemplate -msgid "Insert From Template..." -msgstr "чУФБЧЙФШ ЫБВМПО ЖПТНЩ..." - -#: lazarusidestrconsts:srkmecinsertgplnotice -msgid "Insert GPL notice" -msgstr "чУФБЧЙФШ ЪБНЕФЛХ П GPL" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp -msgid "Insert Kylix 3 Compiler Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛПНРЙМСФПТБ Kylix 3" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem -msgid "Insert Kylix 3 Directory Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛБФБМПЗБ Kylix 3" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl -msgid "Insert Kylix 3 Project Template" -msgstr "чУФБЧЙФШ ЫБВМПО РТПЕЛФБ Kylix 3" - -#: lazarusidestrconsts:srkmecinsertlgplnotice -msgid "Insert LGPL notice" -msgstr "чУФБЧЙФШ ЪБНЕФЛХ П LGPL" - -#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem -msgid "Insert Lazarus Directory Template" -msgstr "чУФБЧЙФШ ЫБВМПО ЛБФБМПЗБ Lazarus" - -#: lazarusidestrconsts:lisctinsertmacro -msgid "Insert Macro" -msgstr "" - -#: lazarusidestrconsts:srkmecinsertmode -msgid "Insert Mode" -msgstr "тЕЦЙН ЧУФБЧЛЙ" - -#: lazarusidestrconsts:lismenueditorinsertnewitemafter -msgid "Insert New Item (after)" -msgstr "чУФБЧЙФШ ОПЧЩК РХОЛФ (РПУМЕ)" - -#: lazarusidestrconsts:lismenueditorinsertnewitembefore -msgid "Insert New Item (before)" -msgstr "чУФБЧЙФШ ОПЧЩК РХОЛФ (РЕТЕД)" - -#: lazarusidestrconsts:liscodetoolsdefsinserttemplate -msgid "Insert Template" -msgstr "чУФБЧЙФШ ЫБВМПО" - -#: lazarusidestrconsts:lismakeresstrinsertalphabetically -msgid "Insert alphabetically" -msgstr "чУФБЧЙФШ РП БМЖБЧЙФХ" - -#: lazarusidestrconsts:lislazdochintboldformat -msgid "Insert bold formatting tag" -msgstr "" - -#: lazarusidestrconsts:lislazdochintinsertcodetag -msgid "Insert code formatting tag" -msgstr "" - -#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive -msgid "Insert context sensitive" -msgstr "чУФБЧЙФШ У ХЮЈФПН ЛПОФЕЛУФБ" - -#: lazarusidestrconsts:srkmecinsertdatetime -msgid "Insert current date and time" -msgstr "чУФБЧЙФШ ФЕЛХЭЙЕ ДБФХ Й ЧТЕНС" - -#: lazarusidestrconsts:srkmecinsertusername -msgid "Insert current username" -msgstr "чУФБЧЙФШ ФЕЛХЭЕЕ ЙНС РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:lismenuinsertcharacter -msgid "Insert from Character Map" -msgstr "чУФБЧЙФШ ЙЪ ФБВМЙГЩ УЙНЧПМПЧ" - -#: lazarusidestrconsts:srkmecinsertcharacter -msgid "Insert from Charactermap" -msgstr "чУФБЧЙФШ ЙЪ ФБВМЙГЩ УЙНЧПМПЧ" - -#: lazarusidestrconsts:lislazdochintitalicformat -msgid "Insert italic formatting tag" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild -msgid "Insert node as child" -msgstr "чУФБЧЙФШ ЬМЕНЕОФ ЛБЛ ДПЮЕТОЙК" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow -msgid "Insert node below" -msgstr "чУФБЧЙФШ ЬМЕНЕОФ ОЙЦЕ" - -#: lazarusidestrconsts:lislazdochintremarktag -msgid "Insert remark formatting tag" -msgstr "" - -#: lazarusidestrconsts:dlginsspaceafter -msgid "Insert space after" -msgstr "чУФБЧМСФШ РТПВЕМЩ РПУМЕ" - -#: lazarusidestrconsts:dlginsspacefront -msgid "Insert space in front of" -msgstr "чУФБЧМСФШ РТПВЕМЩ РЕТЕД" - -#: lazarusidestrconsts:lismenuinserttext -msgid "Insert text" -msgstr "чУФБЧЙФШ ФЕЛУФ" - -#: lazarusidestrconsts:lislazdochintunderlineformat -msgid "Insert underline formatting tag" -msgstr "" - -#: lazarusidestrconsts:lislazdochintvartag -msgid "Insert var formatting tag" -msgstr "" - -#: lazarusidestrconsts:lismenuinspect -msgid "Inspect ..." -msgstr "уМЕДЙФШ ЪБ ..." - -#: lazarusidestrconsts:lispckeditinstall -msgid "Install" -msgstr "хУФБОПЧЙФШ" - -#: lazarusidestrconsts:lispckexplinstallonnextstart -msgid "Install on next start" -msgstr "хУФБОПЧЙФШ РТЙ УМЕД. ЪБРХУЛЕ" - -#: lazarusidestrconsts:lispckeditinstallpackageintheide -msgid "Install package in the IDE" -msgstr "хУФБОПЧЙФШ РБЛЕФ Ч IDE" - -#: lazarusidestrconsts:lisinstallselection -msgid "Install selection" -msgstr "хУФБОПЧЙФШ ЧЩВТБООПЕ" - -#: lazarusidestrconsts:lisinstallationfailed -msgid "Installation failed" -msgstr "" - -#: lazarusidestrconsts:lispckexplinstalled -msgid "Installed" -msgstr "хУФБОПЧМЕО" - -#: lazarusidestrconsts:lisinstalledpackages -msgid "Installed Packages" -msgstr "хУФБОПЧМЕООЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac -msgid "Installing the package %s will automatically install the package:" -msgstr "" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 -msgid "Installing the package %s will automatically install the packages:" -msgstr "" - -#: lazarusidestrconsts:dlgintvinsec -msgid "Interval in secs" -msgstr "йОФЕТЧБМ Ч УЕЛ" - -#: lazarusidestrconsts:lisa2pinvalidancestortype -msgid "Invalid Ancestor Type" -msgstr "оЕРТБЧЙМШОЩК ФЙР РТЕДЛБ" - -#: lazarusidestrconsts:lisa2pinvalidcircle -msgid "Invalid Circle" -msgstr "оЕРТБЧЙМШОЩК ГЙЛМ" - -#: lazarusidestrconsts:lisa2pinvalidclassname -msgid "Invalid Class Name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЛМБУУБ" - -#: lazarusidestrconsts:lisinvalidcompilerfilename -msgid "Invalid Compiler Filename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЖБКМБ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:lispublprojinvalidexcludefilter -msgid "Invalid Exclude filter" -msgstr "оЕРТБЧЙМШОЩК ЖЙМШФТ ЙУЛМАЮЕОЙК" - -#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory -msgid "Invalid Free Pascal source directory" -msgstr "оЕРТБЧЙМШОЩК ЛБФБМПЗ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:lisfriinvalididentifier -msgid "Invalid Identifier" -msgstr "оЕЛПТТЕЛФОЩК ЙДЕОФЙЖЙЛБФПТ" - -#: lazarusidestrconsts:lispublprojinvalidincludefilter -msgid "Invalid Include filter" -msgstr "оЕРТБЧЙМШОЩК ЖЙМШФТ ЧЛМАЮЕОЙК" - -#: lazarusidestrconsts:lisprojaddinvalidminmaxversion -msgid "Invalid Min-Max version" -msgstr "оЕРТБЧЙМШОЩЕ ЧЕТУЙЙ (НЙОЙНБМШОБС/НБЛУЙНБМШОБС)" - -#: lazarusidestrconsts:lisaf2pinvalidpackage -msgid "Invalid Package" -msgstr "оЕРТБЧЙМШОЩК РБЛЕФ" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename2 -msgid "Invalid Package Name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС РБЛЕФБ" - -#: lazarusidestrconsts:lisinvalidpascalidentifiercap -msgid "Invalid Pascal Identifier" -msgstr "оЕЛПТТЕЛФОЩК ЙДЕОФЙЖЙЛБФПТ РБУЛБМС" - -#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect -msgid "Invalid Resourcestring section" -msgstr "оЕРТБЧЙМШОБС УЕЛГЙС Resourcestring" - -#: lazarusidestrconsts:lisa2pinvalidunitname -msgid "Invalid Unit Name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС НПДХМС" - -#: lazarusidestrconsts:lispkgsysinvalidunitname -msgid "Invalid Unitname: %s" -msgstr "оЕРТБЧЙМШОПЕ ЙНС НПДХМС: %s" - -#: lazarusidestrconsts:lisinvalidcommand -msgid "Invalid command" -msgstr "оЕРТБЧЙМШОБС ЛПНБОДБ" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename -msgid "Invalid compiler filename" -msgstr "оЕЛПТТЕЛФОПЕ ЙНС ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:lispkgsysinvalidcomponentclass -msgid "Invalid component class" -msgstr "оЕРТБЧЙМШОЩК ЛМБУУ ЛПНРПОЕОФБ" - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename -msgid "Invalid debugger filename" -msgstr "оЕЛПТТЕЛФОПЕ ЙНС ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lisinvaliddelete -msgid "Invalid delete" -msgstr "оЕДПРХУФЙНПЕ ХДБМЕОЙЕ" - -#: lazarusidestrconsts:lisinvaliddestinationdirectory -msgid "Invalid destination directory" -msgstr "оЕРТБЧЙМШОЩК ЛБФБМПЗ ОБЪОБЮЕОЙС" - -#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction -msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." -msgstr "оЕРТБЧЙМШОПЕ ЧЩТБЦЕОЙЕ.%sрПДУЛБЪЛБ: ЖХОЛГЙС уПЪДБФШ УФТПЛХ ТЕУХТУПЧ ФТЕВХЕФ УФТПЛПЧХА ЛПОУФБОФХ Ч ПДОПН ЖБКМЕ. чЩДЕМЙФЕ ЧЩТБЦЕОЙЕ Й РПРТПВХКФЕ ЕЭЈ." - -#: lazarusidestrconsts:lisa2pinvalidfile -msgid "Invalid file" -msgstr "оЕРТБЧЙМШОЩК ЖБКМ" - -#: lazarusidestrconsts:lispkgmanginvalidfileextension -msgid "Invalid file extension" -msgstr "оЕРТБЧЙМШОПЕ ТБУЫЙТЕОЙЕ ЖБКМБ" - -#: lazarusidestrconsts:lisa2pinvalidfilename -msgid "Invalid filename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЖБКМБ" - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename -msgid "Invalid make filename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЖБКМБ make" - -#: lazarusidestrconsts:lispckeditinvalidmaximumversion -msgid "Invalid maximum version" -msgstr "оЕРТБЧЙМШОБС НБЛУЙНБМШОБС ЧЕТУЙС" - -#: lazarusidestrconsts:lispckeditinvalidminimumversion -msgid "Invalid minimum version" -msgstr "оЕРТБЧЙМШОБС НЙОЙНБМШОБС ЧЕТУЙС" - -#: lazarusidestrconsts:lisinvalidmultiselection -msgid "Invalid multiselection" -msgstr "оЕРТБЧЙМШОЩК НОПЦЕУФЧЕООЩК ЧЩВПТ" - -#: lazarusidestrconsts:fdinvalidmutliselectioncap -msgid "Invalid mutliselection" -msgstr "оЕРТБЧЙМШОЩК НОПЦЕУФЧЕООЩК ЧЩВПТ" - -#: lazarusidestrconsts:lisaf2pinvalidpackageid -msgid "Invalid package ID: %s%s%s" -msgstr "оЕРТБЧЙМШОЩК ЙДЕОФЙЖЙЛБФПТ РБЛЕФБ: %s%s%s" - -#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension -msgid "Invalid package file extension" -msgstr "оЕРТБЧЙМШОПЕ ТБУЫЙТЕОЙЕ ЖБКМБ РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmanginvalidpackagefilename -msgid "Invalid package filename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЖБКМБ РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename -msgid "Invalid package name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС РБЛЕФБ" - -#: lazarusidestrconsts:lispckoptsinvalidpackagetype -msgid "Invalid package type" -msgstr "оЕРТБЧЙМШОЩК ФЙР РБЛЕФБ" - -#: lazarusidestrconsts:lisprojaddinvalidpackagename -msgid "Invalid packagename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС РБЛЕФБ" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparent -msgid "Invalid parent" -msgstr "оЕРТБЧЙМШОЩК \"РТЕДПЛ\"" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode -msgid "Invalid parent node" -msgstr "оЕРТБЧЙМШОЩК ТПДЙФЕМШУЛЙК ЬМЕНЕОФ" - -#: lazarusidestrconsts:lisprojaddinvalidpascalunitname -msgid "Invalid pascal unit name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС НПДХМС РБУЛБМС" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode -msgid "Invalid previous node" -msgstr "оЕРТБЧЙМШОЩК РТЕДЩДХЭЙК ЬМЕНЕОФ" - -#: lazarusidestrconsts:lisinvalidprocname -msgid "Invalid proc name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС РТПГ-ТЩ" - -#: lazarusidestrconsts:lisinvalidprojectfilename -msgid "Invalid project filename" -msgstr "оЕРТБЧЙМШОПЕ ЙНС ЖБКМБ РТПЕЛФБ" - -#: lazarusidestrconsts:lisinvalidselection -msgid "Invalid selection" -msgstr "оЕРТБЧЙМШОПЕ ЧЩДЕМЕОЙЕ" - -#: lazarusidestrconsts:lissvuoinvalidvariablename -msgid "Invalid variable name" -msgstr "оЕРТБЧЙМШОПЕ ЙНС РЕТЕНЕООПК" - -#: lazarusidestrconsts:lisprojaddinvalidversion -msgid "Invalid version" -msgstr "оЕРТБЧЙМШОБС ЧЕТУЙС" - -#: lazarusidestrconsts:ueminvertassignment -msgid "Invert Assignment" -msgstr "йОЧЕТФЙТПЧБФШ РТЙУЧПЕОЙЕ" - -#: lazarusidestrconsts:srkmecinvertassignment -msgid "Invert assignment" -msgstr "йОЧЕТФЙТПЧБФШ РТЙУЧПЕОЙЕ" - -#: lazarusidestrconsts:srvk_irregular -msgid "Irregular " -msgstr "оЕТЕЗХМСТОЩК " - -#: lazarusidestrconsts:rslanguageitalian -msgid "Italian" -msgstr "ЙФБМШСОУЛЙК" - -#: lazarusidestrconsts:rslanguageitalianiso -msgid "Italian(ISO 8859-1)" -msgstr "йФБМШСОУЛЙК (ISO 8859-1)" - -#: lazarusidestrconsts:dlgedital -msgid "Italic" -msgstr "лХТУЙЧ" - -#: lazarusidestrconsts:dlgoiitemheight -msgid "Item height" -msgstr "чЩУПФБ ЬМЕНЕОФБ" - -#: lazarusidestrconsts:rslanguagejapanese -msgid "Japanese" -msgstr "" - -#: lazarusidestrconsts:lismenujumpback -msgid "Jump back" -msgstr "рЕТЕИПД ОБЪБД" - -#: lazarusidestrconsts:lismenujumpforward -msgid "Jump forward" -msgstr "рЕТЕИПД ЧРЕТЕД" - -#: lazarusidestrconsts:lismenujumpto -msgid "Jump to" -msgstr "" - -#: lazarusidestrconsts:lismenujumptonextbookmark -msgid "Jump to next bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenujumptonexterror -msgid "Jump to next error" -msgstr "рЕТЕИПД Л УМЕД. ПЫЙВЛЕ" - -#: lazarusidestrconsts:lismenujumptoprevbookmark -msgid "Jump to previous bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenujumptopreverror -msgid "Jump to previous error" -msgstr "рЕТЕИПД Л РТЕД. ПЫЙВЛЕ" - -#: lazarusidestrconsts:dlgjumpingetc -msgid "Jumping (e.g. Method Jumping)" -msgstr "рЕТЕИПД (ОБРТЙНЕТ, РП НЕФПДХ)" - -#: lazarusidestrconsts:srvk_junja -msgid "Junja" -msgstr "Junja" - -#: lazarusidestrconsts:srvk_kana -msgid "Kana" -msgstr "Kana" - -#: lazarusidestrconsts:liscldirkeepalltextfiles -msgid "Keep all text files" -msgstr "пУФБЧМСФШ ЧУЕ ФЕЛУФПЧЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:dlgkeepcaretx -msgid "Keep caret X position" -msgstr "" - -#: lazarusidestrconsts:dlgcokeepvarsreg -msgid "Keep certain variables in registers" -msgstr "иТБОЙФШ ОЕЛ. РЕТЕНЕООЩЕ Ч ТЕЗЙУФТБИ" - -#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter -msgid "Keep files matching filter" -msgstr "уПИТБОСФШ ЖБКМЩ, УППФЧ. ЖЙМШФТХ" - -#: lazarusidestrconsts:liskeepname -msgid "Keep name" -msgstr "" - -#: lazarusidestrconsts:dlgforwardprocskeeporder -msgid "Keep order of procedures" -msgstr "уПИТБОСФШ РПТСДПЛ РТПГЕДХТ" - -#: lazarusidestrconsts:srkmkey -msgid "Key" -msgstr "лМБЧЙЫБ" - -#: lazarusidestrconsts:dlgkeymappingscheme -msgid "Key Mapping Scheme" -msgstr "уИЕНБ ТБУЛМБДЛЙ ЛМБЧЙЫ" - -#: lazarusidestrconsts:dlgkeymapping -msgid "Key Mappings" -msgstr "лМБЧЙЫЙ" - -#: lazarusidestrconsts:dlgkeymappingerrors -msgid "Key mapping errors" -msgstr "пЫЙВЛЙ ЛПНВЙОБГЙК ЛМБЧЙЫ" - -#: lazarusidestrconsts:liscodetoolsoptskeyword -msgid "Keyword" -msgstr "лМАЮЕЧПЕ УМПЧП" - -#: lazarusidestrconsts:dlgkeywordpolicy -msgid "Keyword policy" -msgstr "рПМЙФЙЛБ ЛМАЮЕЧЩИ УМПЧ" - -#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions -msgid "LCL Interface specific options:" -msgstr "пРГЙЙ LCL, ЪБЧЙУСЭЙЕ ПФ ЙОФЕТЖЕКУБ:" - -#: lazarusidestrconsts:lislclwidgettype -msgid "LCL Widget Type" -msgstr "фЙР ЬМЕНЕОФБ ХРТБЧМЕОЙС LCL" - -#: lazarusidestrconsts:lislazbuildlclinterface -msgid "LCL interface" -msgstr "ЙОФЕТЖЕКУ LCL" - -#: lazarusidestrconsts:lislclunitpathmissing -msgid "LCL unit path missing" -msgstr "пФУХФУФЧХЕФ РХФШ НПДХМС LCL" - -#: lazarusidestrconsts:lispkgfiletypelfm -msgid "LFM - Lazarus form text" -msgstr "LFM - ФЕЛУФ ЖПТНЩ Lazarus" - -#: lazarusidestrconsts:lislfmfile -msgid "LFM file" -msgstr "жБКМ LFM" - -#: lazarusidestrconsts:lislfmfilecorrupt -msgid "LFM file corrupt" -msgstr "жБКМ LFM РПЧТЕЦДЈО" - -#: lazarusidestrconsts:lislfmfilenotfound -msgid "LFM file not found" -msgstr "жБКМ LFM ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lismenuinsertlgplnotice -msgid "LGPL notice" -msgstr "ъБНЕФЛБ П LGPL" - -#: lazarusidestrconsts:lispkgfiletypelrs -msgid "LRS - Lazarus resource" -msgstr "LRS - ТЕУХТУ Lazarus" - -#: lazarusidestrconsts:dlgenvlanguage -msgid "Language" -msgstr "сЪЩЛ" - -#: lazarusidestrconsts:dlglang -msgid "Language:" -msgstr "сЪЩЛ:" - -#: lazarusidestrconsts:dlgcdtlast -msgid "Last" -msgstr "рПУМЕДОЙН" - -#: lazarusidestrconsts:dlglast -msgid "Last (i.e. at end of source)" -msgstr "рПУМЕДОЙК (Ф.Е. Ч ЛПОГЕ ЙУИПДОЙЛБ)" - -#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox -msgid "Launching application" -msgstr "" - -#: lazarusidestrconsts:lislaunchingapplicationinvalid -msgid "Launching application invalid" -msgstr "ъБРХУЛБАЭЕЕ РТЙМПЦЕОЙЕ ОЕДПРХУФЙНП" - -#: lazarusidestrconsts:lislaunchingcmdline -msgid "Launching target command line" -msgstr "лПНБОДОБС УФТПЛБ ДМС ЪБРХУЛБ" - -#: lazarusidestrconsts:lislazdoc -msgid "LazDoc" -msgstr "" - -#: lazarusidestrconsts:lismenulazdoc -msgid "LazDoc Editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocmainformcaption -msgid "LazDoc editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocpathsgroupbox -msgid "LazDoc settings" -msgstr "" - -#: lazarusidestrconsts:lispkgmanglazarus -msgid "Lazarus" -msgstr "" - -#: lazarusidestrconsts:lislazarusdesktopsettings -msgid "Lazarus Desktop Settings" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory -msgid "Lazarus Directory" -msgstr "лБФБМПЗ Lazarus" - -#: lazarusidestrconsts:lislazaruseditorv -msgid "Lazarus Editor v%s" -msgstr "тЕДБЛФПТ Lazarus v%s" - -#: lazarusidestrconsts:lislazarusfile -msgid "Lazarus File" -msgstr "" - -#: lazarusidestrconsts:lislazarusprojectinfofile -msgid "Lazarus Project Info file" -msgstr "" - -#: lazarusidestrconsts:locwndsrceditor -msgid "Lazarus Source Editor" -msgstr "тЕДБЛФПТ ЙУИПДОПЗП ЛПДБ Lazarus" - -#: lazarusidestrconsts:lisconfigdirectory -msgid "Lazarus config directory" -msgstr "лБФБМПЗ ЛПОЖЙЗХТБГЙЙ Lazarus" - -#: lazarusidestrconsts:lislazarusdirectory -msgid "Lazarus directory" -msgstr "лБФБМПЗ Lazarus" - -#: lazarusidestrconsts:dlglazarusdir -msgid "Lazarus directory (default for all projects)" -msgstr "лБФБМПЗ Lazarus (ПВЭЙК ДМС ЧУЕИ РТПЕЛФПЧ)" - -#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg -msgid "Lazarus directory \"%s\" not found." -msgstr "лБФБМПЗ Lazarus \"%s\" ОЕ ОБКДЕО." - -#: lazarusidestrconsts:lislazarusdirectorynotfound -msgid "Lazarus directory not found" -msgstr "лБФБМПЗ Lazarus ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lislazarusform -msgid "Lazarus form" -msgstr "" - -#: lazarusidestrconsts:lislazaruspackage -msgid "Lazarus package" -msgstr "" - -#: lazarusidestrconsts:lislazarusproject -msgid "Lazarus project" -msgstr "" - -#: lazarusidestrconsts:lislazarusprojectsource -msgid "Lazarus project source" -msgstr "" - -#: lazarusidestrconsts:lislazarusunit -msgid "Lazarus unit" -msgstr "" - -#: lazarusidestrconsts:lisleaveemptyfo -msgid "Leave empty for default .po file" -msgstr "пУФБЧШФЕ РХУФЩН ДМС ЖБКМБ .po РП ХНПМЮБОЙА" - -#: lazarusidestrconsts:srvk_left -msgid "Left" -msgstr "чМЕЧП" - -#: lazarusidestrconsts:lisleftsides -msgid "Left sides" -msgstr "мЕЧЩЕ ЛТБС" - -#: lazarusidestrconsts:lisleftspaceequally -msgid "Left space equally" -msgstr "" - -#: lazarusidestrconsts:dlgleftpos -msgid "Left:" -msgstr "уМЕЧБ:" - -#: lazarusidestrconsts:dlglevelnoneopt -msgid "Level 0 (no extra Optimizations)" -msgstr "хТПЧЕОШ 0 (ВЕЪ ПУПВПК ПРФЙНЙЪБГЙЙ)" - -#: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "хТПЧЕОШ 1 (ВЩУФТБС)" - -#: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "хТПЧЕОШ 2 (ХТПЧЕОШ 1 + ВПМЕЕ НЕДМЕООБС)" - -#: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "хТПЧЕОШ 3 (ХТПЧЕОШ 3 + ОЕУФБОДБТФОБС)" - -#: lazarusidestrconsts:dlgcolibraries -msgid "Libraries (-Fl):" -msgstr "вЙВМЙПФЕЛЙ (-Fl):" - -#: lazarusidestrconsts:lispckoptslibrary -msgid "Library" -msgstr "вЙВМЙПФЕЛБ" - -#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin -msgid "Library%sA freepascal library (.dll under windows, .so under linux, .so under macosx). The library source file is automatically maintained by Lazarus." -msgstr "" - -#: lazarusidestrconsts:lispckoptslicense -msgid "License:" -msgstr "мЙГЕОЪЙС:" - -#: lazarusidestrconsts:lisaboutlazarusmsg -msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers." -msgstr "мЙГЕОЪЙС: GPL/LGPL%sLazarus - ЬФП ВЙВМЙПФЕЛЙ ЛМБУУПЧ ДМС FreePascal, ЬНХМЙТХАЭЙЕ Delphi. FreePascal - ЬФП (L)GPL'ШОЩК ЛПНРЙМСФПТ, ТБВПФБАЭЙК РПД Linux, Win32, OS/2, 68K Й ДТ. FreePascal ТБЪТБВПФБО, ЮФПВЩ ТБЪВЙТБФШ Й ЛПНРЙМЙТПЧБФШ РТПЗТБННЩ У УЙОФБЛУЙУПН Delphi, ЛПФПТЩК, ЕУФЕУФЧЕООП, ппр.%sLazarus - ОЕДПУФБАЭЕЕ ЪЧЕОП ГЕРЙ, РПЪЧПМСАЭЕК чБН ТБЪТБВБФЩЧБФШ РТПЗТБННЩ ФЙРБ Delphi ОБ ЧУЕИ ЧЩЫЕХЛБЪБООЩИ РМБФЖПТНБИ. IDE ЧДТХЗ УФБОЕФ ЙОУФТХНЕОФПН RAD, ЛБЛ Delphi.%sф.Л. РТПЕЛФ Lazarus ТБУФЈФ, ОБН ОХЦОП ВПМШЫЕ ТБЪТБВПФЮЙЛПЧ." - -#: lazarusidestrconsts:listodolline -msgid "Line" -msgstr "уФТПЛБ" - -#: lazarusidestrconsts:dlglinesplitting -msgid "Line Splitting" -msgstr "тБЪТЩЧ УФТПЛ" - -#: lazarusidestrconsts:srkmeclineselect -msgid "Line selection mode" -msgstr "тЕЦЙН ЧЩВПТБ УФТПЛ" - -#: lazarusidestrconsts:lissortsellines -msgid "Lines" -msgstr "уФТПЛЙ" - -#: lazarusidestrconsts:lisuidlines -msgid "Lines:" -msgstr "" - -#: lazarusidestrconsts:dlglinksmart -msgid "Link Smart" -msgstr "хНОПЕ УЧСЪЩЧБОЙЕ" - -#: lazarusidestrconsts:dlglinklibraries -msgid "Link Style:" -msgstr "уФЙМШ УВПТЛЙ:" - -#: lazarusidestrconsts:lispckoptslinker -msgid "Linker" -msgstr "мЙОЛЕТ" - -#: lazarusidestrconsts:dlgcolinking -msgid "Linking" -msgstr "уЧСЪЩЧБОЙЕ" - -#: lazarusidestrconsts:dlgloaddfile -msgid "Load desktop settings from file" -msgstr "ъБЗТ. ТБВПЮЙК УФПМ ЙЪ ЖБКМБ" - -#: lazarusidestrconsts:dlgcoloadsave -msgid "Load/Save" -msgstr "ъБЗТХЪЛБ/УПИТБОЕОЙЕ" - -#: lazarusidestrconsts:lispckexplloadedpackages -msgid "Loaded Packages:" -msgstr "ъБЗТХЦЕООЩЕ РБЛЕФЩ:" - -#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage -msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" -msgstr "ъБЗТХЪЛБ РБЛЕФБ %s ЪБНЕОЙФ РБЛЕФ %s%sЙЪ ЖБКМБ %s.%sуФБТЩК РБЛЕФ ЙЪНЕОЈО. уПИТБОЙФШ УФБТЩК РБЛЕФ %s?" - -#: lazarusidestrconsts:dlgrunolocal -msgid "Local" -msgstr "мПЛБМШОЩЕ" - -#: lazarusidestrconsts:lismenuviewlocalvariables -msgid "Local Variables" -msgstr "мПЛБМШОЩЕ РЕТЕНЕООЩЕ" - -#: lazarusidestrconsts:lismenulowercaseselection -msgid "Lowercase selection" -msgstr "оЙЦОЙК ТЕЗЙУФТ ЧЩДЕМЕОЙС" - -#: lazarusidestrconsts:dlg1up2low -msgid "Lowercase, first letter up" -msgstr "фПМШЛП 1С ВХЛЧБ ЪБЗМБЧОБС" - -#: lazarusidestrconsts:lisedtexttoolmacros -msgid "Macros" -msgstr "нБЛТПУЩ" - -#: lazarusidestrconsts:dlgmainmenu -msgid "Main Menu" -msgstr "зМБЧОПЕ НЕОА" - -#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements -msgid "Main Unit has Application.CreateForm statements" -msgstr "зМБЧОЩК НПДХМШ ЙНЕЕФ ЧЩТБЦЕОЙС Application.CreateForm" - -#: lazarusidestrconsts:lismainunithasapplicationtitlestatements -msgid "Main Unit has Application.Title statements" -msgstr "зМБЧОЩК НПДХМШ ЙНЕЕФ ЧЩТБЦЕОЙЕ Application.Title" - -#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject -msgid "Main Unit has Uses Section containing all Units of project" -msgstr "зМБЧОЩК НПДХМШ ЙНЕЕФ УЕЛГЙА uses, ЧЛМАЮБАЭХА ЧУЕ НПДХМЙ РТПЕЛФБ" - -#: lazarusidestrconsts:lismainunitispascalsource -msgid "Main Unit is Pascal Source" -msgstr "зМБЧОЩК НПДХМШ - ЙУИПДОЙЛ рБУЛБМС" - -#: lazarusidestrconsts:lispckoptsmajor -msgid "Major" -msgstr "зМБЧОБС" - -#: lazarusidestrconsts:lismakeexe -msgid "Make Executable" -msgstr "уПЪДБФШ ЙУРПМОСЕНЩК" - -#: lazarusidestrconsts:lismenumakeresourcestring -msgid "Make Resource String" -msgstr "уПЪДБФШ УФТПЛХ ТЕУХТУПЧ" - -#: lazarusidestrconsts:lismakeresourcestring -msgid "Make ResourceString" -msgstr "уПЪДБФШ УФТПЛХ ТЕУХТУПЧ" - -#: lazarusidestrconsts:lismakenotfound -msgid "Make not found" -msgstr "оЕ ОБКДЕО Make" - -#: lazarusidestrconsts:dlgmakepath -msgid "Make path" -msgstr "РХФШ Л Make" - -#: lazarusidestrconsts:srkmecmakeresourcestring -msgid "Make resource string" -msgstr "уПЪДБФШ УФТПЛХ ТЕУХТУПЧ" - -#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically -msgid "Manual compilation (never automatically)" -msgstr "тХЮОБС ЛПНРЙМСГЙС (ОЕ БЧФПНБФЙЮЕУЛЙ)" - -#: lazarusidestrconsts:dlgmargingutter -msgid "Margin and gutter" -msgstr "зТБОЙГЩ" - -#: lazarusidestrconsts:dlgmarkercolor -msgid "Marker color" -msgstr "гЧЕФ НБТЛЕТБ" - -#: lazarusidestrconsts:lissmatches -msgid "Matches" -msgstr "" - -#: lazarusidestrconsts:dlgmaxlinelength -msgid "Max line length:" -msgstr "max ДМЙОБ УФТПЛЙ:" - -#: lazarusidestrconsts:dlgmaxrecentfiles -msgid "Max recent files" -msgstr "рТЕДЕМ ОЕДБЧОЙИ ЖБКМПЧ" - -#: lazarusidestrconsts:dlgmaxrecentprojs -msgid "Max recent project files" -msgstr "рТЕДЕМ ОЕДБЧОЙИ РТПЕЛФПЧ" - -#: lazarusidestrconsts:lisexttoolmaximumtoolsreached -msgid "Maximum Tools reached" -msgstr "дПУФЙЗОХФ РТЕДЕМ ЙОУФТХНЕОФПЧ" - -#: lazarusidestrconsts:lisprojaddmaximumversionoptional -msgid "Maximum Version (optional):" -msgstr "нБЛУ. ЧЕТУЙС (РП ЧЩВПТХ):" - -#: lazarusidestrconsts:lispckeditmaximumversion -msgid "Maximum Version:" -msgstr "нБЛУ. ЧЕТУЙС" - -#: lazarusidestrconsts:dlgmaxcntr -msgid "Maximum counter" -msgstr "нБЛУЙНБМШОЩК УЮЕФЮЙЛ" - -#: lazarusidestrconsts:srvk_menu -msgid "Menu" -msgstr "нЕОА" - -#: lazarusidestrconsts:lismenueditormenueditor -msgid "Menu Editor" -msgstr "тЕДБЛФПТ НЕОА" - -#: lazarusidestrconsts:lismenuviewmessages -msgid "Messages" -msgstr "уППВЭЕОЙС..." - -#: lazarusidestrconsts:dlgmethodinspolicy -msgid "Method insert policy" -msgstr "рПМЙФЙЛБ ЧУФБЧЛЙ НЕФПДПЧ" - -#: lazarusidestrconsts:dlgminimizeallonminimizemain -msgid "Minimize all on minimize main" -msgstr "нЙОЙНЙЪЙТПЧБФШ ЧУЕ РТЙ НЙОЙНЙЪБГЙЙ ЗМБЧОПК" - -#: lazarusidestrconsts:lisprojaddminimumversionoptional -msgid "Minimum Version (optional):" -msgstr "нЙОЙН. ЧЕТУЙС (РП ЧЩВПТХ):" - -#: lazarusidestrconsts:lispckeditminimumversion -msgid "Minimum Version:" -msgstr "нЙОЙН. ЧЕТУЙС:" - -#: lazarusidestrconsts:lispckoptsminor -msgid "Minor" -msgstr "чФПТЙЮОБС" - -#: lazarusidestrconsts:fdmmirrorhorizontal -msgid "Mirror horizontal" -msgstr "пФТБЪЙФШ РП ЗПТЙЪПОФБМЙ" - -#: lazarusidestrconsts:fdmmirrorvertical -msgid "Mirror vertical" -msgstr "пФТБЪЙФШ РП ЧЕТФЙЛБМЙ" - -#: lazarusidestrconsts:dlgenvmisc -msgid "Miscellaneous" -msgstr "тБЪОПЕ" - -#: lazarusidestrconsts:lismissingpackages -msgid "Missing Packages" -msgstr "пФУХФУФЧХАЭЙЕ РБЛЕФЩ" - -#: lazarusidestrconsts:dlgmixmethodsandproperties -msgid "Mix methods and properties" -msgstr "уНЕЫЙЧБФШ НЕФПДЩ Й УЧПКУФЧБ" - -#: lazarusidestrconsts:srvk_modechange -msgid "Mode Change" -msgstr "уНЕОЙФШ ТЕЦЙН" - -#: lazarusidestrconsts:uemodified -msgid "Modified" -msgstr "йЪНЕОЈО" - -#: lazarusidestrconsts:lispckeditmodified -msgid "Modified: %s" -msgstr "йЪНЕОЈО: %s" - -#: lazarusidestrconsts:lispckeditmore -msgid "More ..." -msgstr "вПМШЫЕ..." - -#: lazarusidestrconsts:srvk_lbutton -msgid "Mouse Button Left" -msgstr "мЕЧБС ЛОПРЛБ НЩЫЙ" - -#: lazarusidestrconsts:srvk_mbutton -msgid "Mouse Button Middle" -msgstr "уТЕДОСС ЛОПРЛБ НЩЫЙ" - -#: lazarusidestrconsts:srvk_rbutton -msgid "Mouse Button Right" -msgstr "рТБЧБС ЛОПРЛБ НЩЫЙ" - -#: lazarusidestrconsts:dlgmouselinks -msgid "Mouse links" -msgstr "уУЩМЛЙ НЩЫЙ" - -#: lazarusidestrconsts:lisexttoolmovedown -msgid "Move Down" -msgstr "уДЧЙОХФШ ЧОЙЪ" - -#: lazarusidestrconsts:lismenueditormovedown -msgid "Move Down (or right)" -msgstr "" - -#: lazarusidestrconsts:uemmoveeditorleft -msgid "Move Editor Left" -msgstr "рПДЧЙОХФШ УФТБОЙГХ ЧМЕЧП" - -#: lazarusidestrconsts:uemmoveeditorright -msgid "Move Editor Right" -msgstr "рПДЧЙОХФШ УФТБОЙГХ ЧРТБЧП" - -#: lazarusidestrconsts:lisexttoolmoveup -msgid "Move Up" -msgstr "чЧЕТИ" - -#: lazarusidestrconsts:lismenueditormoveup -msgid "Move Up (or left)" -msgstr "" - -#: lazarusidestrconsts:lisdsgorderbackone -msgid "Move component one back" -msgstr "" - -#: lazarusidestrconsts:lisdsgorderforwardone -msgid "Move component one forward" -msgstr "" - -#: lazarusidestrconsts:lisdsgordermovetoback -msgid "Move component to back" -msgstr "" - -#: lazarusidestrconsts:lisdsgordermovetofront -msgid "Move component to front" -msgstr "" - -#: lazarusidestrconsts:srkmecpagedown -msgid "Move cursor down one page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ЧОЙЪ ОБ 1 УФТБОЙГХ" - -#: lazarusidestrconsts:srkmecpageleft -msgid "Move cursor left one page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ЧМЕЧП ОБ 1 УФТБОЙГХ" - -#: lazarusidestrconsts:srkmecpageright -msgid "Move cursor right one page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ЧРТБЧП ОБ 1 УФТБОЙГХ" - -#: lazarusidestrconsts:srkmeceditortop -msgid "Move cursor to absolute beginning" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч УБНПЕ ОБЮБМП" - -#: lazarusidestrconsts:srkmeceditorbottom -msgid "Move cursor to absolute end" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч УБНЩК ЛПОЕГ" - -#: lazarusidestrconsts:srkmecpagebottom -msgid "Move cursor to bottom of page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч ЛПОЕГ УФТБОЙГЩ" - -#: lazarusidestrconsts:srkmeclineend -msgid "Move cursor to line end" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч ЛПОЕГ УФТПЛЙ" - -#: lazarusidestrconsts:srkmeclinestart -msgid "Move cursor to line start" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч ОБЮБМП УФТПЛЙ" - -#: lazarusidestrconsts:srkmecpagetop -msgid "Move cursor to top of page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ Ч ОБЮБМП УФТБОЙГЩ" - -#: lazarusidestrconsts:srkmecpageup -msgid "Move cursor up one page" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ЧЧЕТИ ОБ ПДОХ УФТБОЙГХ" - -#: lazarusidestrconsts:srkmecwordleft -msgid "Move cursor word left" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ОБ УМПЧП ЧМЕЧП" - -#: lazarusidestrconsts:srkmecwordright -msgid "Move cursor word right" -msgstr "рЕТЕНЕУФЙФШ ЛХТУПТ ОБ УМПЧП ЧРТБЧП" - -#: lazarusidestrconsts:lispckeditmovedependencydown -msgid "Move dependency down" -msgstr "ъБЧЙУЙНПУФШ - ЧОЙЪ" - -#: lazarusidestrconsts:lispckeditmovedependencyup -msgid "Move dependency up" -msgstr "ъБЧЙУЙНПУФШ ЧЧЕТИ" - -#: lazarusidestrconsts:srkmecmoveeditorleft -msgid "Move editor left" -msgstr "уНЕУФЙФШ ТЕДБЛФПТ ЧМЕЧП" - -#: lazarusidestrconsts:srkmecmoveeditorright -msgid "Move editor right" -msgstr "уНЕУФЙФШ ТЕДБЛФПТ ЧРТБЧП" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodedown -msgid "Move node down" -msgstr "рЕТЕНЕУФЙФШ ЬМЕНЕОФ ЧОЙЪ" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown -msgid "Move node one level down" -msgstr "рЕТЕНЕУФЙФШ ЬМЕНЕОФ ОБ ХТПЧЕОШ ЧОЙЪ" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup -msgid "Move node one level up" -msgstr "рЕТЕНЕУФЙФШ ЬМЕНЕОФ ОБ ХТПЧЕОШ ЧЧЕТИ" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeup -msgid "Move node up" -msgstr "рЕТЕНЕУФЙФШ ЬМЕНЕОФ ЧЧЕТИ" - -#: lazarusidestrconsts:lispatheditmovepathdown -msgid "Move path down" -msgstr "рХФШ - ЧОЙЪ" - -#: lazarusidestrconsts:lispatheditmovepathup -msgid "Move path up" -msgstr "рХФШ - ЧЧЕТИ" - -#: lazarusidestrconsts:fdmordermovetoback -msgid "Move to back" -msgstr "" - -#: lazarusidestrconsts:fdmordermovetofront -msgid "Move to front" -msgstr "" - -#: lazarusidestrconsts:dlgmultiline -msgid "Multi Line" -msgstr "нОПЗПУФТПЮОЩК" - -#: lazarusidestrconsts:dlgmultiselect -msgid "Multi Select" -msgstr "" - -#: lazarusidestrconsts:fdinvalidmutliselectiontext -msgid "Multiselected components must be of a single form." -msgstr "нОПЦЕУФЧЕООЩК ЧЩВПТ ЛПНРПОЕОФПЧ ДПМЦЕО ВЩФШ ОБ ПДОПК ЖПТНЕ" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal -msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "ъбнефлб: оЕ НПЗХ УПЪДБФШ ЫБВМПО ПРТЕДЕМЕОЙК ЙЪ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources -msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "ъбнефлб: оЕ НПЗХ УПЪДБФШ ЫБВМПО ПРТЕДЕМЕОЙК ЙЪ ЙУИПДОЙЛПЧ Lazarus" - -#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults -msgid "NOTE: codetools config file not found - using defaults" -msgstr "ъбнефлб: ЖБКМ ОБУФТПЕЛ CodeTools ОЕ ОБКДЕО - ЙУРПМШЪХЕН ХНПМЮБОЙС" - -#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile -msgid "NOTE: loading old codetools options file: " -msgstr "ъбнефлб: ЗТХЪЙН УФБТЩК ЖБКМ ОБУФТПЕЛ CodeTools: " - -#: lazarusidestrconsts:lisnameofnewprocedure -msgid "Name of new procedure" -msgstr "йНС ОПЧПК РТПГЕДХТЩ" - -#: lazarusidestrconsts:liscodetoolsdefsname -msgid "Name:" -msgstr "йНС:" - -#: lazarusidestrconsts:dlgnaming -msgid "Naming" -msgstr "оБЪЧБОЙС" - -#: lazarusidestrconsts:lisceoneveronlymanually -msgid "Never, only manually" -msgstr "" - -#: lazarusidestrconsts:srkmecnew -msgid "New" -msgstr "уПЪДБФШ" - -#: lazarusidestrconsts:lismenunewother -msgid "New ..." -msgstr "уПЪДБФШ ..." - -#: lazarusidestrconsts:lisnewancestors -msgid "New Ancestors" -msgstr "" - -#: lazarusidestrconsts:lisnewclass -msgid "New Class" -msgstr "" - -#: lazarusidestrconsts:lisa2pnewcomponent -msgid "New Component" -msgstr "оПЧЩК ЛПНРПОЕОФ" - -#: lazarusidestrconsts:lisa2pnewfile -msgid "New File" -msgstr "" - -#: lazarusidestrconsts:lismenunewform -msgid "New Form" -msgstr "уПЪДБФШ ЖПТНХ" - -#: lazarusidestrconsts:lismenunewproject -msgid "New Project" -msgstr "уПЪДБФШ РТПЕЛФ" - -#: lazarusidestrconsts:lismenunewprojectfromfile -msgid "New Project from file" -msgstr "уПЪДБФШ РТПЕЛФ ЙЪ ЖБКМБ" - -#: lazarusidestrconsts:lisprojaddnewrequirement -msgid "New Requirement" -msgstr "оПЧПЕ ФТЕВПЧБОЙЕ" - -#: lazarusidestrconsts:lismenueditornewtemplatedescription -msgid "New Template Description..." -msgstr "оПЧПЕ ПРЙУБОЙЕ ЫБВМПОБ..." - -#: lazarusidestrconsts:lismenunewunit -msgid "New Unit" -msgstr "уПЪДБФШ НПДХМШ" - -#: lazarusidestrconsts:lisa2pnewclassname -msgid "New class name:" -msgstr "оПЧПЕ ЙНС ЛМБУУБ:" - -#: lazarusidestrconsts:srkmecnewform -msgid "New form" -msgstr "уПЪДБФШ ЖПТНХ" - -#: lazarusidestrconsts:srkmecnewunit -msgid "New unit" -msgstr "уПЪДБФШ НПДХМШ" - -#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath -msgid "New unit not in unitpath" -msgstr "оПЧЩК НПДХМШ ОЕ Ч РХФЙ РПЙУЛБ" - -#: lazarusidestrconsts:liscodetoolsdefsnewnode -msgid "NewNode" -msgstr "оПЧЩК ЬМЕНЕОФ" - -#: lazarusidestrconsts:lispkgmangnewpackage -msgid "NewPackage" -msgstr "оПЧЩК рБЛЕФ" - -#: lazarusidestrconsts:liscodetoolsoptsnewline -msgid "Newline" -msgstr "оПЧБС УФТПЛБ" - -#: lazarusidestrconsts:srvk_next -msgid "Next" -msgstr "уМЕДХАЭЙК" - -#: lazarusidestrconsts:srkmecnextbookmark -msgid "Next Bookmark" -msgstr "" - -#: lazarusidestrconsts:lisnoresourcestringsectionfound -msgid "No ResourceString Section found" -msgstr "оЕ ОБКДЕОП УЕЛГЙЙ ResourceString" - -#: lazarusidestrconsts:lisnostringconstantfound -msgid "No String Constant Found" -msgstr "оЕ ОБКДЕОП УФТПЛПЧПК ЛПОУФБОФЩ" - -#: lazarusidestrconsts:lisnochange -msgid "No change" -msgstr "вЕЪ ЙЪНЕОЕОЙК" - -#: lazarusidestrconsts:lisnocodeselected -msgid "No code selected" -msgstr "оЕ ЧЩВТБОП ЛПДБ" - -#: lazarusidestrconsts:lisnocompileroptionsinherited -msgid "No compiler options inherited." -msgstr "оЕ ХОБУМЕДПЧБОП РБТБНЕФТПЧ ЛПНРЙМСФПТБ." - -#: lazarusidestrconsts:lisdbgmangnodebuggerspecified -msgid "No debugger specified" -msgstr "" - -#: lazarusidestrconsts:dlgednoerr -msgid "No errors in key mapping found." -msgstr "оЕ ОБКДЕОП ПЫЙВПЛ ТБУЛМБДПЛ." - -#: lazarusidestrconsts:lisnewdlgnoitemselected -msgid "No item selected" -msgstr "оЕ ЧЩДЕМЕОП ЬМЕНЕОФПЧ" - -#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting -msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." -msgstr "оЕ ОБКДЕОП РБЛЕФБ ДМС ЪБЧЙУЙНПУФЙ %s%s%s.%sчЩВЕТЙФЕ УХЭЕУФЧХАЭЙК РБЛЕФ." - -#: lazarusidestrconsts:lisoipnopackageselected -msgid "No package selected" -msgstr "оЕ ЧЩВТБОП РБЛЕФПЧ" - -#: lazarusidestrconsts:lisnoprogramfilesfound -msgid "No program file %s%s%s found." -msgstr "жБКМБ РТПЗТБННЩ %s%s%s ОЕ ОБКДЕОП." - -#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly -msgid "Node and its children are only valid for this project" -msgstr "ьМЕНЕОФ Й ЕЗП \"РПФПНЛЙ\" ДПУФХРОЩ ФПМШЛП ДМС ЬФПЗП РТПЕЛФБ" - -#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly -msgid "Node is readonly" -msgstr "ьМЕНЕОФ ФПМШЛП ДМС ЮФЕОЙС" - -#: lazarusidestrconsts:srvk_nonconvert -msgid "Nonconvert" -msgstr "вЕЪ ЛПОЧЕТФБГЙЙ" - -#: lazarusidestrconsts:dlgenvnone -msgid "None" -msgstr "оЕФ" - -#: lazarusidestrconsts:dlgconormal -msgid "Normal Code" -msgstr "оПТНБМШОЩК ЛПД" - -#: lazarusidestrconsts:srkmecnormalselect -msgid "Normal selection mode" -msgstr "оПТНБМШОЩК ТЕЦЙН ЧЩВПТБ" - -#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta -msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" -msgstr "" - -#: lazarusidestrconsts:lisnotadelphiproject -msgid "Not a Delphi project" -msgstr "оЕ РТПЕЛФ Delphi" - -#: lazarusidestrconsts:lisnotadelphiunit -msgid "Not a Delphi unit" -msgstr "оЕ НПДХМШ Delphi" - -#: lazarusidestrconsts:lisuenotfound -msgid "Not found" -msgstr "оЕ ОБКДЕО" - -#: lazarusidestrconsts:uenotimplcap -msgid "Not implemented yet" -msgstr "еЭЕ ОЕ ТЕБМЙЪПЧБОП" - -#: lazarusidestrconsts:lisnotnow -msgid "Not now" -msgstr "оЕ УЕКЮБУ" - -#: lazarusidestrconsts:dlgenvbackuphelpnote -msgid "Notes: Project files are all files in the project directory" -msgstr "чОЙНБОЙЕ, ЖБКМЩ РТПЕЛФБ - ЧУЕ ЖБКМЩ Ч ЕЗП ЛБФБМПЗЕ" - -#: lazarusidestrconsts:liscodetoolsoptsnumber -msgid "Number" -msgstr "юЙУМП" - -#: lazarusidestrconsts:srvk_numlock -msgid "Numlock" -msgstr "NumLock" - -#: lazarusidestrconsts:srvk_numpad -msgid "Numpad %d" -msgstr "%d ГЙЖТПЧПК ЛМБЧЙБФХТЩ" - -#: lazarusidestrconsts:uepovr -msgid "OVR" -msgstr "ъбн" - -#: lazarusidestrconsts:lispckoptsobject -msgid "Object" -msgstr "пВЯЕЛФ" - -#: lazarusidestrconsts:lismenuviewobjectinspector -msgid "Object Inspector" -msgstr "йОУРЕЛФПТ ПВЯЕЛФПЧ" - -#: lazarusidestrconsts:lisokbtn -msgid "Ok" -msgstr "пл" - -#: lazarusidestrconsts:lisoldancestors -msgid "Old Ancestors" -msgstr "" - -#: lazarusidestrconsts:lisoldclass -msgid "Old Class" -msgstr "" - -#: lazarusidestrconsts:lisceoonidle -msgid "On idle" -msgstr "" - -#: lazarusidestrconsts:lismenuonlinehelp -msgid "Online Help" -msgstr "" - -#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented -msgid "Online Help not yet implemented" -msgstr "лПОФЕЛУФОБС УРТБЧЛБ ЕЭЈ ОЕ ТЕБМЙЪПЧБОБ" - -#: lazarusidestrconsts:lisonlysearchforwholewords -msgid "Only search for whole words" -msgstr "рПЙУЛ ФПМШЛП ГЕМЩИ УМПЧ" - -#: lazarusidestrconsts:lisdiffdlgonlyselection -msgid "Only selection" -msgstr "фПМШЛП ЧЩВТБООПЕ" - -#: lazarusidestrconsts:lisfindfileonlytextfiles -msgid "Only text files" -msgstr "фПМШЛП ФЕЛУФПЧЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:lismenuopen -msgid "Open" -msgstr "пФЛТЩФШ" - -#: lazarusidestrconsts:lisopenlfm -msgid "Open %s" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgopendiffineditor -msgid "Open Diff in editor" -msgstr "пФЛТ. Diff Ч ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:lisopenpackagefile -msgid "Open Package File" -msgstr "пФЛТЩФШ ЖБКМ РБЛЕФБ" - -#: lazarusidestrconsts:lisopenpackage -msgid "Open Package?" -msgstr "пФЛТЩФШ РБЛЕФ?" - -#: lazarusidestrconsts:lisctdefsopenpreview -msgid "Open Preview" -msgstr "пФЛТЩФШ РТЕДРТПУНПФТ" - -#: lazarusidestrconsts:lismenuopenproject -msgid "Open Project" -msgstr "пФЛТЩФШ РТПЕЛФ" - -#: lazarusidestrconsts:lisopenprojectfile -msgid "Open Project File" -msgstr "пФЛТЩФШ РТПЕЛФ" - -#: lazarusidestrconsts:lisopenproject -msgid "Open Project?" -msgstr "пФЛТЩФШ РТПЕЛФ?" - -#: lazarusidestrconsts:lismenuopenrecent -msgid "Open Recent" -msgstr "пФЛТЩФШ ОЕДБЧОЕЕ" - -#: lazarusidestrconsts:lismenuopenrecentproject -msgid "Open Recent Project" -msgstr "пФЛТЩФШ ОЕДБЧОЙК РТПЕЛФ" - -#: lazarusidestrconsts:lisopenastextfile -msgid "Open as text file" -msgstr "" - -#: lazarusidestrconsts:lisopenfile -msgid "Open file" -msgstr "пФЛТЩФШ ЖБКМ" - -#: lazarusidestrconsts:srkmecopenfileatcursor -msgid "Open file at cursor" -msgstr "пФЛТЩФШ ЖБКМ Х ЛХТУПТБ" - -#: lazarusidestrconsts:lismenuopenfilenameatcursor -msgid "Open filename at cursor" -msgstr "пФЛТЩФШ ЙНС ЖБКМБ РПД ЛХТУПТПН" - -#: lazarusidestrconsts:dlgqopenlastprj -msgid "Open last project at start" -msgstr "зТХЪЙФШ РПУМЕДОЙК РТПЕЛФ РТЙ РХУЛЕ" - -#: lazarusidestrconsts:lismenuopenpackage -msgid "Open loaded package" -msgstr "пФЛТЩФШ ЪБЗТХЦЕООЩК РБЛЕФ" - -#: lazarusidestrconsts:liscomppalopenpackage -msgid "Open package" -msgstr "пФЛТЩФШ РБЛЕФ" - -#: lazarusidestrconsts:lismenuopenpackagefile -msgid "Open package file (.lpk)" -msgstr "пФЛТЩФШ ЖБКМ РБЛЕФБ (.lpk)" - -#: lazarusidestrconsts:lismenuopenpackageofcurunit -msgid "Open package of current unit" -msgstr "пФЛТЩФШ РБЛЕФ ФЕЛХЭЕЗП НПДХМС" - -#: lazarusidestrconsts:lisopenproject2 -msgid "Open project" -msgstr "" - -#: lazarusidestrconsts:lisopenprojectagain -msgid "Open project again" -msgstr "" - -#: lazarusidestrconsts:lismenuopenrecentpkg -msgid "Open recent package" -msgstr "пФЛТЩФШ ОЕДБЧОЙК РБЛЕФ" - -#: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile -msgid "Open the package %s?%sAnswer No to load it as xml file." -msgstr "пФЛТЩФШ РБЛЕФ %s?%s пФЧЕФШФЕ оЕФ, ЮФПВЩ ЪБЗТХЪЙФШ ЕЗП ЛБЛ xml." - -#: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile -msgid "Open the project %s?%sAnswer No to load it as xml file." -msgstr "пФЛТЩФШ РТПЕЛФ %s?%s пФЧЕФШФЕ оЕФ, ЮФПВЩ ЪБЗТХЪЙФШ ЕЗП ЛБЛ xml." - -#: lazarusidestrconsts:liscomppalopenunit -msgid "Open unit" -msgstr "пФЛТЩФШ НПДХМШ" - -#: lazarusidestrconsts:dlgoptimiz -msgid "Optimizations:" -msgstr "пРФЙНЙЪБГЙС:" - -#: lazarusidestrconsts:fdmsnaptogridoption -msgid "Option: Snap to grid" -msgstr "рБТБНЕФТ: чЩТПЧОСФШ РП УЕФЛЕ" - -#: lazarusidestrconsts:fdmsnaptoguidelinesoption -msgid "Option: Snap to guide lines" -msgstr "рБТБНЕФТ: чЩТПЧОСФШ РП МЙОЙСН РПНПЭЙ" - -#: lazarusidestrconsts:dlgfropts -msgid "Options" -msgstr "рБТБНЕФТЩ" - -#: lazarusidestrconsts:lislazbuildoptions -msgid "Options:" -msgstr "рБТБНЕФТЩ:" - -#: lazarusidestrconsts:dlgcoopts -msgid "Options: " -msgstr "рБТБНЕФТЩ: " - -#: lazarusidestrconsts:fdmorder -msgid "Order" -msgstr "" - -#: lazarusidestrconsts:dlgsrorigin -msgid "Origin" -msgstr "оБЮЙОБФШ" - -#: lazarusidestrconsts:dlgcoother -msgid "Other" -msgstr "дТХЗПЕ" - -#: lazarusidestrconsts:dlgcosources -msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" -msgstr "дТХЗЙЕ ЙУИПДОЙЛЙ (.pp/.pas files, ОХЦОЩ ФПМШЛП IDE, ОЕ ЛПНРЙМСФПТХ)" - -#: lazarusidestrconsts:dlgotherunitfiles -msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" -msgstr "дТХЗЙЕ НПДХМЙ (-Fu) (ТБЪДЕМЙФЕМШ ФПЮЛБ У ЪБРСФПК):" - -#: lazarusidestrconsts:dlgenvotherfiles -msgid "Other files" -msgstr "дТ. ЖБКМЩ" - -#: lazarusidestrconsts:dlgpooutputsettings -msgid "Output Settings" -msgstr "рБТБНЕФТЩ ЧЩЧПДБ" - -#: lazarusidestrconsts:lispkgdefsoutputdirectory -msgid "Output directory" -msgstr "лБФБМПЗ УПИТБОЕОЙК" - -#: lazarusidestrconsts:dlgcooverflow -msgid "Overflow" -msgstr "рЕТЕРПМОЕОЙС" - -#: lazarusidestrconsts:lisoverridelanguage -msgid "Override language. For example --language=de. For possible values see files in the languages directory." -msgstr "" - -#: lazarusidestrconsts:lissvuooverridesystemvariable -msgid "Override system variable" -msgstr "рЕТЕЛТЩФШ УЙУФЕНОХА РЕТЕНЕООХА" - -#: lazarusidestrconsts:srkmecoverwritemode -msgid "Overwrite Mode" -msgstr "тЕЦЙН ЪБНЕОЩ" - -#: lazarusidestrconsts:lisoverwritefileondisk -msgid "Overwrite file on disk" -msgstr "" - -#: lazarusidestrconsts:lisoverwritefile -msgid "Overwrite file?" -msgstr "рЕТЕРЙУБФШ ЖБКМ?" - -#: lazarusidestrconsts:lispackage -msgid "Package" -msgstr "" - -#: lazarusidestrconsts:lispckeditpackage -msgid "Package %s" -msgstr "рБЛЕФ %s" - -#: lazarusidestrconsts:lispckexplpackagenotfound -msgid "Package %s not found" -msgstr "рБЛЕФ %s ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lispkgmangpackagechangedsave -msgid "Package %s%s%s changed. Save?" -msgstr "рБЛЕФ %s%s%s ЙЪНЕОЈО. уПИТБОЙФШ?" - -#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage -msgid "Package %s%s%s has changed.%sSave package?" -msgstr "рБЛЕФ %s%s%s ЙЪНЕОЈО.%s уПИТБОЙФШ РБЛЕФ?" - -#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory -msgid "Package %s%s%s has no valid output directory:%s%s%s%s" -msgstr "рБЛЕФ %s%s%s ОЕ ЙНЕЕФ РТБЧЙМШОПЗП ЛБФБМПЗБ УПИТБОЕОЙК:%s%s%s%s" - -#: lazarusidestrconsts:lisaf2ppackagenotfound -msgid "Package %s%s%s not found." -msgstr "рБЛЕФ %s%s%s ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lismenupackagegraph -msgid "Package Graph" -msgstr "дЙБЗТБННБ РБЛЕФПЧ" - -#: lazarusidestrconsts:lisoippackagename -msgid "Package Name" -msgstr "йНС РБЛЕФБ" - -#: lazarusidestrconsts:lisprojaddpackagename -msgid "Package Name:" -msgstr "йНС РБЛЕФБ:" - -#: lazarusidestrconsts:lispckoptspackageoptions -msgid "Package Options" -msgstr "рБТБНЕФТЩ РБЛЕФБ" - -#: lazarusidestrconsts:lispkgdefssrcdirmark -msgid "Package Source Directory Mark" -msgstr "нЕФЛБ ЛБФБМПЗБ ЙУИПДОЙЛБ РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmangpackageconflicts -msgid "Package conflicts" -msgstr "лПОЖМЙЛФЩ РБЛЕФПЧ" - -#: lazarusidestrconsts:lispkgsyspackagefilenotfound -msgid "Package file not found" -msgstr "жБКМ РБЛЕФБ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage -msgid "Package is no designtime package" -msgstr "рБЛЕФ - ОЕ РБЛЕФ ТБЪТБВПФЛЙ" - -#: lazarusidestrconsts:lisaf2ppackageisreadonly -msgid "Package is read only" -msgstr "рБЛЕФ ФПМШЛП ДМС ЮФЕОЙС" - -#: lazarusidestrconsts:lispkgmangpackageisrequired -msgid "Package is required" -msgstr "фТЕВХЕФУС РБЛЕФ" - -#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists -msgid "Package name already exists" -msgstr "йНС РБЛЕФБ ХЦЕ ЪБОСФП" - -#: lazarusidestrconsts:lispackageneedsinstallation -msgid "Package needs installation" -msgstr "рБЛЕФ ФТЕВХЕФ ХУФБОПЧЛЙ" - -#: lazarusidestrconsts:lisprojaddpackagenotfound -msgid "Package not found" -msgstr "рБЛЕФ ОЕ ОБКДЕО" - -#: lazarusidestrconsts:lispkgmangpackage -msgid "Package: %s" -msgstr "рБЛЕФ: %s" - -#: lazarusidestrconsts:lispckoptspackagetype -msgid "PackageType" -msgstr "фЙР РБЛЕФБ" - -#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk -msgid "Packages must have the extension .lpk" -msgstr "рБЛЕФЩ ДПМЦОЩ ЙНЕФШ ТБУЫЙТЕОЙЕ .lpk" - -#: lazarusidestrconsts:lispackagestoinstallintheide -msgid "Packages to install in the IDE" -msgstr "рБЛЕФЩ ДМС ХУФБОПЧЛЙ Ч IDE" - -#: lazarusidestrconsts:lisa2ppagenametoolong -msgid "Page Name too long" -msgstr "йНС УФТБОЙГЩ УМЙЫЛПН ДМЙООПЕ" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu -msgid "Paint designer items only on idle (reduce overhead for slow computers)" -msgstr "тЙУПЧБФШ ЬМЕНЕОФЩ ДЙЪБКОЕТПЧ ФПМШЛП Ч РБХЪБИ (ХНЕОШЫБЕФ ОБЗТХЪЛХ ОБ НЕДМЕООЩИ НБЫЙОБИ)" - -#: lazarusidestrconsts:lisa2ppalettepage -msgid "Palette Page:" -msgstr "уФТБОЙГБ РБМЙФТЩ:" - -#: lazarusidestrconsts:lissortselparagraphs -msgid "Paragraphs" -msgstr "бВЪБГЩ" - -#: lazarusidestrconsts:liscmparameter -msgid "Parameter" -msgstr "" - -#: lazarusidestrconsts:lisedtexttoolparameters -msgid "Parameters:" -msgstr "рБТБНЕФТЩ:" - -#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch -msgid "Parent node can not contain child nodes." -msgstr "тПДЙФЕМШУЛЙК ЬМЕНЕОФ ОЕ НПЦЕФ УПДЕТЦБФШ ДПЮЕТОЙИ." - -#: lazarusidestrconsts:dlgcoparsing -msgid "Parsing" -msgstr "пВТБВПФЛБ" - -#: lazarusidestrconsts:lispascalsourcefile -msgid "Pascal source file" -msgstr "" - -#: lazarusidestrconsts:lispascalunit -msgid "Pascal unit" -msgstr "" - -#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas -msgid "Pascal units must have the extension .pp or .pas" -msgstr "нПДХМЙ РБУЛБМС ДПМЦОЩ ЙНЕФШ ТБУЫЙТЕОЙЕ .pp ЙМЙ .pas" - -#: lazarusidestrconsts:dlgpassoptslinker -msgid "Pass Options To The Linker (Delimiter is space)" -msgstr "рЕТЕДБФШ ПРГЙЙ МЙОЛЕТХ (ПФДЕМСФШ РТПВЕМБНЙ)" - -#: lazarusidestrconsts:lismenupaste -msgid "Paste" -msgstr "чУФБЧЙФШ" - -#: lazarusidestrconsts:srkmecpaste -msgid "Paste clipboard to current position" -msgstr "чУФБЧЙФШ ЙЪ ВХЖЕТБ Ч ФЕЛХЭХА РПЪЙГЙА" - -#: lazarusidestrconsts:lisdsgpastecomponents -msgid "Paste selected components from clipboard" -msgstr "чУФБЧЙФШ ЧЩВТБООЩЕ ЛПНРПОЕОФЩ ЙЪ ВХЖЕТБ" - -#: lazarusidestrconsts:lispatheditpathtemplates -msgid "Path templates" -msgstr "ыБВМПОЩ РХФЙ" - -#: lazarusidestrconsts:listofpcpath -msgid "Path:" -msgstr "рХФШ:" - -#: lazarusidestrconsts:dlgsearchpaths -msgid "Paths" -msgstr "рХФЙ" - -#: lazarusidestrconsts:lisuidpathsreadonly -msgid "Paths (Read Only)" -msgstr "рХФЙ (ФПМШЛП ЮФЕОЙЕ)" - -#: lazarusidestrconsts:lismenupause -msgid "Pause" -msgstr "рБХЪБ" - -#: lazarusidestrconsts:srvk_pause -msgid "Pause key" -msgstr "лМБЧЙЫБ Pause" - -#: lazarusidestrconsts:dlgpersistentcaret -msgid "Persistent caret" -msgstr "оЕРПДЧЙЦОЩК ЛХТУПТ" - -#: lazarusidestrconsts:lisplzcheckthecompilername -msgid "Please check the compiler name" -msgstr "рТПЧЕТШФЕ ЙНС ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory -msgid "Please check the freepascal source directory" -msgstr "рТПЧЕТШФЕ ЛБФБМПЗ ЙУИПДОЙЛПЧ FreePascal" - -#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring -msgid "Please choose a resourstring section from the list." -msgstr "чЩВЕТЙФЕ УЕЛГЙА resourcestring ЙЪ УРЙУЛБ." - -#: lazarusidestrconsts:lispleaseopenaunitbeforerun -msgid "Please open a unit before run." -msgstr "пФЛТПКФЕ НПДХМШ РЕТЕД ЪБРХУЛПН." - -#: lazarusidestrconsts:srkmpresskey -msgid "Please press a key ..." -msgstr "оБЦНЙФЕ МАВХА ЛМБЧЙЫХ..." - -#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage -msgid "Please save the file before adding it to a package." -msgstr "уПИТБОЙФЕ ЖБКМ РЕТЕД ДПВБЧМЕОЙЕН Ч РБЛЕФ." - -#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst -msgid "Please save the package first." -msgstr "" - -#: lazarusidestrconsts:lisoippleaseselectapackage -msgid "Please select a package" -msgstr "чЩВЕТЙФЕ РБЛЕФ" - -#: lazarusidestrconsts:lisoippleaseselectapackagetoopen -msgid "Please select a package to open" -msgstr "чЩВЕТЙФЕ РБЛЕФ, ЮФПВЩ ПФЛТЩФШ" - -#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst -msgid "Please select an item first." -msgstr "чЩВЕТЙФЕ УОБЮБМБ ЬМЕНЕОФ" - -#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod -msgid "Please select some code to extract a new procedure/method." -msgstr "чЩДЕМЙФЕ ОЕЛПФПТЩК ЛПД, ЮФПВЩ ЙЪЧМЕЮШ ОПЧХА РТПГЕДХТХ/НЕФПД." - -#: lazarusidestrconsts:liscodetoolsoptspoint -msgid "Point" -msgstr "фПЮЛБ" - -#: lazarusidestrconsts:rslanguagepolish -msgid "Polish" -msgstr "рПМШУЛЙК" - -#: lazarusidestrconsts:rslanguagepolishwin -msgid "Polish(CP1250)" -msgstr "рПМШУЛЙК(CP1250)" - -#: lazarusidestrconsts:rslanguagepolishiso -msgid "Polish(ISO 8859-2)" -msgstr "рПМШУЛЙК(ISO 8859-2)" - -#: lazarusidestrconsts:rslanguageportugues -msgid "Portuguese" -msgstr "" - -#: lazarusidestrconsts:dlgwrdpreview -msgid "Preview" -msgstr "рТЕДРТПУНПФТ" - -#: lazarusidestrconsts:dlgcdtpreview -msgid "Preview (Max line length = 1)" -msgstr "рТЕДРТПУНПФТ(max ДМЙОБ=1)" - -#: lazarusidestrconsts:srkmecprevbookmark -msgid "Previous Bookmark" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes -msgid "Previous node can not contain child nodes." -msgstr "рТЕДЩДХЭЙК ЬМЕНЕОФ ОЕ НПЦЕФ УПДЕТЦБФШ ДПЮЕТОЙИ." - -#: lazarusidestrconsts:srvk_print -msgid "Print" -msgstr "рЕЮБФШ" - -#: lazarusidestrconsts:listodolistprintlist -msgid "Print todo items" -msgstr "тБУРЕЮБФБФШ ЬМЕНЕОФЩ todo" - -#: lazarusidestrconsts:srvk_prior -msgid "Prior" -msgstr "рЕТЕД" - -#: lazarusidestrconsts:lisprivatemethod -msgid "Private Method" -msgstr "уЛТЩФЩК НЕФПД" - -#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti -msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "" - -#: lazarusidestrconsts:lisprocedure -msgid "Procedure" -msgstr "рТПГЕДХТБ" - -#: lazarusidestrconsts:dlgforwardprocsinsertpolicy -msgid "Procedure insert policy" -msgstr "рПМЙФЙЛБ ЧУФБЧЛЙ РТПГЕДХТ" - -#: lazarusidestrconsts:lisprocedurewithinterface -msgid "Procedure with interface" -msgstr "рТПГЕДХТБ У ЙОФЕТЖЕКУПН" - -#: lazarusidestrconsts:lisprogram -msgid "Program" -msgstr "рТПЗТБННБ" - -#: lazarusidestrconsts:lisprogramdetected -msgid "Program detected" -msgstr "пВОБТХЦЕОБ РТПЗТБННБ" - -#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp -msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "йУИПДОЙЛ РТПЗТБННЩ ДПМЦЕО ЙНЕФШ ТБУЫЙТЕОЙЕ РБУЛБМС, ОБРТ. .pas, .pp ЙМЙ .lpr" - -#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic -msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "рТПЗТБННБ%sрТПЗТБННБ freepascal. жБКМ РТПЗТБННЩ БЧФПНБФЙЮЕУЛЙ РПДДЕТЦЙЧБЕФУС lazarus." - -#: lazarusidestrconsts:lisedtexttoolprogramfilename -msgid "Programfilename:" -msgstr "йНС ЖБКМБ РТПЗТБННЩ:" - -#: lazarusidestrconsts:lispdprogress -msgid "Progress" -msgstr "" - -#: lazarusidestrconsts:dlgenvproject -msgid "Project" -msgstr "рТПЕЛФ" - -#: lazarusidestrconsts:lisprojectsuccessfullybuilt -msgid "Project %s%s%s successfully built. :)" -msgstr "рТПЕЛФ %s%s%s ХУРЕЫОП УПВТБО. :)" - -#: lazarusidestrconsts:lisedtdefprojectincpath -msgid "Project IncPath" -msgstr "рХФШ ЧЛМ.РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectincpath -msgid "Project Include Path" -msgstr "рХФЙ ЧЛМАЮЕОЙК РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectinformation -msgid "Project Information" -msgstr "" - -#: lazarusidestrconsts:lismenuprojectinspector -msgid "Project Inspector" -msgstr "йОУРЕЛФПТ РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojinspprojectinspector -msgid "Project Inspector - %s" -msgstr "йОУРЕЛФПТ РТПЕЛФБ - %s" - -#: lazarusidestrconsts:dlgprojectoptions -msgid "Project Options" -msgstr "рБТБНЕФТЩ РТПЕЛФБ" - -#: lazarusidestrconsts:lismenuprojectoptions -msgid "Project Options..." -msgstr "рБТБНЕФТЩ РТПЕЛФБ..." - -#: lazarusidestrconsts:lisprojprojectsourcedirectorymark -msgid "Project Source Directory Mark" -msgstr "" - -#: lazarusidestrconsts:lisprojectsrcpath -msgid "Project Src Path" -msgstr "рХФШ ЙУИПДОЙЛПЧ РТПЕЛФБ" - -#: lazarusidestrconsts:lisedtdefprojectsrcpath -msgid "Project SrcPath" -msgstr "рХФШ ЙУИ. РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectunitpath -msgid "Project Unit Path" -msgstr "рХФШ НПДХМЕК РТПЕЛФБ" - -#: lazarusidestrconsts:lisedtdefprojectunitpath -msgid "Project UnitPath" -msgstr "рХФШ НПДХМЕК РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectchanged -msgid "Project changed" -msgstr "рТПЕЛФ ЙЪНЕОЕО" - -#: lazarusidestrconsts:lisprojectdirectory -msgid "Project directory" -msgstr "йНС ЛБФБМПЗБ РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectfilename -msgid "Project filename" -msgstr "йНС ЖБКМБ РТПЕЛФБ" - -#: lazarusidestrconsts:dlgprojfiles -msgid "Project files" -msgstr "жБКМЩ РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectinfofiledetected -msgid "Project info file detected" -msgstr "пВОБТХЦЕО ЖБКМ УЧЕДЕОЙК РТПЕЛФБ" - -#: lazarusidestrconsts:lisprojectisrunnable -msgid "Project is runnable" -msgstr "рТПЕЛФ ЪБРХУЛБЕНЩК" - -#: lazarusidestrconsts:lisprojectmakroproperties -msgid "Project makro properties" -msgstr "" - -#: lazarusidestrconsts:srkmcatprojectmenu -msgid "Project menu commands" -msgstr "лПНБОДЩ НЕОА рТПЕЛФ" - -#: lazarusidestrconsts:lispkgmangproject -msgid "Project: %s" -msgstr "рТПЕЛФ: %s" - -#: lazarusidestrconsts:dlgpromptonreplace -msgid "Prompt On Replace" -msgstr "рПДФЧЕТЦДБФШ ЪБНЕОХ" - -#: lazarusidestrconsts:lispromptforvalue -msgid "Prompt for value" -msgstr "рПДУЛБЪЛБ РП ЪОБЮЕОЙА" - -#: lazarusidestrconsts:lishlpoptsproperties -msgid "Properties:" -msgstr "уЧПКУФЧБ:" - -#: lazarusidestrconsts:dlgpropertycompletion -msgid "Property completion" -msgstr "ъБЧЕТЫЕОЙЕ УЧПКУФЧ" - -#: lazarusidestrconsts:dlgpropnamecolor -msgid "Property name" -msgstr "" - -#: lazarusidestrconsts:lisprotectedmethod -msgid "Protected Method" -msgstr "ъБЭЙЭЈООЩК НЕФПД" - -#: lazarusidestrconsts:lispublicmethod -msgid "Public Method" -msgstr "пВЭЙК НЕФПД" - -#: lazarusidestrconsts:lispkgeditpublishpackage -msgid "Publish Package" -msgstr "пРХВМЙЛПЧБФШ РБЛЕФ" - -#: lazarusidestrconsts:lismenupublishproject -msgid "Publish Project" -msgstr "пРХВМЙЛПЧБФШ РТПЕЛФ" - -#: lazarusidestrconsts:lispublishprojdir -msgid "Publish project directory" -msgstr "лБФБМПЗ РХВМЙЛБГЙЙ РТПЕЛФБ" - -#: lazarusidestrconsts:lispublishedmethod -msgid "Published Method" -msgstr "пРХВМЙЛПЧБООЩК НЕФПД" - -#: lazarusidestrconsts:lismenuquicksyntaxcheck -msgid "Quick syntax check" -msgstr "вЩУФТБС РТПЧЕТЛБ УЙОФБЛУЙУБ" - -#: lazarusidestrconsts:lismenuquit -msgid "Quit" -msgstr "чЩИПД" - -#: lazarusidestrconsts:dlgcorange -msgid "Range" -msgstr "дЙБРБЪПОБ" - -#: lazarusidestrconsts:lispckeditreadddependency -msgid "Re-Add dependency" -msgstr "пВОПЧЙФШ ЪБЧЙУЙНПУФШ" - -#: lazarusidestrconsts:lispckeditreaddfile -msgid "Re-Add file" -msgstr "пВОПЧЙФШ ЖБКМ" - -#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages -msgid "Re-Compile this and all required packages?" -msgstr "рЕТЕЛПНРЙМЙТПЧБФШ" - -#: lazarusidestrconsts:lisreaderror -msgid "Read Error" -msgstr "пЫЙВЛБ ЮФЕОЙС" - -#: lazarusidestrconsts:uemreadonly -msgid "Read Only" -msgstr "фПМШЛП ЮФЕОЙЕ" - -#: lazarusidestrconsts:lispckeditreadonly -msgid "Read Only: %s" -msgstr "фПМШЛП ЮФЕОЙЕ:%s" - -#: lazarusidestrconsts:liscodetoolsdefsreaderror -msgid "Read error" -msgstr "пЫЙВЛБ ЮФЕОЙС" - -#: lazarusidestrconsts:dlgcdtreadprefix -msgid "Read prefix" -msgstr "рТЕЖЙЛУ READ" - -#: lazarusidestrconsts:uepreadonly -msgid "Readonly" -msgstr "фПМШЛП ЮФЕОЙЕ" - -#: lazarusidestrconsts:lispkgmangrebuildlazarus -msgid "Rebuild Lazarus?" -msgstr "рЕТЕУПВТБФШ Lazarus?" - -#: lazarusidestrconsts:lispckeditrecompileallrequired -msgid "Recompile all required" -msgstr "фТЕВХЕФУС РЕТЕУПВТБФШ ЧУЕ" - -#: lazarusidestrconsts:lispckeditrecompileclean -msgid "Recompile clean" -msgstr "юЙУФБС РЕТЕУВПТЛБ" - -#: lazarusidestrconsts:lismenuredo -msgid "Redo" -msgstr "чЕТОХФШ" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidle -msgid "Reduce designer painting" -msgstr "хНЕОШЫЙФШ РТПТЙУПЧЛХ ДЙЪБКОЕТПЧ" - -#: lazarusidestrconsts:uemrefactor -msgid "Refactoring" -msgstr "рЕТЕТБВПФЛБ ЛПДБ" - -#: lazarusidestrconsts:dlgreferencecolor -msgid "Reference" -msgstr "" - -#: lazarusidestrconsts:dlgunitdeprefresh -msgid "Refresh" -msgstr "пВОПЧЙФШ" - -#: lazarusidestrconsts:lisceorefreshautomatically -msgid "Refresh automatically" -msgstr "" - -#: lazarusidestrconsts:listodolistrefresh -msgid "Refresh todo items" -msgstr "пВОПЧЙФШ ЬМЕНЕОФЩ todo" - -#: lazarusidestrconsts:lispkgsysregisterprocedureisnil -msgid "Register procedure is nil" -msgstr "рТПГЕДХТБ ТЕЗЙУФТБГЙЙ РХУФБ" - -#: lazarusidestrconsts:lispckeditregisterunit -msgid "Register unit" -msgstr "ъБТЕЗЙУФТЙТПЧБФШ НПДХМШ" - -#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering -msgid "RegisterUnit was called, but no package is registering." -msgstr "вЩМ ЧЩЪЧБО RegisterUnit, ОП РБЛЕФПЧ ОЕ ЪБТЕЗЙУФТЙТПЧБОП." - -#: lazarusidestrconsts:lispckeditregisteredplugins -msgid "Registered plugins" -msgstr "ъБТЕЗЙУФТЙТПЧБООЩЕ ДПРПМОЕОЙС" - -#: lazarusidestrconsts:lispkgsysregistrationerror -msgid "Registration Error" -msgstr "пЫЙВЛБ ТЕЗЙУФТБГЙЙ" - -#: lazarusidestrconsts:dlgregularexpressions -msgid "Regular Expressions" -msgstr "гЕМЩЕ ЧЩТБЦЕОЙС" - -#: lazarusidestrconsts:lisfindfileregularexpressions -msgid "Regular expressions" -msgstr "тЕЗХМСТОПЕ ЧЩТБЦЕОЙЕ" - -#: lazarusidestrconsts:lispckoptsrelease -msgid "Release" -msgstr "тЕМЙЪ" - -#: lazarusidestrconsts:lisdiskdiffrevertall -msgid "Reload from disk" -msgstr "рЕТЕЗТХЪЙФШ У ДЙУЛБ" - -#: lazarusidestrconsts:lisexttoolremove -msgid "Remove" -msgstr "хДБМЙФШ" - -#: lazarusidestrconsts:lispckeditremovedependency2 -msgid "Remove Dependency?" -msgstr "хДБМЙФШ ЪБЧЙУЙНПУФШ?" - -#: lazarusidestrconsts:lisremoveallinvalidproperties -msgid "Remove all invalid properties" -msgstr "хДБМЙФШ ЧУЕ ОЕЛПТТЕЛФОЩЕ УЧПКУФЧБ" - -#: lazarusidestrconsts:lispckeditremovedependency -msgid "Remove dependency" -msgstr "хДБМЙФШ ЪБЧЙУЙНПУФШ" - -#: lazarusidestrconsts:lispckeditremovedependencyfrompackage -msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" -msgstr "хДБМЙФШ ЪБЧЙУЙНПУФШ %s%s%s%sЙЪ РБЛЕФБ %s%s%s?" - -#: lazarusidestrconsts:lispckeditremovefile -msgid "Remove file" -msgstr "хДБМЙФШ ЖБКМ" - -#: lazarusidestrconsts:lisprojinspremovefilefromproject -msgid "Remove file %s from project?" -msgstr "хДБМЙФШ ЖБКМ %s ЙЪ РТПЕЛФБ?" - -#: lazarusidestrconsts:lispckeditremovefilefrompackage -msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "хДБМЙФШ ЖБКМ %s%s%s%s ЙЪ РБЛЕФБ %s%s%s?" - -#: lazarusidestrconsts:lispckeditremovefile2 -msgid "Remove file?" -msgstr "хДБМЙФШ ЖБКМ?" - -#: lazarusidestrconsts:liscldirremovefilesmatchingfilter -msgid "Remove files matching filter" -msgstr "хДБМЙФШ ЖБКМЩ РП ЖЙМШФТХ" - -#: lazarusidestrconsts:lismenuremovefromproject -msgid "Remove from Project" -msgstr "хВТБФШ ЙЪ РТПЕЛФБ" - -#: lazarusidestrconsts:lisoifremovefromfavouriteproperties -msgid "Remove from favourite properties" -msgstr "" - -#: lazarusidestrconsts:lisremovefromproject -msgid "Remove from project" -msgstr "хДБМЙФШ ЙЪ РТПЕЛФБ" - -#: lazarusidestrconsts:lislazdocdeletepathbutton -msgid "Remove path" -msgstr "" - -#: lazarusidestrconsts:lispckeditremoveselecteditem -msgid "Remove selected item" -msgstr "хДБМЙФШ ЧЩВТБООЩК ЬМЕНЕОФ" - -#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile -msgid "Removed Files (these entries are not saved to the lpk file)" -msgstr "хДБМЈООЩЕ ЖБКМЩ (ЬФЙ ЬМЕНЕОФЩ ОЕ УПИТБОСФУС Ч lpk-ЖБКМЕ)" - -#: lazarusidestrconsts:lisprojinspremovedrequiredpackages -msgid "Removed required packages" -msgstr "хДБМЕОЩ ФТЕВХЕНЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved -msgid "Removed required packages (these entries are not saved to the lpk file)" -msgstr "хДБМЕОЩ ФТЕВХЕНЩЕ РБЛЕФЩ (ПОЙ ОЕ УПИТБОСФУС Ч lpk-ЖБКМЕ)" - -#: lazarusidestrconsts:lisfrirename -msgid "Rename" -msgstr "рЕТЕЙНЕОПЧБФШ" - -#: lazarusidestrconsts:lispkgmangrenamefilelowercase -msgid "Rename File lowercase?" -msgstr "рЕТЕЙНЕОПЧБФШ ЖБКМ Ч ОЙЦО.ТЕЗ-ТЕ?" - -#: lazarusidestrconsts:lismenurenameidentifier -msgid "Rename Identifier" -msgstr "рЕТЕЙНЕОПЧБФШ ID" - -#: lazarusidestrconsts:lisfrirenameallreferences -msgid "Rename all References" -msgstr "рЕТЕЙНЕОПЧБФШ ЧУЕ УУЩМЛЙ" - -#: lazarusidestrconsts:lisrenamefilefailed -msgid "Rename file failed" -msgstr "оЕ ХДБМПУШ РЕТЕЙНЕОПЧБФШ ЖБКМ" - -#: lazarusidestrconsts:lispkgmangrenamefileinpackage -msgid "Rename file in package?" -msgstr "рЕТЕЙНЕОПЧБФШ ЖБКМ Ч РБЛЕФЕ?" - -#: lazarusidestrconsts:lisrenamefile -msgid "Rename file?" -msgstr "рЕТЕЙНЕОПЧБФШ ЖБКМ?" - -#: lazarusidestrconsts:srkmecrenameidentifier -msgid "Rename identifier" -msgstr "рЕТЕЙНЕОПЧБФШ ID" - -#: lazarusidestrconsts:lisfrirenameto -msgid "Rename to" -msgstr "рЕТЕЙНЕОПЧБФШ Ч" - -#: lazarusidestrconsts:lisrenametolowercase -msgid "Rename to lowercase" -msgstr "" - -#: lazarusidestrconsts:lismenureplace -msgid "Replace" -msgstr "ъБНЕОБ" - -#: lazarusidestrconsts:dlgreplaceall -msgid "Replace All" -msgstr "ъБНЕОЙФШ ЧУЕ" - -#: lazarusidestrconsts:lispkgmangreplacefile -msgid "Replace File" -msgstr "ъБНЕОЙФШ ЖБКМ" - -#: lazarusidestrconsts:lispkgmangreplaceexistingfile -msgid "Replace existing file %s%s%s?" -msgstr "ъБНЕОЙФШ УХЭЕУФЧХАЭЙК ЖБКМ %s%s%s?" - -#: lazarusidestrconsts:srkmecreplace -msgid "Replace text" -msgstr "ъБНЕОЙФШ ФЕЛУФ" - -#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith -msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "ъБНЕОЙФШ %s%s%s%s ОБ %s%s%s Ч ЬФПН НЕУФЕ?" - -#: lazarusidestrconsts:lisreplacingselectionfailed -msgid "Replacing selection failed." -msgstr "" - -#: lazarusidestrconsts:dlgreport -msgid "Report" -msgstr "пФЮЕФ" - -#: lazarusidestrconsts:lispckeditrequiredpackages -msgid "Required Packages" -msgstr "фТЕВХЕНЩЕ РБЛЕФЩ" - -#: lazarusidestrconsts:lismenurescanfpcsourcedirectory -msgid "Rescan FPC source directory" -msgstr "рЕТЕУНПФТЕФШ ЛБФБМПЗ ЙУИПДОЙЛПЧ FPC" - -#: lazarusidestrconsts:lismenuresetdebugger -msgid "Reset debugger" -msgstr "уВТПУ ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:lisresourceloaderror -msgid "Resource load error" -msgstr "пЫЙВЛБ ЪБЗТХЪЛЙ ТЕУХТУБ" - -#: lazarusidestrconsts:lisresourcesaveerror -msgid "Resource save error" -msgstr "пЫЙВЛБ УПИТБОЕОЙС ТЕУХТУБ" - -#: lazarusidestrconsts:lismakeresstrresourcestringsection -msgid "Resourcestring Section:" -msgstr "уЕЛГЙС Resourcestring:" - -#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis -msgid "Resourcestring already exists" -msgstr "уФТПЛБ ТЕУХТУПЧ ХЦЕ УХЭЕУФЧХЕФ" - -#: lazarusidestrconsts:lismenurestart -msgid "Restart" -msgstr "рЕТЕЪБРХУЛ" - -#: lazarusidestrconsts:lislazbuildrestartafterbuild -msgid "Restart After Successfull Build" -msgstr "рЕТЕЪБРХУЛ РПУМЕ ХУРЕЫОПК УВПТЛЙ" - -#: lazarusidestrconsts:rsiwprestorewindowgeometry -msgid "Restore window geometry" -msgstr "чПУУФБОПЧЙФШ ЗЕПНЕФТЙА ПЛОБ" - -#: lazarusidestrconsts:rsiwprestorewindowsize -msgid "Restore window size" -msgstr "чПУУФБОПЧЙФШ ТБЪНЕТ ПЛОБ" - -#: lazarusidestrconsts:srvk_return -msgid "Return" -msgstr "чПЪЧТБФ" - -#: lazarusidestrconsts:lismenurevert -msgid "Revert" -msgstr "пВТБФОЩК ЬЛУРПТФ" - -#: lazarusidestrconsts:lisrevertfailed -msgid "Revert failed" -msgstr "пВТБЭЕОЙЕ ОЕ ХДБМПУШ" - -#: lazarusidestrconsts:lispkgeditrevertpackage -msgid "Revert package?" -msgstr "чЕТОХФШ РБЛЕФ?" - -#: lazarusidestrconsts:srvk_right -msgid "Right" -msgstr "уРТБЧБ" - -#: lazarusidestrconsts:dlgrightclickselects -msgid "Right Click selects" -msgstr "чЩВПТ РТБЧЩН ЭЕМЮЛПН" - -#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav -msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "рТБЧЩК ЭЕМЮПЛ ОБ ЬМЕНЕОФЕ ДЕТЕЧБ ДБУФ НЕОА УП ЧУЕНЙ ДПУФХРОЩНЙ ЖХОЛГЙСНЙ РБЛЕФБ." - -#: lazarusidestrconsts:dlgrightmargin -msgid "Right margin" -msgstr "рТБЧБС ЗТБОЙГБ" - -#: lazarusidestrconsts:dlgrightmargincolor -msgid "Right margin color" -msgstr "гЧЕФ РТБЧПК ЗТБОЙГЩ" - -#: lazarusidestrconsts:dlgrightmousemovescursor -msgid "Right mouse moves caret" -msgstr "рТБЧБС ЛОПРЛБ РЕТЕНЕЭБЕФ ЛХТУПТ" - -#: lazarusidestrconsts:lisrightsides -msgid "Right sides" -msgstr "рТБЧЩЕ ЛТБС" - -#: lazarusidestrconsts:lisrightspaceequally -msgid "Right space equally" -msgstr "" - -#: lazarusidestrconsts:dlgrubberbandgroup -msgid "Rubber band" -msgstr "рПМЕ ЪБНЕФПЛ" - -#: lazarusidestrconsts:lismenuprojectrun -msgid "Run" -msgstr "ъБРХУЛ" - -#: lazarusidestrconsts:lismenurunfile -msgid "Run File" -msgstr "ъБРХУФЙФШ ЖБКМ" - -#: lazarusidestrconsts:lismenurunparameters -msgid "Run Parameters ..." -msgstr "рБТБНЕФТЩ ЪБРХУЛБ ..." - -#: lazarusidestrconsts:srkmcatrunmenu -msgid "Run menu commands" -msgstr "лПНБДОДЩ НЕОА ъБРХУЛ" - -#: lazarusidestrconsts:dlgrunparameters -msgid "Run parameters" -msgstr "рБТБНЕФТЩ ЪБРХУЛБ" - -#: lazarusidestrconsts:lismenuruntocursor -msgid "Run to cursor" -msgstr "ъБРХУЛ ДП ЛХТУПТБ" - -#: lazarusidestrconsts:lisruntofailed -msgid "Run-to failed" -msgstr "ъБРХУЛ-ДП ОЕ ХДБМУС" - -#: lazarusidestrconsts:lispckoptsruntimeonly -msgid "Runtime only" -msgstr "чТЕНЕОЙ ЙУРПМОЕОЙС" - -#: lazarusidestrconsts:rslanguagerussian -msgid "Russian" -msgstr "тХУУЛЙК" - -#: lazarusidestrconsts:rslanguagerussianwin -msgid "Russian(CP1251)" -msgstr "тХУУЛЙК(CP1251)" - -#: lazarusidestrconsts:lissvnrevision -msgid "SVN Revision: " -msgstr "" - -#: lazarusidestrconsts:dlgbckupsubdir -msgid "Same name (in subdirectory)" -msgstr "фП ЦЕ ЙНС (Ч РПДЛБФБМПЗЕ)" - -#: lazarusidestrconsts:lismenusave -msgid "Save" -msgstr "уПИТБОЙФШ" - -#: lazarusidestrconsts:lissavespace -msgid "Save " -msgstr "уПИТБОЙФШ " - -#: lazarusidestrconsts:lismenusaveall -msgid "Save All" -msgstr "уПИТБОЙФШ ЧУЕ" - -#: lazarusidestrconsts:lismenusaveas -msgid "Save As" -msgstr "уПИТБОЙФШ ЛБЛ" - -#: lazarusidestrconsts:dlgcharcasefileact -msgid "Save As - auto rename pascal files lower case" -msgstr "уПИТБОЙФШ ЛБЛ-БЧФПРЕТЕЙНЕОПЧБФШ Ч ОЙЦОЙК ТЕЗЙУФТ" - -#: lazarusidestrconsts:lismenueditorsaveastemplate -msgid "Save As Template..." -msgstr "уПИТБОЙФШ ЛБЛ ЫБВМПО..." - -#: lazarusidestrconsts:lispckeditsavechanges -msgid "Save Changes?" -msgstr "уПИТБОЙФШ ЙЪНЕОЕОЙС?" - -#: lazarusidestrconsts:lispkgmangsavepackagelpk -msgid "Save Package %s (*.lpk)" -msgstr "уПИТБОЙФШ РБЛЕФ %s (*.lpk)" - -#: lazarusidestrconsts:lispkgmangsavepackage -msgid "Save Package?" -msgstr "уПИТБОЙФШ РБЛЕФ?" - -#: lazarusidestrconsts:lismenusaveproject -msgid "Save Project" -msgstr "уПИТБОЙФШ РТПЕЛФ" - -#: lazarusidestrconsts:lissaveprojectlpi -msgid "Save Project %s (*.lpi)" -msgstr "уПИТБОЙФШ РТПЛЕФ %s (*.lpi)" - -#: lazarusidestrconsts:lismenusaveprojectas -msgid "Save Project As..." -msgstr "уПИТБОЙФШ РТПЕЛФ ЛБЛ..." - -#: lazarusidestrconsts:lissavesettings -msgid "Save Settings" -msgstr "" - -#: lazarusidestrconsts:lishintsaveall -msgid "Save all" -msgstr "уПИТБОЙФШ ЧУЕ" - -#: lazarusidestrconsts:lissaveallmessagestofile -msgid "Save all messages to file" -msgstr "уПИТБОЙФШ ЧУЕ УППВЭЕОЙС Ч ЖБКМ" - -#: lazarusidestrconsts:liscodetoolsdefssaveandexit -msgid "Save and Exit" -msgstr "уПИТБОЙФШ Й ЧЩКФЙ" - -#: lazarusidestrconsts:lissaveandexitdialog -msgid "Save and exit dialog" -msgstr "уПИТБОЙФШ Й ЧЩКФЙ ЙЪ ДЙБМПЗБ" - -#: lazarusidestrconsts:lissaveandrebuildide -msgid "Save and rebuild IDE" -msgstr "уПИТБОЙФШ Й РЕТЕЪБРХУФЙФШ IDE" - -#: lazarusidestrconsts:srkmecsaveas -msgid "Save as" -msgstr "уПИТБОЙФШ ЛБЛ" - -#: lazarusidestrconsts:lissavechangestoproject -msgid "Save changes to project %s?" -msgstr "уПИТБОЙФШ ЙЪНЕОЕОЙС Ч РТПЕЛФ %s?" - -#: lazarusidestrconsts:lissavechanges -msgid "Save changes?" -msgstr "уПИТБОЙФШ ЙЪНЕОЕОЙС?" - -#: lazarusidestrconsts:dlgsavedfile -msgid "Save desktop settings to file" -msgstr "уПИТ. ТБВПЮЙК УФПМ Ч ЖБКМ" - -#: lazarusidestrconsts:dlgsaveeditorinfo -msgid "Save editor info for closed files" -msgstr "уПИТБОСФШ УЧЕДЕОЙС П ЪБЛТЩЧБЕНЩИ ЖБКМБИ" - -#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles -msgid "Save editor info of non project files" -msgstr "" - -#: lazarusidestrconsts:dlgsaveeditorinfoproject -msgid "Save editor info only for project files" -msgstr "уПИТБОСФШ УЧЕДЕОЙС ФПМШЛП П ЖБКМБИ РТПЕЛФБ" - -#: lazarusidestrconsts:lissavefilebeforeclosingform -msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "уПИТБОЙФШ ЖБКМ %s%s%sРЕТЕД ЪБЛТЩФЙЕН ЖПТНЩ %s%s%s?" - -#: lazarusidestrconsts:lisposaveinlpifil -msgid "Save in .lpi file" -msgstr "" - -#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory -msgid "Save in .lps file in project directory" -msgstr "" - -#: lazarusidestrconsts:lisposaveinideconfigdirectory -msgid "Save in IDE config directory" -msgstr "" - -#: lazarusidestrconsts:lissaveinfoofclosededitorfiles -msgid "Save info of closed editor files" -msgstr "" - -#: lazarusidestrconsts:lispckeditsavepackage -msgid "Save package" -msgstr "уПИТБОЙФШ РБЛЕФ" - -#: lazarusidestrconsts:lispkgmangsavepackage2 -msgid "Save package?" -msgstr "уПИТБОЙФШ РБЛЕФ?" - -#: lazarusidestrconsts:lisposavesessioninformationin -msgid "Save session information in" -msgstr "" - -#: lazarusidestrconsts:fdmscaleword -msgid "Scale" -msgstr "нБУЫФБВ" - -#: lazarusidestrconsts:lisscalingfactor -msgid "Scaling factor:" -msgstr "нБУЫФБВОЩК ЖБЛФПТ:" - -#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure -msgid "Scan Unit for Unit Name and Register procedure" -msgstr "йУЛБФШ Ч НПДХМЕ ЙНС Й РТПГЕДХТХ Register" - -#: lazarusidestrconsts:liscoscanforfpcmessages -msgid "Scan for FPC messages" -msgstr "рПЙУЛ УППВЭЕОЙК FPC" - -#: lazarusidestrconsts:liscoscanformakemessages -msgid "Scan for Make messages" -msgstr "рПЙУЛ УППВЭЕОЙК Make" - -#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages -msgid "Scan output for Free Pascal Compiler messages" -msgstr "рПЙУЛ УППВЭЕОЙК ЛПНРЙМСФПТБ FreePascal Ч ЧЩЧПДЕ" - -#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages -msgid "Scan output for make messages" -msgstr "рПЙУЛ УППВЭЕОЙК make Ч ЧЩЧПДЕ" - -#: lazarusidestrconsts:dlgscope -msgid "Scope" -msgstr "зДЕ" - -#: lazarusidestrconsts:srvk_scroll -msgid "Scroll" -msgstr "рТПЛТХФЙФШ" - -#: lazarusidestrconsts:dlgscrollbyoneless -msgid "Scroll by one less" -msgstr "" - -#: lazarusidestrconsts:srkmecscrolldown -msgid "Scroll down one line" -msgstr "рТПЛТХФЙФШ ЧОЙЪ 1 УФТПЛХ" - -#: lazarusidestrconsts:srkmecscrollleft -msgid "Scroll left one char" -msgstr "рТПЛТХФЙФШ ЧМЕЧП 1 УЙНЧПМ" - -#: lazarusidestrconsts:dlgscrollpastendfile -msgid "Scroll past end of file" -msgstr "рТПЛТХФЙФШ ДП ЛПОГБ ЖБКМБ" - -#: lazarusidestrconsts:dlgscrollpastendline -msgid "Scroll past end of line" -msgstr "рТПЛТХФЙФШ ДП ЛПОГБ УФТПЛЙ" - -#: lazarusidestrconsts:srkmecscrollright -msgid "Scroll right one char" -msgstr "рТПЛТХФЙФШ ЧМЕЧП 1 УЙНЧПМ" - -#: lazarusidestrconsts:srkmecscrollup -msgid "Scroll up one line" -msgstr "рТПЛТХФЙФШ ЧЧЕТИ 1 УФТПЛХ" - -#: lazarusidestrconsts:lissearchfor -msgid "Search For " -msgstr "йУЛБФШ " - -#: lazarusidestrconsts:lismenuviewsearchresults -msgid "Search Results" -msgstr "тЕЪХМШФБФЩ РПЙУЛБ" - -#: lazarusidestrconsts:lissearchagain -msgid "Search again" -msgstr "йУЛБФШ УОПЧБ" - -#: lazarusidestrconsts:lisfrisearchincommentstoo -msgid "Search in comments too" -msgstr "йУЛБФШ Й Ч ЛПННЕОФБТЙСИ" - -#: lazarusidestrconsts:lispatheditsearchpaths -msgid "Search paths:" -msgstr "рХФЙ РПЙУЛБ:" - -#: lazarusidestrconsts:lisuesearchstringnotfound -msgid "Search string '%s' not found!" -msgstr "уФТПЛБ РПЙУЛБ '%s' ОЕ ОБКДЕОБ!" - -#: lazarusidestrconsts:dlgsearchabort -msgid "Search terminated by user." -msgstr "рПЙУЛ РТЕТЧБО РПМШЪПЧБФЕМЕН." - -#: lazarusidestrconsts:lisssearchtext -msgid "Search text" -msgstr "" - -#: lazarusidestrconsts:lisfrisearchwhere -msgid "Search where" -msgstr "йУЛБФШ ЗДЕ" - -#: lazarusidestrconsts:lisssearching -msgid "Searching" -msgstr "" - -#: lazarusidestrconsts:dlgsearchcaption -msgid "Searching..." -msgstr "рПЙУЛ..." - -#: lazarusidestrconsts:lisuesearching -msgid "Searching: %s" -msgstr "йЭХ: %s" - -#: lazarusidestrconsts:lislazdocseealsotag -msgid "See also" -msgstr "" - -#: lazarusidestrconsts:lisseemessages -msgid "See messages." -msgstr "уН. УППВЭЕОЙС." - -#: lazarusidestrconsts:srkmecselleft -msgid "SelLeft" -msgstr "SelLeft" - -#: lazarusidestrconsts:srkmecselright -msgid "SelRight" -msgstr "SelRight" - -#: lazarusidestrconsts:lismenuselect -msgid "Select" -msgstr "чЩДЕМЙФШ" - -#: lazarusidestrconsts:srkmecselectall -msgid "Select All" -msgstr "чЩВТБФШ ЧУЕ" - -#: lazarusidestrconsts:lisctselectcodemacro -msgid "Select Code Macro" -msgstr "" - -#: lazarusidestrconsts:lisselectdfmfiles -msgid "Select Delphi form files (*.dfm)" -msgstr "чЩВЕТЙФЕ ЖБКМЩ ЖПТН Delphi (*.dfm)" - -#: lazarusidestrconsts:srkmecseldown -msgid "Select Down" -msgstr "чЩДЕМЙФШ ЧОЙЪ" - -#: lazarusidestrconsts:srkmecselgotoxy -msgid "Select Goto XY" -msgstr "чЩДЕМЙФШ РЕТЕИПД РП ЛППТД." - -#: lazarusidestrconsts:srkmecsellineend -msgid "Select Line End" -msgstr "чЩДЕМЙФШ ЛПОЕГ УФТПЛЙ" - -#: lazarusidestrconsts:srkmecsellinestart -msgid "Select Line Start" -msgstr "чЩДЕМЙФШ ОБЮБМП УФТПЛЙ" - -#: lazarusidestrconsts:lismenueditorselectmenu -msgid "Select Menu:" -msgstr "чЩВТБФШ НЕОА:" - -#: lazarusidestrconsts:srkmecselpagebottom -msgid "Select Page Bottom" -msgstr "чЩДЕМЙФШ ОЙЪ УФТБОЙГЩ" - -#: lazarusidestrconsts:srkmecselpagedown -msgid "Select Page Down" -msgstr "чЩДЕМЙФШ УФТБОЙГХ УОЙЪХ" - -#: lazarusidestrconsts:srkmecselpageleft -msgid "Select Page Left" -msgstr "чЩДЕМЙФШ УФТБОЙГХ УМЕЧБ" - -#: lazarusidestrconsts:srkmecselpageright -msgid "Select Page Right" -msgstr "чЩДЕМЙФШ УФТБОЙГХ УРТБЧБ" - -#: lazarusidestrconsts:srkmecselpagetop -msgid "Select Page Top" -msgstr "чЩДЕМЙФШ ЧЕТИ УФТБОЙГЩ" - -#: lazarusidestrconsts:srkmecselpageup -msgid "Select Page Up" -msgstr "чЩДЕМЙФШ УФТБОЙГХ УЧЕТИХ" - -#: lazarusidestrconsts:lismenueditorselecttemplate -msgid "Select Template:" -msgstr "чЩВТБФШ ЫБВМПО:" - -#: lazarusidestrconsts:srkmecselup -msgid "Select Up" -msgstr "чЩДЕМЙФШ ЧЧЕТИ" - -#: lazarusidestrconsts:srkmecselwordleft -msgid "Select Word Left" -msgstr "чЩДЕМЙФШ УМПЧП УМЕЧБ" - -#: lazarusidestrconsts:srkmecselwordright -msgid "Select Word Right" -msgstr "чЩДЕМЙФШ УМПЧП УРТБЧБ" - -#: lazarusidestrconsts:lisselectahelpitem -msgid "Select a help item:" -msgstr "йУЛБФШ ЬМЕНЕОФ УРТБЧЛЙ:" - -#: lazarusidestrconsts:lisselectanode -msgid "Select a node" -msgstr "чЩВЕТЙФЕ ЬМЕНЕОФ" - -#: lazarusidestrconsts:lisnpselectaprojecttype -msgid "Select a project type" -msgstr "чЩВЕТЙФЕ ФЙР РТПЕЛФБ" - -#: lazarusidestrconsts:lismenuselectall -msgid "Select all" -msgstr "чЩДЕМЙФШ ЧУЕ" - -#: lazarusidestrconsts:lismenuselectcodeblock -msgid "Select code block" -msgstr "чЩДЕМЙФШ ВМПЛ ЛПДБ" - -#: lazarusidestrconsts:lispatheditselectdirectory -msgid "Select directory" -msgstr "чЩВТБФШ ЛБФБМПЗ" - -#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds -msgid "Select grand childs" -msgstr "" - -#: lazarusidestrconsts:lismenuselectline -msgid "Select line" -msgstr "чЩДЕМЙФШ УФТПЛХ" - -#: lazarusidestrconsts:lismenuselectparagraph -msgid "Select paragraph" -msgstr "чЩДЕМЙФШ БВЪБГ" - -#: lazarusidestrconsts:lisdsgselectparentcomponent -msgid "Select parent component" -msgstr "чЩВТБФШ ТПДЙФЕМШУЛЙК ЛПНРПОЕОФ" - -#: lazarusidestrconsts:srkmecseleditortop -msgid "Select to absolute beginning" -msgstr "чЩДЕМЙФШ ДП УБНПЗП ОБЮБМБ" - -#: lazarusidestrconsts:srkmecseleditorbottom -msgid "Select to absolute end" -msgstr "чЩДЕМЙФШ ДП УБНПЗП ЛПОГБ" - -#: lazarusidestrconsts:lismenuselecttobrace -msgid "Select to brace" -msgstr "чЩДЕМЙФШ ДП УЛПВЛЙ" - -#: lazarusidestrconsts:lismenuselectword -msgid "Select word" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsselectednode -msgid "Selected Node:" -msgstr "чЩДЕМЙФШ ЬМЕНЕОФ:" - -#: lazarusidestrconsts:dlgselectedtext -msgid "Selected Text" -msgstr "ч ЧЩДЕМЕООПН" - -#: lazarusidestrconsts:lispckexplisrequiredby -msgid "Selected package is required by:" -msgstr "чЩВТБООЩК РБЛЕФ ОХЦЕО ДМС:" - -#: lazarusidestrconsts:dlgruberbandselectioncolor -msgid "Selection" -msgstr "чЩДЕМЕОЙЕ" - -#: lazarusidestrconsts:lisselectionexceedsstringconstant -msgid "Selection exceeds string constant" -msgstr "чЩВПТ РТЕЧЩЫБЕФ УФТПЛПЧХА ЛПОУФБОФХ" - -#: lazarusidestrconsts:lisselectiontool -msgid "Selection tool" -msgstr "йОУФТХНЕОФ ЧЩВПТБ" - -#: lazarusidestrconsts:liscodetoolsoptssemicolon -msgid "Semicolon" -msgstr "фПЮЛБ У ЪБРСФПК" - -#: lazarusidestrconsts:dlgposavesession -msgid "Session" -msgstr "" - -#: lazarusidestrconsts:srkmecsetmarker -msgid "Set Marker %d" -msgstr "хУФБОПЧЙФШ НБТЛЕТ %d" - -#: lazarusidestrconsts:uemsetfreebookmark -msgid "Set a free Bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenusetfreebookmark -msgid "Set a free bookmark" -msgstr "" - -#: lazarusidestrconsts:dlgsetallelementdefault -msgid "Set all elements to default" -msgstr "хУФБОПЧЙФШ ЧУЕ ЬМЕНЕОФЩ РП ХНПМЮБОЙА" - -#: lazarusidestrconsts:dlgsetelementdefault -msgid "Set element to default" -msgstr "хУФБОПЧЙФШ ЬМЕНЕОФ РП ХНПМЮБОЙА" - -#: lazarusidestrconsts:dlgsetpropertyvariable -msgid "Set property Variable" -msgstr "рЕТЕНЕООБС УЧПКУФЧБ" - -#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway -msgid "Set the breakpoint anyway" -msgstr "" - -#: lazarusidestrconsts:lislazbuildsettobuildall -msgid "Set to %sBuild All%s" -msgstr "хУФБОПЧЙФШ %sуПВТБФШ ЧУЕ%s" - -#: lazarusidestrconsts:srvk_shift -msgid "Shift" -msgstr "Shift" - -#: lazarusidestrconsts:srkmecshifttab -msgid "Shift Tab" -msgstr "" - -#: lazarusidestrconsts:lislazdocshorttag -msgid "Short" -msgstr "" - -#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto -msgid "Should the file be renamed lowercase to%s%s%s%s?" -msgstr "дПМЦЕО МЙ ЖБКМ ВЩФШ РЕТЕЙНЕОПЧБО Ч ОЙЦО. ТЕЗ. Ч %s%s%s%s?" - -#: lazarusidestrconsts:lisaf2pshowall -msgid "Show All" -msgstr "рПЛБЪБФШ ЧУЕ" - -#: lazarusidestrconsts:lisuishowcodetoolsvalues -msgid "Show CodeTools Values" -msgstr "рПЛБЪБФШ ЪОБЮЕОЙС CodeTools" - -#: lazarusidestrconsts:dlgcoshowerr -msgid "Show Errors" -msgstr "рПЛБЪБФШ ПЫЙВЛЙ" - -#: lazarusidestrconsts:dlgguidelines -msgid "Show Guide Lines" -msgstr "рПЛБЪБФШ МЙОЙЙ РПНПЭЙ" - -#: lazarusidestrconsts:dlgshowhint -msgid "Show Hints" -msgstr "рПЛБЪБФШ РПДУЛБЪЛЙ" - -#: lazarusidestrconsts:dlghintsunused -msgid "Show Hints for unused units in main source" -msgstr "рПДУЛБЪЛЙ ДМС ОЕОХЦОЩИ НПДХМЕК Ч ЗМБЧОПН ЙУИПДОЙЛЕ" - -#: lazarusidestrconsts:uemshowlinenumbers -msgid "Show Line Numbers" -msgstr "" - -#: lazarusidestrconsts:dlgshownotes -msgid "Show Notes" -msgstr "рПЛБЪБФШ ЪБНЕФЛЙ" - -#: lazarusidestrconsts:dlgcoshowoptions -msgid "Show Options" -msgstr "рПЛБЪБФШ ПРГЙЙ" - -#: lazarusidestrconsts:fdmshowoptions -msgid "Show Options for form editing" -msgstr "рПЛБЪБФШ ОБУФТПКЛЙ ДМС ТЕДБЛФЙТПЧБОЙС ЖПТН" - -#: lazarusidestrconsts:dlgshowwarnings -msgid "Show Warnings" -msgstr "рПЛБЪБФШ РТЕДХРТЕЦДЕОЙС" - -#: lazarusidestrconsts:lisa2pshowall -msgid "Show all" -msgstr "рПЛБЪБФШ ЧУЕ" - -#: lazarusidestrconsts:liscoshowallmessages -msgid "Show all messages" -msgstr "рПЛБЪБФШ ЧУЕ УППВЭЕОЙС" - -#: lazarusidestrconsts:dlgshowprocserror -msgid "Show all procs on error" -msgstr "чУЕ РТПГ-ТЩ РТЙ ПЫЙВЛБИ" - -#: lazarusidestrconsts:dlgqshowborderspacing -msgid "Show border spacing" -msgstr "" - -#: lazarusidestrconsts:dlgclosebuttonsnotebook -msgid "Show close buttons in notebook" -msgstr "рПЛБЪБФШ ЛОПРЛЙ ЪБЛТЩФЙС ЪБЛМБДПЛ" - -#: lazarusidestrconsts:srkmecshowcodecontext -msgid "Show code context" -msgstr "" - -#: lazarusidestrconsts:dlgshowcompiledprocedures -msgid "Show compiled procedures" -msgstr "рПЛБЪБФШ ЛПНРЙМЙТХЕНЩЕ РТПГЕДХТЩ" - -#: lazarusidestrconsts:dlgshowcompileroptions -msgid "Show compiler options" -msgstr "рПЛБЪБФШ ПРГЙЙ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:dlgshowcaps -msgid "Show component captions" -msgstr "рПЛБЪБФШ ОБЪЧБОЙС ЛПНРПОЕОФПЧ" - -#: lazarusidestrconsts:dlgshowconditionals -msgid "Show conditionals" -msgstr "рПЛБЪБФШ ХУМПЧЙС" - -#: lazarusidestrconsts:dlgshowdebuginfo -msgid "Show debug info" -msgstr "рПЛБЪБФШ ПФМБДПЮОХА ЙОЖ-А" - -#: lazarusidestrconsts:dlgshowdefinedmacros -msgid "Show defined macros" -msgstr "рПЛБЪБФШ ПРТЕДЕМЈООЩЕ НБЛТПУЩ" - -#: lazarusidestrconsts:dlgshowedrhints -msgid "Show editor hints" -msgstr "рПЛБЪЧБФШ РПДУЛБЪЛЙ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:dlgshoweverything -msgid "Show everything" -msgstr "рПЛБЪБФШ ЧУЈ" - -#: lazarusidestrconsts:dlgshowexecutableinfo -msgid "Show executable info (Win32 only)" -msgstr "" - -#: lazarusidestrconsts:dlgshowgeneralinfo -msgid "Show general info" -msgstr "рПЛБЪБФШ ПВЭЙЕ УЧЕДЕОЙС" - -#: lazarusidestrconsts:dlgqshowgrid -msgid "Show grid" -msgstr "рПЛБЪБФШ УЕФЛХ" - -#: lazarusidestrconsts:dlgshowgutterhints -msgid "Show gutter hints" -msgstr "" - -#: lazarusidestrconsts:lisshowhintsinobjectinspector -msgid "Show hints in Object Inspector" -msgstr "" - -#: lazarusidestrconsts:dlgshowlinenumbers -msgid "Show line numbers" -msgstr "рПЛБЪБФШ ОПНЕТБ УФТПЛ" - -#: lazarusidestrconsts:dlgshownothing -msgid "Show nothing (only errors)" -msgstr "оЙЮЕЗП ОЕ РПЛБЪЩЧБФШ(ФПМШЛП ПЫЙВЛЙ)" - -#: lazarusidestrconsts:dlgshowscrollhint -msgid "Show scroll hint" -msgstr "" - -#: lazarusidestrconsts:dlgshowsummary -msgid "Show summary" -msgstr "рПЛБЪБФШ ПВЪПТ" - -#: lazarusidestrconsts:dlgshowtriedfiles -msgid "Show tried files" -msgstr "" - -#: lazarusidestrconsts:dlgshowusedfiles -msgid "Show used files" -msgstr "рПЛБЪБФШ ЙУРПМШЪХЕНЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:lissimplesyntax -msgid "Simple Syntax" -msgstr "" - -#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof -msgid "Simple Syntax (e.g. * instead of .*)" -msgstr "рТПУФПК УЙОФБЛУЙУ (ОБРТ., * ЧНЕУФП .*)" - -#: lazarusidestrconsts:fdmsizeword -msgid "Size" -msgstr "тБЪНЕТ" - -#: lazarusidestrconsts:lisuidsize -msgid "Size:" -msgstr "" - -#: lazarusidestrconsts:liscoskipcallingcompiler -msgid "Skip calling Compiler" -msgstr "рТПРХУЛ ЧЩЪПЧБ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:lisskipfileandcontinueloading -msgid "Skip file and continue loading" -msgstr "" - -#: lazarusidestrconsts:lisskiploadinglastproject -msgid "Skip loading last project" -msgstr "" - -#: lazarusidestrconsts:dlgcosmaller -msgid "Smaller Code" -msgstr "нЕОШЫЙК ЛПД" - -#: lazarusidestrconsts:dlgcosmartlinkable -msgid "Smart Linkable" -msgstr "" - -#: lazarusidestrconsts:dlgsmarttabs -msgid "Smart tabs" -msgstr "" - -#: lazarusidestrconsts:dlgsnapguidelines -msgid "Snap to Guide Lines" -msgstr "чЩТБЧОЙЧБФШ РП МЙОЙСН РПНПЭЙ" - -#: lazarusidestrconsts:dlgqsnaptogrid -msgid "Snap to grid" -msgstr "чЩТБЧОЙЧБФШ РП УЕФЛЕ" - -#: lazarusidestrconsts:srvk_snapshot -msgid "Snapshot" -msgstr "уОЙНПЛ" - -#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk -msgid "Some files have changed on disk:" -msgstr "оЕЛПФПТЩЕ ЖБКМЩ ЙЪНЕОЕОЩ ОБ ДЙУЛЕ:" - -#: lazarusidestrconsts:lissorrynotimplementedyet -msgid "Sorry, not implemented yet" -msgstr "йЪЧЙОЙФЕ, РПЛБ ОЕ ТЕБМЙЪПЧБОП" - -#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented -msgid "Sorry, this type is not yet implemented" -msgstr "йЪЧЙОЙФЕ, ЬФПФ ФЙР ЕЭЈ ОЕ ТЕБМЙЪПЧБО" - -#: lazarusidestrconsts:lismenusortselection -msgid "Sort selection" -msgstr "уПТФЙТПЧЛБ ЧЩВТБООПЗП" - -#: lazarusidestrconsts:lismenuviewsourceeditor -msgid "Source Editor" -msgstr "тЕДБЛФПТ ЙУИПДОЙЛПЧ" - -#: lazarusidestrconsts:srkmcatsrcnotebook -msgid "Source Notebook commands" -msgstr "лПНБОДЩ ЪБЛМБДПЛ ЙУИПДОЙЛБ" - -#: lazarusidestrconsts:lissourceanddestinationarethesame -msgid "Source and Destination are the same:%s%s" -msgstr "йУФПЮОЙЛ Й ОБЪОБЮЕОЙЕ ПДЙОБЛПЧЩ:%s%s" - -#: lazarusidestrconsts:lismenuaddbpsource -msgid "Source breakpoint" -msgstr "фПЮЛБ ПУФБОПЧБ Ч ЙУИПДОЙЛЕ" - -#: lazarusidestrconsts:lissourcedirectorydoesnotexist -msgid "Source directory %s%s%s does not exist." -msgstr "" - -#: lazarusidestrconsts:lissourcemodified -msgid "Source modified" -msgstr "йУИПДОЙЛ ЙЪНЕОЈО" - -#: lazarusidestrconsts:lissourceofpagehaschangedsave -msgid "Source of page %s%s%s has changed. Save?" -msgstr "йУИПДОЙЛ УФТБОЙГЩ %s%s%s ЙЪНЕОЈО. уПИТБОЙФШ?" - -#: lazarusidestrconsts:lismakeresstrsourcepreview -msgid "Source preview" -msgstr "рТЕДРТПУНПФТ ЙУИПДОЙЛБ" - -#: lazarusidestrconsts:dlgspacenotcosmos -msgid "Space" -msgstr "рТПВЕМ" - -#: lazarusidestrconsts:lisspaceequally -msgid "Space equally" -msgstr "" - -#: lazarusidestrconsts:srvk_space -msgid "Space key" -msgstr "лОПРЛБ РТПВЕМ" - -#: lazarusidestrconsts:rslanguagespanish -msgid "Spanish" -msgstr "йУРБОУЛЙК" - -#: lazarusidestrconsts:lisuidsrc -msgid "Src" -msgstr "йУИ" - -#: lazarusidestrconsts:dlgcostack -msgid "Stack" -msgstr "уФЕЛБ" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu -msgid "Standard Edit Menu" -msgstr "уФБОДБТФОПЕ НЕОА рТБЧЛБ" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu -msgid "Standard File Menu" -msgstr "уФБОДБТФОПЕ НЕОА жБКМ" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu -msgid "Standard Help Menu" -msgstr "уФБОДБТФОПЕ НЕОА уРТБЧЛБ" - -#: lazarusidestrconsts:lisstartwithanewproject -msgid "Start with a new project" -msgstr "" - -#: lazarusidestrconsts:lisoipstate -msgid "State" -msgstr "уПУФПСОЙЕ" - -#: lazarusidestrconsts:dlgstatickeyword -msgid "Static Keyword in Objects" -msgstr "лМАЮЕЧПЕ УМПЧП Static Ч ПВЯЕЛФБИ" - -#: lazarusidestrconsts:lishintstepinto -msgid "Step Into" -msgstr "ыБЗ УП ЧИПДПН" - -#: lazarusidestrconsts:lishintstepover -msgid "Step Over" -msgstr "ыБЗ Ч ПВИПД" - -#: lazarusidestrconsts:lismenustepinto -msgid "Step into" -msgstr "ыБЗ УП ЧИПДПН" - -#: lazarusidestrconsts:lismenustepover -msgid "Step over" -msgstr "ыБЗ Ч ПВИПД" - -#: lazarusidestrconsts:lismenustop -msgid "Stop" -msgstr "пУФБОПЧ" - -#: lazarusidestrconsts:lisstopdebugging -msgid "Stop Debugging?" -msgstr "пУФБОПЧЙФШ ПФМБДЛХ?" - -#: lazarusidestrconsts:dlgstopafternrerr -msgid "Stop after number of errors:" -msgstr "пУФБОПЧ РПУМЕ ЮЙУМБ ПЫЙВПЛ" - -#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject -msgid "Stop current debugging and rebuild project?" -msgstr "" - -#: lazarusidestrconsts:lisstopdebugging2 -msgid "Stop debugging?" -msgstr "" - -#: lazarusidestrconsts:lisstopthedebugging -msgid "Stop the debugging?" -msgstr "пУФБОПЧЙФШ ПФМБДЛХ?" - -#: lazarusidestrconsts:dlgcdtstoredpostfix -msgid "Stored postfix" -msgstr "рТЕЖЙЛУ STORED" - -#: lazarusidestrconsts:lisstreamingerror -msgid "Streaming error" -msgstr "пЫЙВЛБ РПФПЛПЧ" - -#: lazarusidestrconsts:lismakeresstrstringconstantinsource -msgid "String Constant in source" -msgstr "уФТПЛПЧБС ЛПОУФБОФБ Ч ЙУИПДОЙЛЕ" - -#: lazarusidestrconsts:liscodetoolsoptsstringconst -msgid "String constant" -msgstr "уФТПЛПЧБС ЛПОУФБОФБ" - -#: lazarusidestrconsts:lismakeresstrstringswithsamevalue -msgid "Strings with same value:" -msgstr "уФТПЛЙ У ФЕН ЦЕ ЪОБЮЕОЙЕН:" - -#: lazarusidestrconsts:dlgcostrip -msgid "Strip Symbols From Executable" -msgstr "чЩТЕЪБФШ УЙНЧПМЩ ЙЪ ВЙОБТОЙЛБ" - -#: lazarusidestrconsts:dlgcostyle -msgid "Style:" -msgstr "уФЙМШ:" - -#: lazarusidestrconsts:lissubprocedure -msgid "Sub Procedure" -msgstr "рПДРТПГЕДХТБ" - -#: lazarusidestrconsts:lissubprocedureonsamelevel -msgid "Sub Procedure on same level" -msgstr "рПДРТПГЕДХТБ ФПЗП ЦЕ ХТПЧОС" - -#: lazarusidestrconsts:dlgedbsubdir -msgid "Sub directory" -msgstr "рПДЛБФБМПЗ" - -#: lazarusidestrconsts:dlgsubpropkcolor -msgid "Subpropertes" -msgstr "" - -#: lazarusidestrconsts:lisa2pswitchpaths -msgid "Switch Paths" -msgstr "рЕТЕЛМАЮЙФШ РХФЙ" - -#: lazarusidestrconsts:srkmectoggleformunit -msgid "Switch between form and unit" -msgstr "рЕТЕЛМАЮЙФШ НПДХМШ/ЖПТНХ" - -#: lazarusidestrconsts:liscodetoolsoptssymbol -msgid "Symbol" -msgstr "уЙНЧПМ" - -#: lazarusidestrconsts:dlgsmbbehind -msgid "Symbol behind (.pp~)" -msgstr "уЙНЧПМ УЪБДЙ (.~pp)" - -#: lazarusidestrconsts:dlgsmbfront -msgid "Symbol in front (.~pp)" -msgstr "уЙНЧПМ УРЕТЕДЙ (.~pp)" - -#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus -msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" -msgstr "SynEdit - ЛПНРПОЕОФ ТЕДБЛФПТБ, ЙУРПМШЪХЕНЩК Lazarus. http://sourceforge.net/projects/synedit/" - -#: lazarusidestrconsts:srkmecsyntaxcheck -msgid "Syntax check" -msgstr "рТПЧЕТЛБ УЙОФБЛУЙУБ" - -#: lazarusidestrconsts:dlgsyntaxoptions -msgid "Syntax options" -msgstr "" - -#: lazarusidestrconsts:dlgrunosystemvariables -msgid "System variables" -msgstr "уЙУФЕНОЩЕ РЕТЕНЕООЩЕ" - -#: lazarusidestrconsts:dlgbp7cptb -msgid "TP/BP 7.0 Compatible" -msgstr "уПЧНЕУФЙНПУФШ У TP/BP 7.0" - -#: lazarusidestrconsts:srvk_tab -msgid "Tab" -msgstr "фбв" - -#: lazarusidestrconsts:dlgtabindent -msgid "Tab indents blocks" -msgstr "фбв ЧЩДЕМСЕФ ВМПЛЙ" - -#: lazarusidestrconsts:fdmtaborder -msgid "Tab order..." -msgstr "" - -#: lazarusidestrconsts:liseotabwidths -msgid "Tab widths" -msgstr "" - -#: lazarusidestrconsts:dlgtabstospaces -msgid "Tabs to spaces" -msgstr "фбв Ч РТПВЕМЩ" - -#: lazarusidestrconsts:lismenutabstospacesselection -msgid "Tabs to spaces in selection" -msgstr "фбв УДЕМБФШ РТПВЕМБНЙ Ч ЧЩДЕМЕООПН" - -#: lazarusidestrconsts:listargetcpu -msgid "Target CPU" -msgstr "дМС гр:" - -#: lazarusidestrconsts:lislazbuildtargetdirectory -msgid "Target Directory:" -msgstr "лБФБМПЗ ОБЪОБЮЕОЙС:" - -#: lazarusidestrconsts:listargetos -msgid "Target OS" -msgstr "дМС ЛБЛПК пу" - -#: lazarusidestrconsts:liscotargetosspecificoptions -msgid "Target OS specific options" -msgstr "уРЕГЙЖЙЮЕУЛЙЕ РБТБНЕФТЩ пу" - -#: lazarusidestrconsts:lislazbuildtargetos -msgid "Target OS:" -msgstr "дМС пу:" - -#: lazarusidestrconsts:dlgtargetplatform -msgid "Target Platform:" -msgstr "" - -#: lazarusidestrconsts:dlgpotargetfilename -msgid "Target file name:" -msgstr "йНС ЙУРПМОСЕНПЗП ЖБКМБ:" - -#: lazarusidestrconsts:listargetfilenameplusparams -msgid "Target filename + params" -msgstr "йНС ЖБКМБ ВЙОБТОЙЛБ У РБТБНЕФТБНЙ" - -#: lazarusidestrconsts:listargetfilenameofproject -msgid "Target filename of project" -msgstr "йНС ЖБКМБ ВЙОБТОЙЛБ РТПЕЛФБ" - -#: lazarusidestrconsts:dlgtargetproc -msgid "Target i386" -msgstr "" - -#: lazarusidestrconsts:lismenueditortemplatepreview -msgid "Template Preview" -msgstr "рТПУНПФТ ЫБВМПОБ" - -#: lazarusidestrconsts:dlgtplfname -msgid "Template file name" -msgstr "йНС ЖБКМБ ЫБВМПОБ" - -#: lazarusidestrconsts:lisctdtemplates -msgid "Templates" -msgstr "" - -#: lazarusidestrconsts:liscomptest -msgid "Test" -msgstr "фЕУФ" - -#: lazarusidestrconsts:listestdirectory -msgid "Test directory" -msgstr "лБФБМПЗ РТПВ" - -#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg -msgid "Test directory \"%s\" not found." -msgstr "лБФБМПЗ РТПВ \"%s\" ОЕ ОБКДЕО." - -#: lazarusidestrconsts:lispkgfiletypetext -msgid "Text" -msgstr "фЕЛУФ" - -#: lazarusidestrconsts:dlgtextattributes -msgid "Text attributes" -msgstr "рБТБНЕФТЩ ФЕЛУФБ" - -#: lazarusidestrconsts:srkmcatediting -msgid "Text editing commands" -msgstr "лПНБОДЩ ТЕДБЛФЙТПЧБОЙС ФЕЛУФБ" - -#: lazarusidestrconsts:srkmcatmarker -msgid "Text marker commands" -msgstr "лПНБОДЩ НБТЛЕТБ ФЕЛУФБ" - -#: lazarusidestrconsts:srkmcatsearchreplace -msgid "Text search and replace commands" -msgstr "лПНБОДЩ РПЙУЛБ Й ЪБНЕОЩ ФЕЛУФБ" - -#: lazarusidestrconsts:srkmcatselection -msgid "Text selection commands" -msgstr "лПНБОДЩ ЧЩДЕМЕОЙС ФЕЛУФБ" - -#: lazarusidestrconsts:lisfindfiletexttofind -msgid "Text to find:" -msgstr "йУЛБФШ ФЕЛУФ:" - -#: lazarusidestrconsts:lisdiffdlgtext1 -msgid "Text1" -msgstr "фЕЛУФ1" - -#: lazarusidestrconsts:lisdiffdlgtext2 -msgid "Text2" -msgstr "фЕЛУФ2" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" -msgstr "зМБЧОЩК ЛБФБМПЗ %s,%sЗДЕ Borland ХУФБОПЧЙМ %s ЙУИПДОЙЛЙ,%sЛПФПТЩЕ ЙУРПМШЪХЕФ ЬФПФ %s РТПЕЛФ.%sоБРТЙНЕТ: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "зМБЧОЩК ЛБФБМПЗ %s, %sЗДЕ Borland ХУФБОПЧЙМ ЧУЕ ЙУИПДОЙЛЙ %s,ЙУРПМШЪХЕНЩЕ РТПЕЛФПН %s. %sоБРТЙНЕТ: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" -msgstr "зМБЧОЩК ЛБФБМПЗ %s,%sЗДЕ Borland ХУФБОПЧЙМ ЧУЕ %s ЙУИПДОЙЛЙ.%sоБРТЙНЕТ: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "зМБЧОЩК ЛБФБМПЗ %s, %sЗДЕ Borland ХУФБОПЧЙМ ЧУЕ ЙУИПДОЙЛЙ %s. %sоБРТЙНЕТ: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory -msgid "The %s project directory,%swhich contains the .dpr, dpk file." -msgstr "лБФБМПЗ %s РТПЕЛФБ,%sУПДЕТЦБЭЙК ЖБКМЩ .dpr, dpk." - -#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase -msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "FCL - ВЙВМЙПФЕЛБ ЛПНРПОЕОФПЧ FreePascal - ПВЕУРЕЮЙЧБЕФ ВБЪПЧЩЕ ЛМБУУЩ ДМС ПВЯЕЛФОПЗП РБУЛБМС." - -#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir -msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FPC \"%s\" ЧЩЗМСДЙФ ОЕЛПТТЕЛФОП. пВЩЮОП ПО УПДЕТЦЙФ ЛБФБМПЗЙ rtl, fcl, packages, compiler, ... ." - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir -msgid "The Free Pascal SVN source directory." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory -msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." -msgstr "" - -#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm -msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "лПНРЙМСФПТ FreePascal (ЙНС ЖБКМБ: %s) ОЕ ОБКДЕО.%sчБН ТЕЛПНЕОДХЕФУС ХУФБОПЧЙФШ fpc" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory -msgid "The Free Pascal project directory." -msgstr "лБФБМПЗ РТПЕЛФБ FreePascal." - -#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun -msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "лБФБМПЗ ЙУИПДОЙЛПЧ FPC ОЕ ОБКДЕО.%sпФДЕМШОЩЕ ДЕКУФЧЙС У ЛПДПН ОЕ ВХДХФ ТБВПФБФШ.%sтЕЛПНЕОДХЕФУС ХУФБОПЧЙФШ ЕЗП Й ХУФБОПЧЙФШ РХФШ%sEnvironment -> Environment Options -> Files" - -#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase -msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "LCL - вЙВМЙПФЕЛБ ЛПНРПОЕОФПЧ Lazarus - УПДЕТЦЙФ ЧУЕ ПУОПЧОЩЕ ЛПНРПОЕОФЩ ДМС ТЕДБЛФЙТПЧБОЙС ЖПТН." - -#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis -msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "LFM-ЖБКМ (ЖБКМ ЖПТНЩ Lazarus) УПДЕТЦЙФ ОЕЛПТТЕЛФОЩЕ УЧПКУФЧБ. ьФП ЪОБЮЙФ, ОБРТЙНЕТ, ЮФП ПО УПДЕТЦЙФ ОЕЛПФПТЩЕ УЧПКУФЧБ/ЛМБУУЩ, ЛПФПТЩИ ОЕФ Ч ФЕЛХЭЕК ЧЕТУЙЙ LCL. пВЩЮОП УМЕДХЕФ ХВТБФШ ЬФЙ УЧПКУФЧБ ЙЪ lfm Й (ЕУМЙ ОБДП) ЙУРТБЧЙФШ ЛПД РБУЛБМС ЧТХЮОХА." - -#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr -msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "лБФБМПЗ Lazarus ОЕ ОБКДЕО.%sчЩ ОЕ УНПЦЕФЕ УПЪДБЧБФШ РТЙМПЦЕОЙС LCL.рТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory -msgid "The Lazarus main directory." -msgstr "зМБЧОЩК ЛБФБМПЗ Lazarus." - -#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid -msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "нБЛУЙНБМШОБС ЧЕТУЙС %s%s%s ОЕЛПТТЕЛФОБ.%sйУРПМШЪХКФЕ ЖПТНБФ ЗМБЧОБС.ЧФПТЙЮОБС.ТЕМЙЪ.УВПТЛБ%sоБРТЙНЕТ: 1.0.20.10" - -#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion -msgid "The Maximum Version is lower than the Minimim Version." -msgstr "нБЛУЙНБМШОБС ЧЕТУЙС НЕОШЫЕ НЙОЙНБМШОПК." - -#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid -msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "нЙОЙНБМШОБС ЧЕТУЙС %s%s%s ОЕЛПТТЕЛФОБ.%sйУРПМШЪХКФЕ ЖПТНБФ ЗМБЧОБС.ЧФПТЙЮОБС.ТЕМЙЪ.УВПТЛБ%sоБРТЙНЕТ: 1.0.20.10" - -#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase -msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." -msgstr "" - -#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt -msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "рТПВОЩК ЛБФБМПЗ ОЕ ОБКДЕО:%s%s%s%s%s (УН. ОБУФТПКЛЙ ПЛТХЦЕОЙС)" - -#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit -msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "оБЪЧБОЙЕ ФЙРБ РТЕДЛБ %s%s%s УПЧРБДБЕФ У%sНПДХМЕН %s%s%sА" - -#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier -msgid "The ancestor type %s%s%s is not a valid pascal identifier." -msgstr "фЙР РТЕДЛБ %s%s%s - ОЕРТБЧЙМШОЩК ЙДЕОФЙЖЙЛБФПТ РБУЛБМС" - -#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro -msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "лМБУУ %s%s%s - ЬМЕНЕОФ ХРТБЧМЕОЙС (TControl), ЕЗП ОЕМШЪС ЧУФБЧЙФШ ОБ ЮФП-ФП ДТХЗПЕ.%sоЕ НПЗХ ЧУФБЧЙФШ." - -#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame -msgid "The class name %s%s%s and ancestor type %s%s%s are the same." -msgstr "йНС ЛМБУУБ %s%s%s Й ЕЗП РТЕДЛБ %s%s%s УПЧРБДБАФ." - -#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile -msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" -msgstr "йНС ЛМБУУБ %s%s%s ХЦЕ ЕУФШ Ч%sрБЛЕФЕ %s%sжБКМ: %s%s%s" - -#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit -msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "йНС ЛМБУУБ %s%s%s УПЧРБДБЕФ У %s ЙНЕОЕН НПДХМС %s%s%s." - -#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier -msgid "The class name %s%s%s is not a valid pascal identifier." -msgstr "йНС ЛМБУУБ %s%s%s - ОЕДПРХУФЙНЩК ЙДЕОФЙЖЙЛБФПТ РБУЛБМС" - -#: lazarusidestrconsts:listhecommandafterisnotexecutable -msgid "The command after %s%s%s is not executable." -msgstr "лПНБОДБ РПУМЕ %s%s%s" - -#: lazarusidestrconsts:listhecommandafterpublishingisinvalid -msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "лПНБОДБ РПУМЕ ПРХВМЙЛПЧБОЙС ОЕЛПТТЕЛФОБ:%s%s%s%s" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg -msgid "The compiler file \"%s\" is not an executable." -msgstr "жБКМ ЛПНРЙМСФПТБ \"%s\" ОЕ ЙУРПМОСЕНЩК." - -#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable -msgid "The compiler file for package %s is not a valid executable:%s%s" -msgstr "жБКМ ЛПНРЙМСФПТБ ДМС РБЛЕФБ %s - ОЕДПРХУФЙНЩК ЙУРПМОСЕНЩК:%s%s" - -#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated -msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" -msgstr "тЕДБЛФПТ ЛПНРПОЕОФБ ДМС ЛМБУУБ %s%s%sУЧСЪБООЩК УП УМПЧПН #%s %s%s%sЧЩЪЧБМ ПЫЙВЛХ:%s%s%s%s" - -#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror -msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" -msgstr "тЕДБЛФПТ ЛПНРПОЕОФБ ДМС ЛМБУУБ %s%s%sЧЩЪЧБМ ПЫЙВЛХ:%s%s%s%s" - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "фЕЛХЭЙК ЛБФБМПЗ ЙУИПДОЙЛПЧ FPC %s%s%s%sЧЩЗМСДЙФ ОЕРТБЧЙМШОП.%sрТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "фЕЛХЭЙК ЛБФБМПЗ ЙУИПДОЙЛПЧ FPC %s%s%s%sЧЩЗМСДЙФ ОЕРТБЧЙМШОП.%sчЩВЕТЙФЕ пл ЮФПВЩ ЧЕТОХФШ ЙУРПМШЪХЕНЩК РП ХНПМЮБОЙА %s%s%s,%s ЙМЙ ЦЕ РТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "фЕЛХЭЙК ЛБФБМПЗ Lazarus %s%s%s%sЧЩЗМСДЙФ ОЕРТБЧЙМШОП.%sвЕЪ ОЕЗП чЩ ОЕ УНПЦЕФЕ УПЪДБЧБФШ РТЙМПЦЕОЙС LCL.%sрТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "фЕЛХЭЙК ЛБФБМПЗ Lazarus %s%s%s%sЧЩЗМСДЙФ ОЕРТБЧЙМШОП.%sвЕЪ ОЕЗП чЩ ОЕ УНПЦЕФЕ УПЪДБЧБФШ РТЙМПЦЕОЙС LCL.%sчЩВЕТЙФЕ пл ДМС ЙУРПМШЪПЧБОЙС ЛБФБМПЗБ РП ХНПМЮБОЙА %s%s%s,%s ЙМЙ ЦЕ РТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "%s%s%s.%sйОБЮЕ РТПЧЕТШФЕ пЛТХЦЕОЙЕ->оБУФТПКЛЙ ПЛТХЦЕОЙС->жБКМЩ" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "фЕЛХЭЕЕ ЙНС ЛПНРЙМСФПТБ %s%s%s%s - ОЕ ЙУРПМОСЕНЩК ЖБКМ.%sрТПЧЕТШФЕ Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits -msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "фЕЛХЭЙК РХФШ НПДХМС ДМС ЖБКМБ %s%s%s%s - %s%s%s%s.%s%sрХФШ Л НПДХМСН LCL %s%s%s ПФУХФУФЧХЕФ.%s%sрПДУЛБЪЛБ ДМС ОПЧЙЮЛПЧ:%sуПЪДБКФЕ РТЙМПЦЕОЙЕ lazarus Й РПНЕУФЙФЕ ЖБКМ Ч ЛБФБМПЗ РТПЕЛФБ." - -#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro -msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "" - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg -msgid "The debugger file \"%s\" is not an executable." -msgstr "жБКМ ПФМБДЮЙЛБ \"%s\" ОЕ ЙУРПМОСЕНЩК." - -#: lazarusidestrconsts:lisprojaddthedependencywasnotfound -msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "ъБЧЙУЙНПУФШ %s%s%s ОЕ ОБКДЕОБ.%sчЩВЕТЙФЕ УХЭЕУФЧХАЭЙК РБЛЕФ." - -#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist -msgid "The destination directory%s%s%s%s does not exist." -msgstr "лБФБМПЗ ОБЪОБЮЕОЙС%s%s%s%s ОЕ УХЭЕУФЧХЕФ." - -#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit -msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "" - -#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit -msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" -msgstr "" - -#: lazarusidestrconsts:dlgthedirectory -msgid "The directory \"" -msgstr "лБФБМПЗ \"" - -#: lazarusidestrconsts:listhefile -msgid "The file %s%s%s" -msgstr "жБКМ %s%s%s" - -#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage -msgid "The file %s%s%s is already in the package." -msgstr "жБКМ %s%s%s ХЦЕ Ч РБЛЕФЕ." - -#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr -msgid "The file %s%s%s is not a Delphi project (.dpr)" -msgstr "жБКМ %s%s%s ОЕ РТПЕЛФ Delphi (.dpr)" - -#: lazarusidestrconsts:listhefileisnotadelphiunit -msgid "The file %s%s%s is not a Delphi unit." -msgstr "жБКМ %s%s%s - ОЕ НПДХМШ Delphi." - -#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage -msgid "The file %s%s%s is not a lazarus package." -msgstr "жБКМ %s%s%s - ОЕ РБЛЕФ Lazarus." - -#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea -msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." -msgstr "жБКМ %s%s%s - ЮБУФШ ФЕЛХЭЕЗП РТПЕЛФБ.%sоЕ МХЮЫБС ЙДЕС - ДЕМЙФШ ЖБКМЩ НЕЦДХ РТПЕЛФБНЙ Й РБЛЕФБНЙ." - -#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage -msgid "The file %s%s%s%sis already in the package %s." -msgstr "жБКМ %s%s%s%sХЦЕ Ч РБЛЕФЕ %s." - -#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage -msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "жБКМ %s%s%s%sУЕКЮБУ ОЕ ОБИПДЙФУС Ч УРЙУЛЕ РХФЕК НПДХМЕК РБЛЕФБ.%s%sдПВБЧЙФШ ЕЗП ФХДБ?" - -#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject -msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "жБКМ %s%s%s%sЧЩЗМСДЙФ ЛБЛ РТПЗТБННБ. ъБЛТЩФШ ФЕЛХЭЙК РТПЕЛФ Й УПЪДБФШ ОПЧЩК РТПЕЛФ lazarus ДМС ЬФПК РТПЗТБННЩ?%s\"оЕФ\" ПФЛТПЕФ ЖБКМ ЛБЛ ПВЩЮОЩК ЙУИПДОЙЛ." - -#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus -msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source." -msgstr "жБКМ %s%s%s%s РПИПЦ ОБ ЖБКМ РТПЗТБННЩ УХЭЕУФЧХАЭЕЗП рТПЕЛФБ1 lazarus.%sпФЛТЩФШ РТПЕЛФ?%sпФНЕОБ ЪБЗТХЪЙФ ЖБКМ ЛБЛ ПВЩЮОЩК ЙУИПДОЙЛ." - -#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac -msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "жБКМ %s%s%s%sОБКДЕО Ч ПДОПН ЙЪ ЛБФБМПЗПЧ ЙУИПДОЙЛБ РБЛЕФБ %s, Й ПО ЧЩЗМСДЙФ ЛБЛ ПФЛПНРЙМЙТПЧБООЩК НПДХМШ. фБЛЙЕ НПДХМЙ ДПМЦОЩ ВЩФШ Ч УРЕГЙБМШОПН ЛБФБМПЗЕ РБЛЕФБ, ЙОБЮЕ ДТХЗЙЕ РБЛЕФЩ ОЕ УНПЗХФ РТБЧЙМШОП ЙУРПМШЪПЧБФШ РБЛФЕ.%s%sхДБМЙФШ ФБЛЙЕ ЖБКМЩ?" - -#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself -msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "жБКМ %s%s%s%sОЕ ОБКДЕО.%sчЩ ИПФЙФЕ РПЙУЛБФШ ЕЗП УБНПУФПСФЕМШОП?%s" - -#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject -msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "жБКМ %s%s%s%sОЕ ОБКДЕО.%sрТПРХУЛ РТПДПМЦЙФ ЪБЗТХЪЛХ РТПЕЛФБ,%sрТЕТЧБФШ - ПУФБОПЧЙФ ЪБЗТХЪЛХ." - -#: lazarusidestrconsts:uefilerotext1 -msgid "The file \"" -msgstr "жБКМ \"" - -#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject -msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." -msgstr "йНС ЖБКМБ %s%s%s - ЮБУФШ ФЕЛХЭЕЗП РТПЕЛФБ.%sрТПЕЛФЩ Й РБЛЕФЩ ОЕ ДПМЦОЩ ВЩ ДЕМЙФШ ЖБКМЩ." - -#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile -msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." -msgstr "йНС ЖБКМБ %s%s%sЙУРПМШЪХЕФУС%sРБЛЕФПН %s%s%s%sЧ ЖБКМЕ %s%s%s." - -#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage -msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" -msgstr "йНС ЖБКМБ %s%s%s ОЕ УППФЧЕФУФЧХЕФ ЙНЕОЙ РБЛЕФБ %s%s%s Ч ЖБКМЕ.%sуНЕОЙФШ ЙНС РБЛЕФБ ОБ %s%s%s?" - -#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename -msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." -msgstr "" - -#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload -msgid "The following package failed to load:" -msgstr "" - -#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload -msgid "The following packages failed to load:" -msgstr "" - -#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren -msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" -msgstr "оЕ ОБКДЕОЩ УМЕДХАЭЙЕ НПДХМЙ:%s%s%s%s1)мЙВП ЬФЙИ НПДХМЕК ОЕФ Ч РХФЙ РПЙУЛБ НПДХМЕК, ФПЗДБ РТЕТЧЙФЕ ПРЕТБГЙА УЕКЮБУ, ЙУРТБЧШФЕ РХФЙ НПДХМЕК Й РПРТПВХКФЕ УОПЧБ.%s2) чПЪНПЦОП, НПДХМЙ РПУФХРЙМЙ ЙЪ ТЕЗЙУФТПОЕЪБЧЙУЙНПК УЙУФЕНЩ (windows/Delphi), Б УЕКЮБУ ОБ ТЕЗЙУФТПЪБЧЙУЙНПК УЙУФЕНЕ (linux, bsd, macosx). ч ЬФПН УМХЮБЕ УЕКЮБУ РТЕТЧЙФЕ ПРЕТБГЙА, РЕТЕЙНЕОХКФЕ НПДХМЙ Ч ОЙЦОЙК ТЕЗЙУФТ Й РПРТПВХКФЕ УОПЧБ.%s3) нПЦОП ЙЗОПТЙТПЧБФШ ПФУХФУФЧХАЪЙЕ НПДХМЙ Й РТПДПМЦЙФШ.%s%sдПМЦОЩ МЙ ПФУХФУФЧХАЭЙЕ НПДХМЙ ВЩФШ ЪБЛПННЕОФЙТПЧБОЩ?" - -#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable -msgid "The host application %s%s%s is not executable." -msgstr "зМБЧОПЕ РТЙМПЦЕОЙЕ %s%s%s - ОЕ ЙУРПМОСЕНЩК ЖБКМ." - -#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta -msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "" - -#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir -msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." -msgstr "лБФБМПЗ lazarus \"%s\" ЧЩЗМСДЙФ ОЕЛПТТЕЛФОП. пВЩЮОП ПО УПДЕТЦЙФ ЛБФБМПЗЙ lcl, debugger, designer, components, ... ." - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg -msgid "The make file \"%s\" is not an executable." -msgstr "жБКМ make \"%s\" - ОЕ ЙУРПМОСЕНЩК ЖБКМ." - -#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion -msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "нБЛУЙНБМШОБС ЧЕТУЙС %s%s%s - ОЕРТБЧЙМШОБС ЧЕТУЙС РБЛЕФБ.%s(ИПТПЫЙК РТЙНЕТ 1.2.3.4)" - -#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion -msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "нЙОЙНБМШОБС ЧЕТУЙС %s%s%s - ОЕРТБЧЙМШОБС ЧЕТУЙС РБЛЕФБ.%s(ИПТПЫЙК РТЙНЕТ 1.2.3.4)" - -#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier -msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "йНС %s%s%s - ОЕРТБЧЙМШОЩК ЙДЕОФЙЖЙЛБФПТ РБУЛБМС." - -#: lazarusidestrconsts:lisinvalidpascalidentifiertext -msgid "The name \"%s\" is not a valid pascal identifier." -msgstr "уМПЧП \"%s\" - ОЕРТБЧЙМШОЩК ЙДЕОФЙЖЙЛБФПТ СЪЩЛБ РБУЛБМШ." - -#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages -msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "рБЛЕФ %s - РБЛЕФ ФПМШЛП ЧТЕНЕОЙ ЧЩРПМОЕОЙС.%sфБЛЙЕ РБЛЕФЩ ОЕ НПЗХФ ЧУФТБЙЧБФШУС Ч IDE." - -#: lazarusidestrconsts:lisaf2pthepackageisreadonly -msgid "The package %s is read only." -msgstr "рБЛЕФ %s ФПМШЛП ДМС ЮФЕОЙС." - -#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation -msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "рБЛЕФ %s ФТЕВХЕФУС ДМС %s, ЛПФПТЩК РПНЕЮЕО ОБ ХУФБОПЧЛХ.%sуНПФТЙ ДЙБЗТБННХ РБЛЕФПЧ." - -#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed -msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "рБЛЕФ %s ЙНЕЕФ ЖБКМ%s%s%s%s.%sдПМЦЕО МЙ ЖБКМ ВЩФШ РЕТЕЙНЕОПЧБО, ЛБЛ Й РБЛЕФ?" - -#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati -msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" -msgstr "" - -#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans -msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." -msgstr "рБЛЕФ %s%s%s ЙНЕЕФ НЕФЛХ бЧФПЙОУФБММСГЙС.%sьФП ЪОБЮЙФ, ЮФП ПО БЧФПНБФЙЮЕУЛЙ ЧУФТПЙФУС Ч IDE. хУФБОБЧМЙЧБЕНЩЕ РБЛЕФЩ%sДПМЦОЩ ВЩФШ ДМС ТБЪТБВПФЛЙ." - -#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound -msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." -msgstr "" - -#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound -msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "рБЛЕФ %s%s%s ПФНЕЮЕО ОБ ХУФБОПЧЛХ, ОП ОЕ ОБКДЕО.%sхДБМЙФШ ЪБЧЙУЙНПУФШ ЙЪ УРЙУЛБ ХУФБОПЧЛЙ РБЛЕФПЧ?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus -msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "рБЛЕФ %s%s%s РПНЕЮЕО ОБ ХУФБОПЧЛХ.%sуЕКЮБУ lazarus РПДДЕТЦЙЧБЕФ ФПМШЛП УФБФЙЮЕУЛЙ УЧСЪБООЩЕ РБЛЕФЩ. оБУФПСЭБС ХУФБОПЧЛБ ФТЕВХЕФ РЕТЕУВПТЛЙ Й РЕТЕЪБРХУЛБ lazarus.%s%sчЩ ИПФЙФЕ РЕТЕВТБФШ Lazarus УЕКЮБУ?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus -msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "рБЛЕФ %s%s%s ПФНЕЮЕО.%sуЕКЮБУ lazarus РПДДЕТЦЙЧБЕФ ФПМШЛП УФБФЙЮЕУЛЙ УЧСЪБООЩЕ РБЛЕФЩ. оБУФПСЭЕЕ ХДБМЕОЙЕ ФТЕВХЕФ РЕТЕУВПТЛЙ Й РЕТЕЪБРХУЛБ lazarus.%s%sчЩ ИПФЙФЕ РЕТЕВТБФШ Lazarus УЕКЮБУ?" - -#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename -msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." -msgstr "йНС РБЛЕФБ %s%s%s Ч%s%s%s%s - ОЕРТБЧЙМШОПЕ ЙНС РБЛЕФБ lazarus." - -#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe -msgid "The package has already a dependency for the package %s%s%s." -msgstr "рБЛЕФ ХЦЕ ЙНЕЕФ ЪБЧЙУЙНПУФШ ПФ РБЛЕФБ %s%s%s" - -#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag -msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "йНС РБЛЕФБ %s%s%s ОЕЛПТТЕЛФОП.%sчЩВЕТЙФЕ УХЭЕУФЧХАЭЙК РБЛЕФ." - -#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting -msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." -msgstr "йНС РБЛЕФБ %s%s%s ОЕЛПТТЕЛФОП.%sчЩВЕТЙФЕ УХЭЕУФЧХАЭЙК РБЛЕФ." - -#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean -msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "йНС РБЛЕФБ %s%s%s ОЕЛПТТЕЛФОП.%sчЩВЕТЙФЕ ДТХЗПК РБЛЕФ (ОБРТ., package1.lpk)." - -#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid -msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." -msgstr "йНС РБЛЕФБ %s%s%s %sЖБКМБ %s%s%s ОЕЛПТТЕЛФОП." - -#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars -msgid "The page name %s%s%s is too long (max 100 chars)." -msgstr "йНС РБЛЕФБ %s%s%s УМЙЫЛПН ДМЙООПЕ (ОБДП ДП 100 УЙНЧ.)." - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject -msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample -msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." -msgstr "рХФШ Л ЛПНРЙМСФПТХ FreePascal.%s оБРТЙНЕТ, %s/usr/bin%s -n%s ЙМЙ %s/usr/local/bin/fpc @/etc/fpc.cfg%s." - -#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla -msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" -msgstr "рТПЗТБННБ %smake%s ОЕ ОБКДЕОБ.%sьФПФ ЙОУФТХНЕОФ ОХЦЕО, ЮФПВЩ УПВТБФШ lazarus.%s" - -#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency -msgid "The project has already a dependency for the package %s%s%s." -msgstr "рТПЕЛФ ХЦЕ ЪБЧЙУЙФ ПФ РБЛЕФБ %s%s%s." - -#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource -msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "жБКМ УЧЕДЕОЙК РТПЕЛФБ %s%s%s%sУПЧРБДБЕФ У ЗМБЧОЩН ЙУИПДОЙЛПН!" - -#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest -msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "рТПЕЛФ ОБДП УПИТБОЙФШ ДП ЛПНРЙМСГЙЙ%sеУМЙ чЩ ХУФБОПЧЙФЕ ЛБФБМПЗ РТПВ Ч ОБУФТПКЛБИ ПЛТХЦЕОЙС,%sчЩ НПЦЕФЕ УПЪДБЧБФШ ОПЧЩЕ РТПЕЛФЩ Й УПВЙТБФШ ЙИ УТБЪХ.%sуПИТБОЙФШ РТПЛЕФ?" - -#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound -msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "рТПЕЛФ ФТЕВХЕФ РБЛЕФ %s%s%s.%sоП ПО ОЕ ОБКДЕО. уН. рТПЛЕФ -> йОУРЕЛФПТ РТПЕЛФБ." - -#: lazarusidestrconsts:lismakeresstrchooseanothername -msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "уФТПЛБ ТЕУХТУПЧ %s%s%s ХЦЕ ЕУФШ. %sчЩВЕТЙФЕ ДТХЗПЕ ЙНС. %s йУРПМШЪХКФЕ рТПРХУЛ, ЮФПВЩ ДПВБЧЙФШ ЛБЛ ЕУФШ." - -#: lazarusidestrconsts:listherootcomponentcannotbedeleted -msgid "The root component can not be deleted." -msgstr "лПНРПОЕОФ ЧЕТИОЕЗП ХТПЧОС ОЕ НПЦЕФ ВЩФШ ХДБМЈО." - -#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming -msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "нПДХМШ %s%s%s ХЦЕ ЕУФШ. рТПРХУЛ РТЙЧЕДЈФ Л РЕТЕЙНЕОПЧБОЙА,%sпФНЕОБ ПФНЕОЙФШ УПИТБОЕОЙЕ ЬФПЗП ЖБКМБ, Б%sрТЕТЧБФШ - ПФНЕОЙФ УПИТБОЕОЙЕ ЧППВЭЕ." - -#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds -msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" -msgstr "нПДХМШ %s%s%s ОЕ Ч ОЙЦОЕН ТЕЗЙУФТЕ.%sлПНРЙМСФПТ FreePascal 1.0.x ФТЕВХЕФ ЙНЕОБ Ч ОЙЦОЕН ТЕЗЙУФТЕ. еУМЙ чЩ ОЕ ЙУРПМШЪХЕФЕ fpc 1.0.x ДМС УВПТЛЙ ЬФПЗП НПДХМС, НПЦОП ЙЗОПТЙТПЧБФШ ЬФП УППВЭЕОЙЕ.%s%sрЕТЕЙНЕОПЧБФШ ЖБКМ?" - -#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus -msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "нПДХМШ ХЦЕ ОБЪЩЧБЕФУС %s%s%s. йДЕОФЙЖЙЛБФПТЩ РБУЛБМС ДПМЦОЩ ВЩФШ ХОЙЛБМШОЩ." - -#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject -msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." -msgstr "йНС НПДХМС %s%s%s ХЦЕ ЕУФШ Ч РТПЕЛФЕ%sЧ ЖБКМЕ: %s%s%s." - -#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection -msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." -msgstr "йНС НПДХМС %s%s%s ХЦЕ ЕУФШ Ч ЧЩДЕМЕОЙЙ%sЧ ЖБКМЕ: %s%s%s." - -#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename -msgid "The unit name %s%s%s does not correspond to the filename." -msgstr "йНС НПДХМС %s%s%s ОЕ УППФЧЕФУФЧХЕФ ЙНЕОЙ ЖБКМБ" - -#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier -msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "йНС НПДХМС %s%s%s - ОЕДПРХУФЙНЩК ЙДЕОФЙЖЙЛБФПТ РБУЛБМС." - -#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent -msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." -msgstr "йНС НПДХМС УПЧРБДБЕФ У ЪБТЕЗЙУФТЙТПЧБООЩН ЛПНРПОЕОФПН.%sьФП НПЦЕФ РТЙЧЕУФЙ Л УФТБООЩН УППВЭЕОЙСН ПВ ПЫЙВЛБИ." - -#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer -msgid "The unit name %s%s%s%sand filename %s%s%s differ." -msgstr "" - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage -msgid "The unitname %s%s%s already exists in the package:%s%s" -msgstr "йНС НПДХМС %s%s%s ХЦЕ ЪБОСФП Ч ЬФПН РБЛЕФЕ:%s%s" - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage -msgid "The unitname %s%s%s already exists in this package." -msgstr "йНС НПДХМС %s%s%s ХЦЕ ЪБОСФП Ч ЬФПН РБЛЕФЕ." - -#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu -msgid "There are more functions in the popupmenu" -msgstr "чП ЧУРМЩЧБАЭЕН НЕОА ВПМШЫЕ ЖХОЛГЙК" - -#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename -msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "ч ЛБФБМПЗЕ ЕУФШ Й ДТХЗЙЕ ЖБКМЩ У ФБЛЙН ЦЕ ЙНЕОЕН,%sПФМЙЮБАЭЙЕУС ФПМШЛП ТЕЗЙУФТПН:%s%s%sхДБМЙФШ ЙИ?" - -#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from -msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" -msgstr "еУФШ ДЧБ НПДХМС У ПДЙОБЛПЧЩН ЙНЕОЕН:%s%s1. %s%s%s ЙЪ %s%s2. %s%s%s ЙЪ %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage -msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "еУФШ НПДХМШ FPC У ФБЛЙН ЦЕ ЙНЕОЕН, ЛБЛ Й РБЛЕФ:%s%s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom -msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "еУФШ НПДХМШ FPC У ФБЛЙН ЦЕ ЙНЕОЕН, ЛБЛ:%s%s%s%s%s ЙЪ %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages -msgid "There is a circle in the required packages. See package graph." -msgstr "пВОБТХЦЕО ГЙЛМ ЪБЧЙУЙНПУФЕК РБЛЕФПЧ. уНПФТЙФЕ ДЙБЗТБННХ РБЛЕФПЧ." - -#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension -msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "оБ ДЙУЛЕ ЕУФШ ЖБКМ У ФБЛЙН ЦЕ ЙНЕОЕН Й РПИПЦЙН ТБУЫЙТЕОЙЕН%sжБКМ: %s%sрПИПЦЙК ЖБКМ: %s%s%sхДБМЙФШ ЧФПТПК ЖБКМ?" - -#: lazarusidestrconsts:lisexttoolthereisamaximumoftools -msgid "There is a maximum of %s tools." -msgstr "дПРХУЛБЕФУС НБЛУЙНХН %s ЙОУФТХНЕОФПЧ." - -#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose -msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" -msgstr "ч РТПЕЛФЕ ЕУФШ НПДХМШ У ЙНЕОЕН %s%s%s.%sчЩВЕТЙФЕ ДТХЗПЕ ЙНС" - -#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 -msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" -msgstr "еУФШ НПДХМШ У ФЕН ЦЕ ЙНЕОЕН, ЮФП Й РБЛЕФ: %s%s1. %s%s%s ЙЪ %s%s2. %s%s%s%s" - -#: lazarusidestrconsts:listhereisalreadyaformwiththename -msgid "There is already a form with the name %s%s%s" -msgstr "хЦЕ ЕУФШ ЖПТНБ У ЙНЕОЕН %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile -msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "хЦЕ ЪБЗТХЦЕО РБЛЕФ %s%s%s %sЙЪ ЖБКМБ %s%s%s.%sуН. лПНРПОЕОФЩ -> дЙБЗТБННБ РБЛЕФПЧ.%sъБНЕОБ ОЕЧПЪНПЦОБ." - -#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus -msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "хЦЕ ЕУФШ НПДХМШ, ОБЪЩЧБЕНЩК %s%s%s. йДЕОФЙЖЙЛБФПТЩ РБУЛБМС ДПМЦОЩ ВЩФШ ХОЙЛБМШОЩ." - -#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename -msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" -msgstr "хЦЕ ЕУФШ ДТХЗПК РБЛЕФ У ЙНЕОЕН %s%s%s.%sлПОЖМЙЛФХАЭЙК РБЛЕФ:%s%s%s%sжБКМ: %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages -msgid "There is an unsaved package in the required packages. See package graph." -msgstr "уТЕДЙ ФТЕВХЕНЩИ РБЛЕФПЧ ЕУФШ ОЕУПИТБОЈООЩК. уН. ДЙБЗТБННХ РБЛЕФПЧ." - -#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno -msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." -msgstr "" - -#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent -msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "рТПЙЪПЫМБ ПЫЙВЛБ РТЙ ЪБРЙУЙ ЧЩВТБООЩИ ЛПНРПОЕОФПЧ %s:%s:%s%s" - -#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe -msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "рТПЙЪПЫМБ ПЫЙВЛБ РТЙ РТЕПВТБЪПЧБОЙЙ ВЙОБТОПЗП РПФПЛБ ЧЩВТБООПЗП ЛПНРПОЕОФБ %s:%s:%s%s" - -#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli -msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "рТПЙЪПЫМБ ПЫЙВЛБ РТЙ ЛПРЙТПЧБОЙЙ РПФПЛБ ЛПНРПОЕОФБ Ч ВХЖЕТ:%s%s" - -#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage -msgid "This file is not in any loaded package." -msgstr "ьФПФ ЖБКМ ПФУХФУФЧХЕФ ЧП ЧУЕИ ЪБЗТХЦЕООЩИ РБЛЕФБИ." - -#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit -msgid "This file was automatically created by Lazarus. Do not edit!" -msgstr "" - -#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe -msgid "This is a virtual package. It has no source yet. Please save the package first." -msgstr "" - -#: lazarusidestrconsts:lisresourcefilecomment -msgid "This is an automatically generated lazarus resource file" -msgstr "ьФП - ЖБКМ ТЕУХТУПЧ, БЧФПНБФЙЮЕУЛЙ УПЪДБООЩК lazarus" - -#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents -msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "ьФП - РБЛЕФ РП ХНПМЮБОЙА. йУРПМШЪХЕФУС ФПМШЛП ДМС ЛПНРПОЕОФПЧ ВЕЪ РБЛЕФБ. фБЛЙЕ ЛПНРПОЕОФЩ ХУФБТЕМЙ." - -#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc -msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" -msgstr "" - -#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound -msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." -msgstr "" - -#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage -msgid "This source is only used to compile and install the package." -msgstr "" - -#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode -msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "ьФП ЧЩТБЦЕОЙЕ ОЕ НПЦЕФ ВЩФШ ЙЪЧМЕЮЕОП.%sчЩВЕТЙФЕ ЛБЛПК-ФП ЛПД, ЮФПВЩ ЙЪЧМЕЮШ ОПЧХА РТПГЕДХТХ/НЕФПД." - -#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired -msgid "Title and Filename required" -msgstr "фТЕВХАФУС ЪБЗПМПЧПЛ Й ЙНС ЖБКМБ" - -#: lazarusidestrconsts:dlgpotitle -msgid "Title:" -msgstr "ъБЗПМПЧПЛ:" - -#: lazarusidestrconsts:listodolistcaption -msgid "ToDo List" -msgstr "уРЙУПЛ ToDo" - -#: lazarusidestrconsts:listodolistoptions -msgid "ToDo options..." -msgstr "оБУФТПКЛЙ ToDo..." - -#: lazarusidestrconsts:lishinttoggleformunit -msgid "Toggle Form/Unit" -msgstr "рЕТЕЛМАЮЙФШ ЖПТНХ/НПДХМШ" - -#: lazarusidestrconsts:srkmectogglemode -msgid "Toggle Mode" -msgstr "рЕТЕЛМАЮЙФШ ТЕЦЙН" - -#: lazarusidestrconsts:lismenuviewtoggleformunit -msgid "Toggle form/unit view" -msgstr "рЕТЕЛМАЮЙФШ ЖПТНХ/НПДХМШ" - -#: lazarusidestrconsts:liscodetempltoken -msgid "Token:" -msgstr "" - -#: lazarusidestrconsts:lisctdefstools -msgid "Tools" -msgstr "йОУФТХНЕОФЩ" - -#: lazarusidestrconsts:srkmcattoolmenu -msgid "Tools menu commands" -msgstr "лПНБОДЩ НЕОА йОУФТХНЕОФЩ" - -#: lazarusidestrconsts:dlgtooltipeval -msgid "Tooltip expression evaluation" -msgstr "" - -#: lazarusidestrconsts:dlgtooltiptools -msgid "Tooltip symbol Tools" -msgstr "" - -#: lazarusidestrconsts:listopspaceequally -msgid "Top space equally" -msgstr "" - -#: lazarusidestrconsts:dlgtoppos -msgid "Top:" -msgstr "чЕТИ:" - -#: lazarusidestrconsts:listops -msgid "Tops" -msgstr "" - -#: lazarusidestrconsts:dlgtrimtrailingspaces -msgid "Trim trailing spaces" -msgstr "пВТЕЪБФШ ИЧПУФПЧЩЕ РТПВЕМЩ" - -#: lazarusidestrconsts:lismenutemplatetutorial -msgid "Tutorial" -msgstr "хЮЕВОЙЛ" - -#: lazarusidestrconsts:dlgenvtype -msgid "Type" -msgstr "фЙР" - -#: lazarusidestrconsts:lisuidtype -msgid "Type:" -msgstr "фЙР:" - -#: lazarusidestrconsts:dlgcdtuppercase -msgid "UPPERCASE" -msgstr "четиойк тезйуфт" - -#: lazarusidestrconsts:rslanguageukrainian -msgid "Ukrainian" -msgstr "" - -#: lazarusidestrconsts:lisunableconvertbinarystreamtotext -msgid "Unable convert binary stream to text" -msgstr "оЕ НПЗХ РТЕПВТБЪПЧБФШ ВЙОБТОЩК РПФПЛ Ч ФЕЛУФ" - -#: lazarusidestrconsts:lisunablecopycomponentstoclipboard -msgid "Unable copy components to clipboard" -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЛПНРПОЕОФЩ Ч ВХЖЕТ" - -#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith -msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." -msgstr "оЕ НПЗХ ДПВБЧЙФШ %s Л РТПЕЛФХ, Ф.Л. Ч РТПЕЛФЕ ХЦЕ ЕУФШ НПДХМШ У ФБЛЙН ЙНЕОЕН." - -#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably -msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "оЕ НПЗХ ДПВБЧЙФШ ТЕУХТУ T%s:FORMDATA Л ЖБКМХ ТЕУХТУПЧ %s%s%s%s.%sчПЪНПЦОП, ПЫЙВЛБ УЙОФБЛУЙУБ." - -#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile -msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "оЕ НПЗХ ДПВБЧЙФШ ЛПННЕОФБТЙК ЪБЗПМПЧЛБ ТЕУХТУБ Л ЖБКМХ ТЕУХТУБ %s%s%s%s.%sчПЪНПЦОП, ПЫЙВЛБ УЙОФБЛУЙУБ." - -#: lazarusidestrconsts:lisunabletobackupfileto -msgid "Unable to backup file %s%s%s to %s%s%s!" -msgstr "оЕ НПЗХ УПИТБОЙФШ ТЕЪЕТЧОЩК ЖБКМ %s%s%s ЛБЛ %s%s%s!" - -#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist -msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." -msgstr "оЕ НПЗХ ЙЪНЕОЙФШ УРЙУПЛ БЧФПУПЪДБЧБЕНЩИ ЖПТН Ч ЙУИПДОЙЛЕ РТПЗТБННЩ.%sйУРТБЧШФЕ УОБЮБМБ ПЫЙВЛЙ." - -#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions -msgid "Unable to clean up %s%s%s.%sPlease check permissions." -msgstr "оЕ НПЗХ ПЮЙУФЙФШ %s%s%s.%sрТПЧЕТШФЕ ДПУФХР." - -#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory -msgid "Unable to clean up destination directory" -msgstr "оЕ НПЗХ ПЮЙУФЙФШ ЛБФБМПЗ ОБЪОБЮЕОЙС" - -#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat -msgid "Unable to convert component text into binary format:%s%s" -msgstr "оЕ НПЗХ РТЕПВТБЪПЧБФШ ЛПНРПОЕОФ ЙЪ ФЕЛУФПЧПЗП Ч ВЙОБТОЩК ЖПТНБФ:%s%s" - -#: lazarusidestrconsts:lisunabletoconvertfileerror -msgid "Unable to convert file %s%s%s%sError: %s" -msgstr "оЕ НПЗХ РЕТЕЧЕУФЙ ЖБКМ %s%s%s%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile -msgid "Unable to convert lfm to lrs and write lrs file." -msgstr "оЕЧПЪНПЦОП РТЕПВТБЪПЧБФШ lfm Ч lrs Й ЪБРЙУБФШ lrs-ЖБКМ." - -#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream -msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" -msgstr "оЕ НПЗХ РТЕЧТБФЙФШ ФЕЛУФПЧЩЕ ДБООЩЕ ЖПТНЩ ЖБКМБ %s%s%s%s%sЧ ДЧПЙЮОЩК РПФПЛ. (%s)" - -#: lazarusidestrconsts:lisunabletocopyfile -msgid "Unable to copy file" -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЖБКМ" - -#: lazarusidestrconsts:lisunabletocopyfileto -msgid "Unable to copy file %s%s%s%sto %s%s%s" -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЖБКМ %s%s%s%sЧ %s%s%s" - -#: lazarusidestrconsts:lisunabletocopyfileto2 -msgid "Unable to copy file %s%s%s%sto %s%s%s." -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЖБКМ %s%s%s%sЧ %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatebackupdirectory -msgid "Unable to create backup directory %s%s%s." -msgstr "оЕ НПЗХ УПЪДБФШ ТЕЪЕТЧОЩК ЛБФБМПЗ %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletocreatedirectory -msgid "Unable to create directory" -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ" - -#: lazarusidestrconsts:lisunabletocreatedirectory2 -msgid "Unable to create directory %s%s%s" -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ %s%s%s" - -#: lazarusidestrconsts:lisunabletocreatedirectory -msgid "Unable to create directory %s%s%s." -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatefile -msgid "Unable to create file" -msgstr "оЕ НПЗХ УПЪДБФШ ЖБКМ" - -#: lazarusidestrconsts:lisunabletocreatefile2 -msgid "Unable to create file %s%s%s" -msgstr "оЕ НПЗХ УПЪДБФШ ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lisunabletocreatefilename -msgid "Unable to create file %s%s%s." -msgstr "оЕ НПЗХ УПЪДБФШ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatefile3 -msgid "Unable to create file%s%s%s%s" -msgstr "оЕ НПЗХ УПЪДБФШ ЖБКМ %s%s%s%s" - -#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin -msgid "Unable to create new method. Plz fix the error shown in the message window." -msgstr "оЕ НПЗХ УПЪДБФШ ОПЧЩК НЕФПД. йУРТБЧШФЕ ПЫЙВЛЙ, ХЛБЪБООЩЕ Ч ПЛОЕ УППВЭЕОЙК." - -#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage -msgid "Unable to create output directory %s%s%s%sfor package %s." -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ ЧЩЧПДБ %s%s%s%sЙЪ РБЛЕФБ %s." - -#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage -msgid "Unable to create package source directory %s%s%s%sfor package %s." -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ ЙУИПДОЙЛБ РБЛЕФБ %s%s%s%sДМС РБЛЕФБ %s." - -#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus -msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." -msgstr "оЕ НПЗХ УПЪДБФШ ЛБФБМПЗ ГЕМЙ ДМС lazarus:%s%s%s%s.%sьФПФ ЛБФБМПЗ ОХЦЕО ДМС ЧОПЧШ ЙЪНЕОЈООПК IDE lazarus У ЧБЫЙНЙ РБЛЕФБНЙ." - -#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer -msgid "Unable to create temporary lfm buffer." -msgstr "" - -#: lazarusidestrconsts:lisunabletodeleteambiguousfile -msgid "Unable to delete ambiguous file %s%s%s" -msgstr "оЕ НПЗХ ХДБМЙФШ ДЧХУНЩУМЕООЩК ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lispkgmangunabletodeletefilename -msgid "Unable to delete file" -msgstr "оЕ НПЗХ ХДБМЙФШ ЖБКМ" - -#: lazarusidestrconsts:lispkgmangunabletodeletefile -msgid "Unable to delete file %s%s%s." -msgstr "оЕ НПЗХ ХДБМЙФШ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage -msgid "Unable to delete old state file %s%s%s%sfor package %s." -msgstr "оЕ НПЗХ ХДБМЙФШ УФБТЩК ЖБКМ %s%s%s%s ЙЪ РБЛЕФБ %s." - -#: lazarusidestrconsts:lisunabletofindinlfmstream -msgid "Unable to find %s in LFM Stream." -msgstr "" - -#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe -msgid "Unable to find a ResourceString section in this or any of the used units." -msgstr "оЕ НПЗХ ОБКФЙ УЕЛГЙА ResourceStribg Ч ЬФПН ЙМЙ МАВПН ЙУРПМШЪХЕНПН НПДХМЕ." - -#: lazarusidestrconsts:lisunabletofindavalidclassnamein -msgid "Unable to find a valid classname in %s%s%s" -msgstr "оЕ НПЗХ ОБКФЙ РТБЧЙМШОПЕ ЙНС ЛМБУУБ Ч %s%s%s" - -#: lazarusidestrconsts:lisunabletofindfile -msgid "Unable to find file %s%s%s." -msgstr "оЕ НПЗХ ОБКФЙ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption -msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" -msgstr "оЕ НПЗХ ОБКФЙ ЖБКМ %s%s%s.%sрТПЧЕТШФЕ РХФШ РПЙУЛБ Ч%sрТПЕЛФ->рБТБНЕФТЩ ЛПНРЙМСФПТБ...->рХФЙ->дТХЗЙЕ ЖБКМЩ НПДХМЕК" - -#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage -msgid "Unable to find method. Plz fix the error shown in the message window." -msgstr "оЕ НПЗХ ОБКФЙ НЕФПД. йУРТБЧШФЕ ПЫЙВЛЙ Ч ПЛОЕ УППВЭЕОЙК." - -#: lazarusidestrconsts:lisunabletogathereditorchanges -msgid "Unable to gather editor changes." -msgstr "" - -#: lazarusidestrconsts:lisunabletogetsourcefordesigner -msgid "Unable to get source for designer." -msgstr "" - -#: lazarusidestrconsts:lisdebugunabletoloadfile -msgid "Unable to load file" -msgstr "оЕ НПЗХ ЪБЗТХЪЙФШ ЖБКМ" - -#: lazarusidestrconsts:lisdebugunabletoloadfile2 -msgid "Unable to load file %s%s%s." -msgstr "оЕ НПЗХ ЪБЗТХЪЙФШ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis -msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "оЕ НПЗХ ЪБЗТХЪЙФШ УФБТЩК ТЕУХТУОЩК ЖБКМ.%sьФПФ ЖБКМ - РЕТЧЩК ЧЛМАЮБЕНЩК ЖБКМ Ч%s ТБЪДЕМ ЙОЙГЙБМЙЪБГЙЙ.%sоБРТЙНЕТ, {$I %s.lrs}.%sчПЪНПЦОП, ПЫЙВЛБ УЙОФБЛУЙУБ." - -#: lazarusidestrconsts:lispkgmangunabletoloadpackage -msgid "Unable to load package" -msgstr "оЕ НПЗХ ЪБЗТХЪЙФШ РБЛЕФ" - -#: lazarusidestrconsts:lispkgmangunabletoopenthepackage -msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." -msgstr "" - -#: lazarusidestrconsts:lisunabletoreadfile -msgid "Unable to read file" -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ" - -#: lazarusidestrconsts:lisunabletoreadfile2 -msgid "Unable to read file %s%s%s!" -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ %s%s%s!" - -#: lazarusidestrconsts:lisunabletoreadfileerror -msgid "Unable to read file %s%s%s%sError: %s" -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ %s%s%s%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:lisunabletoreadfilename -msgid "Unable to read file %s%s%s." -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletoreadpackagefile -msgid "Unable to read package file %s%s%s." -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ РБЛЕФБ %s%s%s." - -#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror -msgid "Unable to read state file %s of project %s%sError: %s" -msgstr "" - -#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror -msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" -msgstr "оЕ НПЗХ РТПЮЙФБФШ ЖБКМ УПУФПСОЙС %s%s%s%sРБЛЕФБ %s.%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:lisunabletoremoveoldbackupfile -msgid "Unable to remove old backup file %s%s%s!" -msgstr "оЕ НПЗХ УФЕТЕФШ УФБТЩК ТЕЪЕТЧОЩК ЖБКМ %s%s%s!" - -#: lazarusidestrconsts:lisunabletorenameambiguousfileto -msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" -msgstr "оЕ НПЗХ РЕТЕЙНЕОПЧБФШ ДЧХУНЩУМЕООЩК ЖБКП %s%s%s%sЧ %s%s%s" - -#: lazarusidestrconsts:lisunabletorenamefile -msgid "Unable to rename file" -msgstr "оЕ НПЗХ РЕТЕЙНЕОПЧБФШ ЖБКМ" - -#: lazarusidestrconsts:lisunabletorenamefileto -msgid "Unable to rename file %s%s%s to %s%s%s!" -msgstr "оЕ НПЗХ РЕТЕЙНЕОПЧБФШ ЖБКМ %s%s%s Ч %s%s%s!" - -#: lazarusidestrconsts:lisunabletorenamefileto2 -msgid "Unable to rename file %s%s%s%sto %s%s%s." -msgstr "оЕ НПЗХ РЕТЕЙНЕОПЧБФШ ЖБКМ %s%s%s%sЧ %s%s%s." - -#: lazarusidestrconsts:lisunabletorenameforminsource -msgid "Unable to rename form in source." -msgstr "оЕЧПЪНПЦОП РЕТЕЙНЕОПЧБФШ ЖПТНХ Ч ЙУИПДОЙЛЕ" - -#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag -msgid "Unable to rename method. Plz fix the error shown in the message window." -msgstr "оЕ НПЗХ РЕТЕЙНЕОПЧБФШ НЕФПД. йУРТБЧШФЕ ПЫЙВЛХ, УН. ПЛОП УППВЭЕОЙК." - -#: lazarusidestrconsts:lisunabletorenamevariableinsource -msgid "Unable to rename variable in source." -msgstr "оЕЧПЪНПЦОП РЕТЕЙНЕОПЧБФШ РЕТЕНЕООХА Ч ЙУИПДОЙЛЕ." - -#: lazarusidestrconsts:lisexttoolunabletorunthetool -msgid "Unable to run the tool %s%s%s:%s%s" -msgstr "оЕ НПЗХ ЪБРХУФЙФШ ЙОУФТХНЕОФ %s%s%s:%s%s" - -#: lazarusidestrconsts:lisunabletosavefile -msgid "Unable to save file %s%s%s" -msgstr "оЕ НПЗХ УПИТБОЙФШ ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage -msgid "Unable to show method. Plz fix the error shown in the message window." -msgstr "оЕ НПЗХ РПЛБЪБФШ НЕФПД. йУРТБЧШФЕ ПЫЙВЛХ, УН. ПЛОП УППВЭЕОЙК." - -#: lazarusidestrconsts:lisunabletostreamt -msgid "Unable to stream %s:T%s." -msgstr "оЕ НПЗХ УДЕМБФШ РПФПЛ %s:T%s." - -#: lazarusidestrconsts:lisunabletostreamselectedcomponents -msgid "Unable to stream selected components" -msgstr "оЕ НПЗХ УЛПРЙТПЧБФШ ЧЩВТБООЩЕ ЛПНРПОЕОФЩ Ч РПФПЛ" - -#: lazarusidestrconsts:lisunabletostreamselectedcomponents2 -msgid "Unable to stream selected components." -msgstr "" - -#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext -msgid "Unable to transform binary component stream of %s:T%s into text." -msgstr "оЕ НПЗХ РЕТЕЧЕУФЙ ДЧПЙЮОЩК ЛПНРПОЕОФ РПФПЛБ %s:T%s Ч ФЕЛУФ." - -#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource -msgid "Unable to update CreateForm statement in project source" -msgstr "оЕЧПЪНПЦОП ПВОПЧЙФШ ЧЩТБЦЕОЙЕ CreateForm Ч ЙУИПДОЙЛЕ РТПЕЛФБ" - -#: lazarusidestrconsts:lisunabletowrite -msgid "Unable to write %s%s%s%s%s." -msgstr "оЕ НПЗХ ЪБРЙУБФШ %s%s%s%s%s." - -#: lazarusidestrconsts:lisunabletowritefile -msgid "Unable to write file" -msgstr "оЕ НПЗХ ЪБРЙУБФШ ЖБКМ" - -#: lazarusidestrconsts:lisunabletowritefile2 -msgid "Unable to write file %s%s%s" -msgstr "оЕ НПЗХ ЪБРЙУБФШ ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lisunabletowritefileerror -msgid "Unable to write file %s%s%s%sError: %s" -msgstr "оЕ НПЗХ ЪБРЙУБФШ ЖБКМ %s%s%s%sError: %s" - -#: lazarusidestrconsts:lisunabletowritefilename -msgid "Unable to write file %s%s%s." -msgstr "оЕ НПЗХ ЪБРЙУБФШ ЖБКМ %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror -msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" -msgstr "оЕ НПЗХ ЪБРЙУБФШ РБЛЕФ %s%s%s%sЧ ЖБКМ %s%s%s.%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror -msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" -msgstr "оЕ НПЗХ ЪБРЙУБФШ ЖБКМ УПУФПСОЙС %s%s%s%sРБЛЕФБ %s.%sпЫЙВЛБ: %s" - -#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror -msgid "Unable to write state file for project %s%sError: %s" -msgstr "" - -#: lazarusidestrconsts:lisunabletowritetofile2 -msgid "Unable to write to file %s%s%s" -msgstr "оЕ НПЗХ ЪБРЙУБФШ Ч ЖБКМ %s%s%s" - -#: lazarusidestrconsts:lisunabletowritetofile -msgid "Unable to write to file %s%s%s!" -msgstr "оЕ НПЗХ ЪБРЙУБФШ Ч ЖБКМ %s%s%s!" - -#: lazarusidestrconsts:dlguncertopt -msgid "Uncertain Optimizations" -msgstr "оЕУФБОДБТФОБС ПРФЙНЙЪБГЙС" - -#: lazarusidestrconsts:lismenuuncommentselection -msgid "Uncomment selection" -msgstr "тБУЛПННЕОФЙТПЧБФШ" - -#: lazarusidestrconsts:liscodetoolsdefsundefine -msgid "Undefine" -msgstr "уОСФШ ПРТЕДЕМЕОЙЕ" - -#: lazarusidestrconsts:liscodetoolsdefsundefineall -msgid "Undefine All" -msgstr "уОСФШ ПРТЕДЕМЕОЙЕ УП ЧУЕИ" - -#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse -msgid "Undefine Recurse" -msgstr "тЕЛХТУЙЧОП УОСФШ ПРТЕДЕМЕОЙЕ" - -#: lazarusidestrconsts:dlgedunder -msgid "Underline" -msgstr "рПДЮЕТЛОХФЩК" - -#: lazarusidestrconsts:lismenuundo -msgid "Undo" -msgstr "пФНЕОЙФШ" - -#: lazarusidestrconsts:dlgundoaftersave -msgid "Undo after save" -msgstr "пФЛБФ РПУМЕ УПИТБОЕОЙС" - -#: lazarusidestrconsts:dlgundolimit -msgid "Undo limit" -msgstr "" - -#: lazarusidestrconsts:srkmecblockunindent -msgid "Unindent block" -msgstr "пФНЕОЙФШ ПФДЕМЕОЙЕ ВМПЛБ" - -#: lazarusidestrconsts:lismenuunindentselection -msgid "Unindent selection" -msgstr "уДЧЙОХФШ ВМПЛ ЧМЕЧП" - -#: lazarusidestrconsts:lispckedituninstall -msgid "Uninstall" -msgstr "дЕЙОУФБММЙТПЧБФШ" - -#: lazarusidestrconsts:lispckexpluninstallonnextstart -msgid "Uninstall on next start" -msgstr "дЕЙОУФБММЙТПЧБФШ РТЙ УМЕД. РХУЛЕ" - -#: lazarusidestrconsts:lispkgmanguninstallpackage2 -msgid "Uninstall package %s?" -msgstr "дЕЙОУФБММЙТПЧБФШ РБЛЕФ %s?" - -#: lazarusidestrconsts:lispkgmanguninstallpackage -msgid "Uninstall package?" -msgstr "дЕЙОУФБММЙТПЧБФШ РБЛЕФ?" - -#: lazarusidestrconsts:lisuninstallselection -msgid "Uninstall selection" -msgstr "дЕЙОУФБММЙТПЧБФШ ЧЩДЕМЕОЙЕ" - -#: lazarusidestrconsts:lispkgfiletypeunit -msgid "Unit" -msgstr "нПДХМШ" - -#: lazarusidestrconsts:lisunithaschangedsave -msgid "Unit %s%s%s has changed. Save?" -msgstr "нПДХМШ %s%s%s ЙЪНЕОЈО. уПИТБОЙФШ?" - -#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage -msgid "Unit %s%s%s was removed from package" -msgstr "нПДХМШ %s%s%s ВЩМ ХДБМЈО ЙЪ РБЛЕФБ" - -#: lazarusidestrconsts:lisa2punitfilename2 -msgid "Unit File Name:" -msgstr "йНС ЖБКМБ НПДХМС:" - -#: lazarusidestrconsts:uemshowunitinfo -msgid "Unit Info" -msgstr "уЧЕДЕОЙС П НПДХМЕ" - -#: lazarusidestrconsts:lisa2punitnameinvalid -msgid "Unit Name Invalid" -msgstr "йНС НПДХМС ОЕДПРХУФЙНП" - -#: lazarusidestrconsts:lisa2punitname -msgid "Unit Name:" -msgstr "йНС НПДХМС:" - -#: lazarusidestrconsts:lisaf2punitname -msgid "Unit Name: " -msgstr "йНС НПДХМС: " - -#: lazarusidestrconsts:lisunitoutputdirectory -msgid "Unit Output directory" -msgstr "лБФБМПЗ ДМС ЗЕОЕТБГЙЙ НПДХМЕК" - -#: lazarusidestrconsts:lispkgdefsunitpath -msgid "Unit Path" -msgstr "рХФШ НПДХМС" - -#: lazarusidestrconsts:dlgcounitstyle -msgid "Unit Style:" -msgstr "уФЙМШ НПДХМЕК:" - -#: lazarusidestrconsts:dlgunitdepcaption -msgid "Unit dependencies" -msgstr "ъБЧЙУЙНПУФЙ НПДХМС" - -#: lazarusidestrconsts:lisa2punitfilename -msgid "Unit file name:" -msgstr "йНС ЖБКМБ НПДХМС:" - -#: lazarusidestrconsts:lisunitidentifierexists -msgid "Unit identifier exists" -msgstr "йДЕОФЙЖЙЛБФПТ НПДХМС УХЭЕУФЧХЕФ" - -#: lazarusidestrconsts:lisprojaddunitnamealreadyexists -msgid "Unit name already exists" -msgstr "йНС НПДХМС ХЦЕ ЕУФШ" - -#: lazarusidestrconsts:lisunitnotfound -msgid "Unit not found" -msgstr "" - -#: lazarusidestrconsts:lispkgsysunitnotfound -msgid "Unit not found: %s%s%s" -msgstr "нПДХМШ ОЕ ОБКДЕО: %s%s%s" - -#: lazarusidestrconsts:dlgunitoutp -msgid "Unit output directory (-FE):" -msgstr "лБФБМПЗ ДМС ЗЕОЕТБГЙЙ НПДХМЕК (-FE):" - -#: lazarusidestrconsts:lisunitlfmfile -msgid "Unit: %s%sLFM file: %s" -msgstr "нПДХМШ: %s%sжБКМ LFM: %s" - -#: lazarusidestrconsts:lisa2punitnamealreadyexists -msgid "Unitname already exists" -msgstr "йНС НПДХМС ХЦЕ ЕУФШ" - -#: lazarusidestrconsts:lisunitnamealreadyexistscap -msgid "Unitname already in project" -msgstr "нПДХМШ У ФБЛЙН ЙНЕОЕН ХЦЕ Ч РТПЕЛФЕ" - -#: lazarusidestrconsts:lisunitsnotfound2 -msgid "Units not found" -msgstr "" - -#: lazarusidestrconsts:lismenuviewunits -msgid "Units..." -msgstr "нПДХМЙ..." - -#: lazarusidestrconsts:srvk_unknown -msgid "Unknown" -msgstr "оЕЙЪЧЕУФОЩК" - -#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug -msgid "Unknown Error, please report this bug" -msgstr "оЕЙЪЧЕУФОБС ПЫЙВЛБ, УППВЭЙФЕ П ОЕК" - -#: lazarusidestrconsts:lispkgmangunsavedpackage -msgid "Unsaved package" -msgstr "оЕУПИТБОЈООЩК РБЛЕФ" - -#: lazarusidestrconsts:dlgupword -msgid "Up" -msgstr "чЧЕТИ" - -#: lazarusidestrconsts:lisceoupdate -msgid "Update" -msgstr "" - -#: lazarusidestrconsts:lispckoptsupdaterebuild -msgid "Update/Rebuild" -msgstr "пВОПЧЙФШ/РЕТЕВТБФШ" - -#: lazarusidestrconsts:lismenuuppercaseselection -msgid "Uppercase selection" -msgstr "чЕТИОЙК ТЕЗЙУФТ ЧЩДЕМЕОЙС" - -#: lazarusidestrconsts:lispckoptsusage -msgid "Usage" -msgstr "йУРПМШЪПЧБОЙЕ" - -#: lazarusidestrconsts:dlgcoansistr -msgid "Use Ansi Strings" -msgstr "йУРПМШЪПЧБФШ УФТПЛЙ Ansi" - -#: lazarusidestrconsts:lisuseexcludefilter -msgid "Use Exclude Filter" -msgstr "" - -#: lazarusidestrconsts:dlgcoheaptrc -msgid "Use Heaptrc Unit" -msgstr "йУРПМШЪПЧБФШ НПДХМШ Heaprc" - -#: lazarusidestrconsts:lisuseincludefilter -msgid "Use Include Filter" -msgstr "" - -#: lazarusidestrconsts:dlgusecustomconfig -msgid "Use addional Compiler Config File" -msgstr "йУРПМШЪПЧБФШ ДПРПМОЙФЕМШОЩК ЖБКМ ОБУФТПЕЛ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:dlgedusedefcolor -msgid "Use default color" -msgstr "гЧЕФ РП ХНПМЮБОЙА" - -#: lazarusidestrconsts:dlgrunousedisplay -msgid "Use display" -msgstr "йУРПМШЪПЧБФШ ДЙУРМЕК" - -#: lazarusidestrconsts:dlguselaunchingapp -msgid "Use launching application" -msgstr "йУРПМШЪПЧБФШ РТЙМПЦЕОЙЕ ДМС ЪБРХУЛБ" - -#: lazarusidestrconsts:dlgusefpccfg -msgid "Use standard Compiler Config File (fpc.cfg)" -msgstr "йУРПМШЪПЧБФШ УФБОДБТФОЩК ЖБКМ ОБУФТПЕЛ (fpc.cfg)" - -#: lazarusidestrconsts:dlgusesyntaxhighlight -msgid "Use syntax highlight" -msgstr "рПДУЧЕФЛБ УЙОФБЛУЙУБ" - -#: lazarusidestrconsts:lispkgmanguseunit -msgid "Use unit" -msgstr "" - -#: lazarusidestrconsts:rsiwpusewindowmanagersetting -msgid "Use windowmanager setting" -msgstr "чЪСФШ ОБУФТПКЛЙ ДЙУР. ПЛПО" - -#: lazarusidestrconsts:srkmecuserfirst -msgid "User First" -msgstr "" - -#: lazarusidestrconsts:dlgedcustomext -msgid "User defined extension" -msgstr "рПМШЪПЧБФЕМШУЛПЕ ТБУЫЙТЕОЙЕ" - -#: lazarusidestrconsts:dlgcustomext -msgid "User defined extension (.pp.xxx)" -msgstr "тБУЫЙТЕОЙЕ РПМШЪПЧБФЕМС (.pp.xxx)" - -#: lazarusidestrconsts:dlgrunouseroverrides -msgid "User overrides" -msgstr "рПМШЪПЧБФЕМШУЛЙЕ ЪБНЕОЩ" - -#: lazarusidestrconsts:dlgvaluecolor -msgid "Value" -msgstr "ъОБЮЕОЙЕ" - -#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths -msgid "Value as File Paths" -msgstr "ъОБЮЕОЙЕ ЛБЛ РХФШ Л ЖБКМХ" - -#: lazarusidestrconsts:liscodetoolsdefsvalueastext -msgid "Value as Text" -msgstr "ъОБЮЕОЙЕ ЛБЛ ФЕЛУФ" - -#: lazarusidestrconsts:dlgrunovariable -msgid "Variable" -msgstr "рЕТЕНЕООБС" - -#: lazarusidestrconsts:lisctdefvariablename -msgid "Variable Name" -msgstr "йНС РЕТЕНЕООПК" - -#: lazarusidestrconsts:dlgcdtvariableprefix -msgid "Variable prefix" -msgstr "рТЕЖЙЛУ РЕТЕНЕООПК" - -#: lazarusidestrconsts:liscodetoolsdefsvariable -msgid "Variable:" -msgstr "рЕТЕНЕООБС:" - -#: lazarusidestrconsts:lisctdefvariable -msgid "Variable: %s" -msgstr "рЕТЕНЕООБС: %s" - -#: lazarusidestrconsts:dlgverbosity -msgid "Verbosity during compilation:" -msgstr "рПДТПВОПУФШ РТЙ ЛПНРЙМСГЙЙ:" - -#: lazarusidestrconsts:lisversion -msgid "Version" -msgstr "чЕТУЙС" - -#: lazarusidestrconsts:lisvertical -msgid "Vertical" -msgstr "чЕТФЙЛБМШОП" - -#: lazarusidestrconsts:dlggridyhint -msgid "Vertical grid step size" -msgstr "чЕТФЙЛБМШОЩК ЫБЗ УЕФЛЙ" - -#: lazarusidestrconsts:lismenuviewanchoreditor -msgid "View Anchor Editor" -msgstr "рПЛБЪБФШ ТЕДБЛФПТ РТЙЧСЪПЛ" - -#: lazarusidestrconsts:uemviewcallstack -msgid "View Call Stack" -msgstr "рПЛБЪБФШ УФЕЛ ЧЩЪПЧПЧ" - -#: lazarusidestrconsts:srkmectogglecodeexpl -msgid "View Code Explorer" -msgstr "рПЛБЪБФШ ПВПЪТЕЧБФЕМШ ЛПДБ" - -#: lazarusidestrconsts:lismenuviewcomponentpalette -msgid "View Component Palette" -msgstr "" - -#: lazarusidestrconsts:lishintviewforms -msgid "View Forms" -msgstr "рПЛБЪБФШ ЖПТНЩ" - -#: lazarusidestrconsts:lismenuviewidespeedbuttons -msgid "View IDE speed buttons" -msgstr "" - -#: lazarusidestrconsts:lismenuviewjumphistory -msgid "View Jump-History" -msgstr "рТПУНПФТ ЙУФПТЙЙ РЕТЕИПДПЧ" - -#: lazarusidestrconsts:srkmectoggleobjectinsp -msgid "View Object Inspector" -msgstr "рПЛБЪБФШ йОУРЕЛФПТ пВЯЕЛФПЧ" - -#: lazarusidestrconsts:lispckeditviewpackgesource -msgid "View Package Source" -msgstr "рПУНПФТЕФШ ЙУИПДОЙЛ РБЛЕФБ" - -#: lazarusidestrconsts:lisviewprojectunits -msgid "View Project Units" -msgstr "рПЛБЪБФШ НПДХМЙ РТПЕЛФБ" - -#: lazarusidestrconsts:srkmectogglesearchresults -msgid "View Search Results" -msgstr "рПЛБЪБФШ ТЕЪХМШФБФЩ РПЙУЛБ" - -#: lazarusidestrconsts:lismenuviewsource -msgid "View Source" -msgstr "рТПУНПФТ ЙУИПДОЙЛБ" - -#: lazarusidestrconsts:lisviewsourcelfm -msgid "View Source (.lfm)" -msgstr "" - -#: lazarusidestrconsts:srkmectogglesourceeditor -msgid "View Source Editor" -msgstr "рПЛБЪБФШ ТЕДБЛФПТ ЙУИПДОЙЛПЧ" - -#: lazarusidestrconsts:lismenuviewprojecttodos -msgid "View ToDo List" -msgstr "рПЛБЪБФШ УРЙУПЛ ToDo" - -#: lazarusidestrconsts:lismenuviewunitdependencies -msgid "View Unit Dependencies" -msgstr "рПЛБЪБФШ ЪБЧЙУЙНПУФЙ НПДХМЕК" - -#: lazarusidestrconsts:lismenuviewunitinfo -msgid "View Unit Information" -msgstr "рПУНПФТЕФШ УЧЕДЕОЙС П НПДХМЕ" - -#: lazarusidestrconsts:lishintviewunits -msgid "View Units" -msgstr "рПЛБЪБФШ НПДХМЙ" - -#: lazarusidestrconsts:srkmecviewanchoreditor -msgid "View anchor editor" -msgstr "рПЛБЪБФШ ТЕДБЛФПТ РТЙЧСЪПЛ" - -#: lazarusidestrconsts:srkmectogglebreakpoints -msgid "View breakpoints" -msgstr "рТПУНПФТ ФПЮЕЛ ПУФБОПЧБ" - -#: lazarusidestrconsts:srkmectogglecallstack -msgid "View call stack" -msgstr "рТПУНПФТ УФЕЛБ ЧЩЪПЧПЧ" - -#: lazarusidestrconsts:srkmectogglecomppalette -msgid "View component palette" -msgstr "" - -#: lazarusidestrconsts:srkmectoggledebuggerout -msgid "View debugger output" -msgstr "рТПУНПФТ ЧЩЧПДБ ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:srkmecviewforms -msgid "View forms" -msgstr "рПЛБЪБФШ ЖПТНЩ" - -#: lazarusidestrconsts:srkmectogglelocals -msgid "View local variables" -msgstr "рТПУНПФТ МПЛБМШОЩИ РЕТЕНЕООЩИ" - -#: lazarusidestrconsts:srkmcatviewmenu -msgid "View menu commands" -msgstr "лПНБОДЩ НЕОА рТПУНПФТ" - -#: lazarusidestrconsts:srkmectogglemessages -msgid "View messages" -msgstr "рТПУНПФТ УППВЭЕОЙК" - -#: lazarusidestrconsts:dlgmainviewforms -msgid "View project forms" -msgstr "рПЛБЪБФШ ЖПТНЩ РТПЕЛФБ" - -#: lazarusidestrconsts:dlgmainviewunits -msgid "View project units" -msgstr "рПЛБЪБФШ НПДХМЙ РТПЕЛФБ" - -#: lazarusidestrconsts:srkmecviewunitdependencies -msgid "View unit dependencies" -msgstr "рПЛБЪБФШ ЪБЧЙУЙНПУФЙ НПДХМЕК" - -#: lazarusidestrconsts:srkmecviewunitinfo -msgid "View unit information" -msgstr "рПЛБЪБФШ УЧЕДЕОЙС П НПДХМЕ" - -#: lazarusidestrconsts:srkmecviewunits -msgid "View units" -msgstr "рПЛБЪБФШ НПДХМЙ" - -#: lazarusidestrconsts:srkmectogglewatches -msgid "View watches" -msgstr "рПЛБЪБФШ ОБВМАДЕОЙС" - -#: lazarusidestrconsts:lishlpoptsviewers -msgid "Viewers" -msgstr "рТПУНПФТЭЙЛЙ" - -#: lazarusidestrconsts:lispkgfiletypevirtualunit -msgid "Virtual Unit" -msgstr "чЙТФХБМШОЩК НПДХМШ" - -#: lazarusidestrconsts:lisaf2pisvirtualunit -msgid "Virtual unit (source is not in package)" -msgstr "чЙТФХБМШОЩК НПДХМШ (ЙУИПДОЙЛ ОЕ Ч РБЛЕФЕ)" - -#: lazarusidestrconsts:dlgvisiblegutter -msgid "Visible gutter" -msgstr "чЙДЙНПЕ РПМЕ (МЕЧ)" - -#: lazarusidestrconsts:dlgvisiblerightmargin -msgid "Visible right margin" -msgstr "рТБЧБС ЧЙДЙНБС ЗТБОЙГБ" - -#: lazarusidestrconsts:dlgambigwarn -msgid "Warn on compile" -msgstr "рТЕДХРТ. РТЙ ЛПНРЙМСГЙЙ" - -#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena -msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." -msgstr "чОЙНБОЙЕ: ДПРПМОЙФЕМШОЩК ЖБКМ ОБУФТПЕЛ ЛПНРЙМСФПТБ ЙНЕЕФ ФБЛПЕ ЦЕ ЙНС, ЛБЛ НПЦЕФ ОБЪЩЧБФШУС ПДЙО ЙЪ УФБОДБТФОЩИ ЖБКМПЧ ОБУФТПЕЛ ЛПНРЙМСФПТБ FreePascal. ьФП РТЙЧЕДЈФ Л ЙУРПМШЪПЧБОЙА ДПРПМОЙФЕМШОПЗП ЖБКМБ Й РТПРХУЛХ УФБОДБТФОПЗП." - -#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject -msgid "Warning: The file %s%s%s%sbelongs to the current project." -msgstr "чОЙНБОЙЕ: жБКМ %s%s%s%sРТЙОБДМЕЦЙФ ФЕЛХЭЕНХ РТПЕЛФХ." - -#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis -msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" -msgstr "рТЕДХРТЕЦДЕОЙЕ: ОБКДЕО ДЧХУНЩУМЕООЩК ЖБКМ %s%s%s. йУИПДОЙЛ: %s%s%s" - -#: lazarusidestrconsts:lismenuviewwatches -msgid "Watches" -msgstr "пЛОП ОБВМАДЕОЙК" - -#: lazarusidestrconsts:dlgautocreatenewforms -msgid "When creating new forms, add them to auto-created forms" -msgstr "рТЙ УПЪДБОЙЙ ОПЧЩИ ЖПТН ДПВБЧЙФШ ЙИ Л БЧФПУПЪДБЧБЕНЩН" - -#: lazarusidestrconsts:lisceowhenswitchingfile -msgid "When switching file in source editor" -msgstr "" - -#: lazarusidestrconsts:lisfindfilewhere -msgid "Where" -msgstr "зДЕ" - -#: lazarusidestrconsts:dlgwholewordsonly -msgid "Whole Words Only" -msgstr "фПМШЛП ГЕМЩЕ УМПЧБ" - -#: lazarusidestrconsts:lisfindfilewholewordsonly -msgid "Whole words only" -msgstr "фПМШЛП ГЕМЩЕ УМПЧБ" - -#: lazarusidestrconsts:dlgwidthpos -msgid "Width:" -msgstr "ыЙТЙОБ:" - -#: lazarusidestrconsts:dlgwinpos -msgid "Window Positions" -msgstr "рПЪЙГЙЙ ПЛОБ" - -#: lazarusidestrconsts:dlgwindows -msgid "Windows" -msgstr "пЛОБ" - -#: lazarusidestrconsts:lislazbuildwithstaticpackages -msgid "With Packages" -msgstr "у РБЛЕФБНЙ" - -#: lazarusidestrconsts:liswordatcursorincurrenteditor -msgid "Word at cursor in current editor" -msgstr "уМПЧП РПД ЛХТУПТПН Ч ЬФПН ТЕДБЛФПТЕ" - -#: lazarusidestrconsts:srkmecwordcompletion -msgid "Word completion" -msgstr "ъБЧЕТЫЕОЙЕ УМПЧ" - -#: lazarusidestrconsts:dlgwordspolicies -msgid "Words" -msgstr "уМПЧБ" - -#: lazarusidestrconsts:lisedtexttoolworkingdirectory -msgid "Working Directory:" -msgstr "тБВПЮЙК ЛБФБМПЗ:" - -#: lazarusidestrconsts:dlgroworkingdirectory -msgid "Working directory" -msgstr "тБВПЮЙК ЛБФБМПЗ" - -#: lazarusidestrconsts:liswriteerror -msgid "Write Error" -msgstr "пЫЙВЛБ ЪБРЙУЙ" - -#: lazarusidestrconsts:dlgwritefpclogo -msgid "Write an FPC logo" -msgstr "чЩЧЕУФЙ МПЗПФЙР FPC" - -#: lazarusidestrconsts:liscodetoolsdefswriteerror -msgid "Write error" -msgstr "пЫЙВЛБ ЪБРЙУЙ" - -#: lazarusidestrconsts:dlgcdtwriteprefix -msgid "Write prefix" -msgstr "рТЕЖЙЛУ WRITE" - -#: lazarusidestrconsts:lisxmlfiles -msgid "XML files" -msgstr "" - -#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling -msgid "You can not build lazarus while debugging or compiling." -msgstr "чЩ ОЕ НПЦЕФЕ РЕТЕВТБФШ lazarus РТЙ ПФМБДЛЕ ЙМЙ ЛПНРЙМСГЙЙ." - -#: lazarusidestrconsts:dlgdoesnotexist -msgid "\" does not exist." -msgstr "\" ОЕ УХЭЕУФЧХЕФ." - -#: lazarusidestrconsts:uefilerotext2 -msgid "\" is not writable." -msgstr "\" ОЕ ДМС ЪБРЙУЙ." - -#: lazarusidestrconsts:srkmecabortbuild -msgid "abort build" -msgstr "РТЕТЧБФШ УВПТЛХ" - -#: lazarusidestrconsts:srkmecaddbreakpoint -msgid "add break point" -msgstr "ДПВБЧЙФШ ФПЮЛХ ПУФБОПЧБ" - -#: lazarusidestrconsts:srkmecaddwatch -msgid "add watch" -msgstr "ДПВБЧЙФШ ОБВМАДЕОЙЕ" - -#: lazarusidestrconsts:srvk_apps -msgid "application key" -msgstr "ЛМБЧЙЫБ РТЙМПЦЕОЙС" - -#: lazarusidestrconsts:lisoipautoinstalldynamic -msgid "auto install dynamic" -msgstr "БЧФПХУФБОПЧЙФШ ДЙОБНЙЮЕУЛЙ" - -#: lazarusidestrconsts:lisoipautoinstallstatic -msgid "auto install static" -msgstr "БЧФПХУФБОПЧЙФШ УФБФЙЮЕУЛЙ" - -#: lazarusidestrconsts:srkmecbuildall -msgid "build all files of program/project" -msgstr "УПВТБФШ ЧУЕ ЖБКМЩ РТПЗТБННЩ/РТПЕЛФБ" - -#: lazarusidestrconsts:srkmecbuildfile -msgid "build file" -msgstr "УПВТБФШ ЖБКМ" - -#: lazarusidestrconsts:srkmecbuild -msgid "build program/project" -msgstr "УПВТБФШ РТПЗТБННХ/РТПЕЛФ" - -#: lazarusidestrconsts:dlglefttopclr -msgid "color for left, top" -msgstr "ГЧЕФ УМЕЧБ УЧЕТИХ" - -#: lazarusidestrconsts:dlgrightbottomclr -msgid "color for right, bottom" -msgstr "ГЧЕФ УРТБЧБ УОЙЪХ" - -#: lazarusidestrconsts:srkmeccompileroptions -msgid "compiler options" -msgstr "РБТБНЕФТЩ ЛПНРЙМСФПТБ" - -#: lazarusidestrconsts:liscodetoolsdefscompilerpath -msgid "compiler path" -msgstr "РХФШ Л ЛПНРЙМСФПТХ" - -#: lazarusidestrconsts:srkmecconfigbuildfile -msgid "config build file" -msgstr "ЖБКМ ОБУФТПЕЛ УВПТЛЙ" - -#: lazarusidestrconsts:liscustomoptions -msgid "custom options" -msgstr "ПРГЙЙ РПМШЪПЧБФЕМС" - -#: lazarusidestrconsts:liscodefault -msgid "default (%s)" -msgstr "РП ХНПМЮБОЙА (%s)" - -#: lazarusidestrconsts:srkmecevaluate -msgid "evaluate/modify" -msgstr "ТБУУЮЙФБФШ/ЙЪНЕОЙФШ" - -#: lazarusidestrconsts:lisfilewheredebugoutputiswritten -msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr "" - -#: lazarusidestrconsts:lisuidinproject -msgid "in Project:" -msgstr "Ч РТПЕЛФЕ:" - -#: lazarusidestrconsts:lisfriinallopenpackagesandprojects -msgid "in all open packages and projects" -msgstr "ЧП ЧУЕИ ПФЛТЩФЩИ РБЛЕФБИ Й РТПЕЛФБИ" - -#: lazarusidestrconsts:lisfriincurrentunit -msgid "in current unit" -msgstr "Ч ФЕЛХЭЕН НПДХМЕ" - -#: lazarusidestrconsts:lisfriinmainproject -msgid "in main project" -msgstr "Ч ЗМБЧОПН РТПЕЛФЕ" - -#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit -msgid "in project/package owning current unit" -msgstr "Ч РТПЕЛФЕ/РБЛЕФЕ, УПДЕТЦБЭЕН ЬФПФ НПДХМШ" - -#: lazarusidestrconsts:lisincludepath -msgid "include path" -msgstr "РХФШ ЧЛМАЮБЕНЩИ" - -#: lazarusidestrconsts:srkmecinspect -msgid "inspect" -msgstr "РТПЧЕТЙФШ" - -#: lazarusidestrconsts:lisoipinstalleddynamic -msgid "installed dynamic" -msgstr "ХУФБОПЧМЕО ДЙОБНЙЮЕУЛЙ" - -#: lazarusidestrconsts:lisoipinstalledstatic -msgid "installed static" -msgstr "ХУФБОПЧМЕО УФБФЙЮЕУЛЙ" - -#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename -msgid "invalid Compiler filename" -msgstr "ОЕРТБЧЙМШОПЕ ЙНС лПНРЙМСФПТБ" - -#: lazarusidestrconsts:lislazarusoptionsprojectfilename -msgid "lazarus [options] " -msgstr "lazarus [ПРГЙЙ] <ЙНС ЖБКМБ РТПЕЛФБ>" - -#: lazarusidestrconsts:srvk_lwin -msgid "left windows key" -msgstr "мЕЧБС ЛМБЧЙЫБ Windows" - -#: lazarusidestrconsts:lislibrarypath -msgid "library path" -msgstr "РХФШ Л ВЙВМЙПФЕЛБН" - -#: lazarusidestrconsts:lislinkeroptions -msgid "linker options" -msgstr "РБТБНЕФТЩ МЙОЛЕТБ" - -#: lazarusidestrconsts:dlgcdtlower -msgid "lowercase" -msgstr "ОЙЦОЙК ТЕЗЙУФТ" - -#: lazarusidestrconsts:lisprojectmakrounitpath -msgid "makro ProjectUnitPath" -msgstr "" - -#: lazarusidestrconsts:lisoipmissing -msgid "missing" -msgstr "ПФУХФУФЧХЕФ" - -#: lazarusidestrconsts:lisoipmodified -msgid "modified" -msgstr "ЙЪНЕОЈО" - -#: lazarusidestrconsts:lisuidno -msgid "no" -msgstr "ОЕФ" - -#: lazarusidestrconsts:dlgnoautomaticrenaming -msgid "no automatic renaming" -msgstr "ВЕЪ БЧФПРЕТЕЙНЕОПЧБОЙС" - -#: lazarusidestrconsts:lisnoname -msgid "noname" -msgstr "ВЕЪ ЙНЕОЙ" - -#: lazarusidestrconsts:liscodetoolsdefsnoneselected -msgid "none selected" -msgstr "оЙЮЕЗП ОЕ ЧЩВТБОП" - -#: lazarusidestrconsts:lisobjectpath -msgid "object path" -msgstr "РХФШ ПВЯЕЛФБ" - -#: lazarusidestrconsts:lispckeditpackagenotsaved -msgid "package %s not saved" -msgstr "РБЛЕФ %s ОЕ УПИТБОЈО" - -#: lazarusidestrconsts:lispkgmangpackagemainsourcefile -msgid "package main source file" -msgstr "ЗМБЧОЩК ЖБКМ-ЙУИПДОЙЛ РБЛЕФБ" - -#: lazarusidestrconsts:srkmecpause -msgid "pause program" -msgstr "РТЙПУФБОПЧЙФШ РТПЗТБННХ" - -#: lazarusidestrconsts:lisctpleaseselectamacro -msgid "please select a macro" -msgstr "" - -#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig -msgid "primary config directory, where Lazarus stores its config files. Default is " -msgstr "" - -#: lazarusidestrconsts:lisoipreadonly -msgid "readonly" -msgstr "ФПМШЛП ЮФЕОЙЕ" - -#: lazarusidestrconsts:srkmecremovebreakpoint -msgid "remove break point" -msgstr "ХДБМЙФШ ФПЮЛХ ПУФБОПЧБ" - -#: lazarusidestrconsts:srkmecresetdebugger -msgid "reset debugger" -msgstr "УВТПУ ПФМБДЮЙЛБ" - -#: lazarusidestrconsts:srvk_rwin -msgid "right windows key" -msgstr "РТБЧБС ЛМБЧЙЫБ Windows" - -#: lazarusidestrconsts:srkmecrunfile -msgid "run file" -msgstr "ЪБРХУЛ ЖБКМБ" - -#: lazarusidestrconsts:srkmecrunparameters -msgid "run parameters" -msgstr "РБТБНЕФТЩ ЪБРХУЛБ" - -#: lazarusidestrconsts:srkmecrun -msgid "run program" -msgstr "ЪБРХУФЙФШ РТПЗТБННХ" - -#: lazarusidestrconsts:lissaveallmodified -msgid "save all modified files" -msgstr "уПИТБОЙФШ ЧУЕ ЙЪНЕОЕООЩЕ ЖБКМЩ" - -#: lazarusidestrconsts:lissavecurrenteditorfile -msgid "save current editor file" -msgstr "уПИТБОЙФШ ФЕЛХЭЙК ЖБКМ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:lisfindfilesearchallfilesinproject -msgid "search all files in project" -msgstr "РПЙУЛ ЧП ЧУЕИ ЖБКМБИ РТПЕЛФБ" - -#: lazarusidestrconsts:lisfindfilesearchallopenfiles -msgid "search all open files" -msgstr "РПЙУЛ ЧП ЧУЕИ ПФЛТЩФЩИ ЖБКМБИ" - -#: lazarusidestrconsts:lisfindfilesearchindirectories -msgid "search in directories" -msgstr "РПЙУЛ Ч ЛБФБМПЗБИ" - -#: lazarusidestrconsts:dlgtimesecondunit -msgid "sec" -msgstr "УЕЛ" - -#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor -msgid "secondary config directory, where Lazarus searches for config template files. Default is " -msgstr "" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi -msgid "set FPC mode to DELPHI" -msgstr "ХУФБОПЧЙФШ ТЕЦЙН FPC Ч DELPHI" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc -msgid "set FPC mode to GPC" -msgstr "ХУФБОПЧЙФШ ТЕЦЙН FPC Ч GPC" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetotp -msgid "set FPC mode to TP" -msgstr "ХУФБОПЧЙФШ ТЕЦЙН FPC Ч TP" - -#: lazarusidestrconsts:lisedtdefsetiocheckson -msgid "set IOCHECKS on" -msgstr "чЛМАЮЙФШ IOCHECKS" - -#: lazarusidestrconsts:lisedtdefsetoverflowcheckson -msgid "set OVERFLOWCHECKS on" -msgstr "чЛМАЮЙФШ OVERFLOWCHECKS" - -#: lazarusidestrconsts:lisedtdefsetrangecheckson -msgid "set RANGECHECKS on" -msgstr "чЛМАЮЙФШ RANGECHECKS" - -#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile -msgid "static packages config file" -msgstr "УФБФЙЮЕУЛЙК ЖБКМ ОБУФТПЕЛ РБЛЕФБ" - -#: lazarusidestrconsts:srkmecstopprogram -msgid "stop program" -msgstr "ПУФБОПЧЙФШ РТПЗТБННХ" - -#: lazarusidestrconsts:listhishelpmessage -msgid "this help message" -msgstr "ЬФП УРТБЧПЮОПЕ УППВЭЕОЙЕ" - -#: lazarusidestrconsts:lisunitpath -msgid "unit path" -msgstr "РХФШ НПДХМС" - -#: lazarusidestrconsts:srkmecunknown -msgid "unknown editor command" -msgstr "оЕЙЪЧЕУФОБС ЛПНБОДБ ТЕДБЛФПТБ" - -#: lazarusidestrconsts:lisedtdefuseheaptrcunit -msgid "use HeapTrc unit" -msgstr "ЙУРПМШЪПЧБФШ НПДХМШ HeapTrc" - -#: lazarusidestrconsts:lisedtdefuselineinfounit -msgid "use LineInfo unit" -msgstr "ЙУРПМШЪПЧБФШ LineInfo" - -#: lazarusidestrconsts:lisuidyes -msgid "yes" -msgstr "ДБ" - diff --git a/languages/lazaruside.ruwin.po b/languages/lazaruside.ruwin.po deleted file mode 100644 index 2a6c052861..0000000000 --- a/languages/lazaruside.ruwin.po +++ /dev/null @@ -1,8496 +0,0 @@ -#: lazarusidestrconsts:srkmcommand1 -msgid " command1 \"" -msgstr " команда1 \"" - -#: lazarusidestrconsts:srkmcommand2 -msgid " command2 \"" -msgstr " команда2 \"" - -#: lazarusidestrconsts:liscodetemplatokenalreadyexists -msgid " A token %s%s%s already exists! " -msgstr "Элемент %s%s%s уже существует! " - -#: lazarusidestrconsts:srkmalreadyconnected -msgid " The key \"%s\" is already connected to \"%s\"." -msgstr "Клавика \"%s\" уже сопоставлена с \"%s\"." - -#: lazarusidestrconsts:srkmconflicw -msgid " conflicts with " -msgstr " Конфликтует с " - -#: lazarusidestrconsts:liscompiling -msgid "%s (compiling ...)" -msgstr "%s (компилирую ...)" - -#: lazarusidestrconsts:lisdebugging -msgid "%s (debugging ...)" -msgstr "%s (идёт отладка ...)" - -#: lazarusidestrconsts:lisnewproject -msgid "%s - (new project)" -msgstr "%s - (новый проект)" - -#: lazarusidestrconsts:lislazarusversionstring -msgid "%s beta" -msgstr "" - -#: lazarusidestrconsts:lisuidbytes -msgid "%s bytes" -msgstr "%s байт" - -#: lazarusidestrconsts:liscodetoolsdefsdirectory -msgid "%s directory" -msgstr "%s - это каталог" - -#: lazarusidestrconsts:lisisalreadypartoftheproject -msgid "%s is already part of the Project." -msgstr "%s - уже часть проекта." - -#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 -msgid "%s project directory" -msgstr "Каталог проекта %s" - -#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject -msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "%s%s%s - некорректное имя проекта.%s Выберите другое (напр., project1.lpi)" - -#: lazarusidestrconsts:lissvuoisnotavalididentifier -msgid "%s%s%s is not a valid identifier." -msgstr "%s%s%s - некорректный идентификатор." - -#: lazarusidestrconsts:lisa2pisnotavalidunitname -msgid "%s%s%s is not a valid unit name." -msgstr "%s%s%s - некорректное название модуля" - -#: lazarusidestrconsts:liscoclickokifaresuretodothat -msgid "%s%sClick OK if you are sure to do that." -msgstr "" - -#: lazarusidestrconsts:lispkgsysfilename -msgid "%s%sFile Name: %s%s%s" -msgstr "%s%sИмя файла: %s%s%s" - -#: lazarusidestrconsts:lisunabletochangeclassofto -msgid "%s%sUnable to change class of %s to %s" -msgstr "%s%sНевозможно изменить класс из %s на %s" - -#: lazarusidestrconsts:lispkgsysunitname -msgid "%s%sUnit Name: %s%s%s" -msgstr "%s%sИмя модуля: %s%s%s" - -#: lazarusidestrconsts:lispckeditpage -msgid "%s, Page: %s" -msgstr "%s, Страница: %s" - -#: lazarusidestrconsts:liscodetoolsdefsautogenerated -msgid "%s, auto generated" -msgstr "%s, создан автоматически" - -#: lazarusidestrconsts:liscodetoolsdefsprojectspecific -msgid "%s, project specific" -msgstr "%s, связан с проектом" - -#: lazarusidestrconsts:lisuereadonly -msgid "%s/ReadOnly" -msgstr "%s/только чтение" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage -msgid "%sAdding new Dependency for package %s: package %s%s" -msgstr "%sДобавление новой зависимости пакета %s: пакет %s%s" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage -msgid "%sAdding new Dependency for project %s: package %s%s" -msgstr "%sДобавление новой зависимости проекта %s: пакет %s%s" - -#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu -msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." -msgstr "%sОба пакета связаны. Это значит, что либо один из них использует другой, либо оба они используются третьим пакетом." - -#: lazarusidestrconsts:lisoipdescriptiondescription -msgid "%sDescription: %s" -msgstr "%sОписание: %s" - -#: lazarusidestrconsts:lisa2pexistingfile -msgid "%sExisting file: %s%s%s" -msgstr "%sСуществующий файл: %s%s%s" - -#: lazarusidestrconsts:lisseeprojectprojectinspector -msgid "%sSee Project -> Project Inspector" -msgstr "%sСм. Проект -> Инспектор проекта" - -#: lazarusidestrconsts:lispckexplstate -msgid "%sState: " -msgstr "%sСостояние: " - -#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof -msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "%sСледующие модули будут добавлены к секции uses %s%s:%s%s%s" - -#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound -msgid "%sThis package is installed, but the lpk file was not found" -msgstr "%sЭтот пакет установлен, но файл lpk не найден" - -#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated -msgid "%sThis package was automatically created" -msgstr "%sЭтот пакет был создан автоматически" - -#: lazarusidestrconsts:uemaddbreakpoint -msgid "&Add Breakpoint" -msgstr "&Добав. точку останова" - -#: lazarusidestrconsts:uemclosepage -msgid "&Close Page" -msgstr "&Закрыть страницу" - -#: lazarusidestrconsts:lismenucomponents -msgid "&Components" -msgstr "Компоненты" - -#: lazarusidestrconsts:lismenuedit -msgid "&Edit" -msgstr "&Правка" - -#: lazarusidestrconsts:lismenufile -msgid "&File" -msgstr "&Файл" - -#: lazarusidestrconsts:uemfinddeclaration -msgid "&Find Declaration" -msgstr "&Найти описание" - -#: lazarusidestrconsts:uemgotobookmark -msgid "&Goto Bookmark" -msgstr "&Переход по закладке" - -#: lazarusidestrconsts:lismenuhelp -msgid "&Help" -msgstr "&Справка" - -#: lazarusidestrconsts:uemopenfileatcursor -msgid "&Open file at cursor" -msgstr "&Открыть файл у курсора" - -#: lazarusidestrconsts:lismenuproject -msgid "&Project" -msgstr "Про&ект" - -#: lazarusidestrconsts:dlgreplacewith -msgid "&Replace With" -msgstr "&Заменить на" - -#: lazarusidestrconsts:lismenurun -msgid "&Run" -msgstr "&Запуск" - -#: lazarusidestrconsts:uemruntocursor -msgid "&Run to Cursor" -msgstr "&Пуск до курсора" - -#: lazarusidestrconsts:lismenusearch -msgid "&Search" -msgstr "&Поиск" - -#: lazarusidestrconsts:uemsetbookmark -msgid "&Set Bookmark" -msgstr "&Установить закладку" - -#: lazarusidestrconsts:dlgtexttofing -msgid "&Text to Find" -msgstr "&Найти текст" - -#: lazarusidestrconsts:lismenutools -msgid "&Tools" -msgstr "&Инструменты" - -#: lazarusidestrconsts:lismenuview -msgid "&View" -msgstr "&Просмотр" - -#: lazarusidestrconsts:lismenuwindows -msgid "&Windows" -msgstr "&Окна" - -#: lazarusidestrconsts:liscefilter -msgid "(Filter)" -msgstr "" - -#: lazarusidestrconsts:dlgbaknosubdirectory -msgid "(no subdirectory)" -msgstr "" - -#: lazarusidestrconsts:listmunknownmacro -msgid "(unknown macro: %s)" -msgstr "(неизвестный макрос: %s)" - -#: lazarusidestrconsts:lislazdocnotagcaption -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisa2pchooseanexistingfile -msgid "" -msgstr "<выберите существующий файл>" - -#: lazarusidestrconsts:lisctdefnovariableselected -msgid "" -msgstr "<Не выбрано переменных>" - -#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen -msgid "A %s can not hold TControls.%sYou can only put non visual components on it." -msgstr "%s не может содержать компоненты TControl.%sВ него можно помещать только невизуальные компоненты." - -#: lazarusidestrconsts:lisafilealreadyexistsreplaceit -msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "Файл %s%s%s уже существует.%s Заменить?" - -#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas -msgid "A pascal unit must have the extension .pp or .pas" -msgstr "Модуль паскаля должен иметь расширение .pp или .pas" - -#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound -msgid "A required packages was not found. See package graph." -msgstr "Требуемый пакет не найден. См. диаграмму пакетов." - -#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi -msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." -msgstr "" - -#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename -msgid "A valid tool needs at least a title and a filename." -msgstr "Нормальный инструмент обязательно должен иметь заголовок и имя файла." - -#: lazarusidestrconsts:lispdabort -msgid "Abort" -msgstr "" - -#: lazarusidestrconsts:lismenuabortbuild -msgid "Abort Build" -msgstr "Прервать сборку" - -#: lazarusidestrconsts:lisabortall -msgid "Abort all" -msgstr "" - -#: lazarusidestrconsts:lisabortallloading -msgid "Abort all loading" -msgstr "" - -#: lazarusidestrconsts:lisabortloadingproject -msgid "Abort loading project" -msgstr "" - -#: lazarusidestrconsts:lismenutemplateabout -msgid "About" -msgstr "О " - -#: lazarusidestrconsts:lismenuaboutlazarus -msgid "About Lazarus" -msgstr "О проекте Lazarus" - -#: lazarusidestrconsts:srvk_accept -msgid "Accept" -msgstr "Принять" - -#: lazarusidestrconsts:liscodetoolsdefsaction -msgid "Action: %s" -msgstr "Действие: %s" - -#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme -msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "Активировать синтаксис регулярных выражений для текста и замены (почти как в perl)" - -#: lazarusidestrconsts:liscodetempladd -msgid "Add" -msgstr "Добавить" - -#: lazarusidestrconsts:lisaddtoproject -msgid "Add %s to project?" -msgstr "Добавить %s к проекту?" - -#: lazarusidestrconsts:uemaddwatchatcursor -msgid "Add &Watch At Cursor" -msgstr "Добавить &наблюдение у курсора" - -#: lazarusidestrconsts:lisa2paddfile -msgid "Add File" -msgstr "Добавить файл" - -#: lazarusidestrconsts:lisa2paddfiles -msgid "Add Files" -msgstr "Добавить файлы" - -#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist -msgid "Add LFM, LRS files, if they exist" -msgstr "Добавить LFM, LRS файлы, если есть" - -#: lazarusidestrconsts:lisa2paddunit -msgid "Add Unit" -msgstr "Добавить модуль" - -#: lazarusidestrconsts:lismenuaddcurunittopkg -msgid "Add active unit to a package" -msgstr "Добавить активный модуль к проекту" - -#: lazarusidestrconsts:lispckeditaddanitem -msgid "Add an item" -msgstr "Добавить элемент" - -#: lazarusidestrconsts:lismenuaddbreakpoint -msgid "Add breakpoint" -msgstr "Добавить точку останова" - -#: lazarusidestrconsts:liscodetempladdcodetemplate -msgid "Add code template" -msgstr "Добавить шаблон кода" - -#: lazarusidestrconsts:lismenuaddtoproject -msgid "Add editor file to Project" -msgstr "Добавить файл редактора к Проекту" - -#: lazarusidestrconsts:lisprojaddeditorfile -msgid "Add editor files" -msgstr "Добавить файлы редактора" - -#: lazarusidestrconsts:lisaf2paddfiletoapackage -msgid "Add file to a package" -msgstr "Добавить файл к пакету" - -#: lazarusidestrconsts:lisprojaddaddfiletoproject -msgid "Add file to project:" -msgstr "Добавить файл к проекту" - -#: lazarusidestrconsts:lisprojaddfiles -msgid "Add files" -msgstr "Добавить файлы" - -#: lazarusidestrconsts:lisa2paddfilestopackage -msgid "Add files to package" -msgstr "Добавить файлы к пакету" - -#: lazarusidestrconsts:srkmecaddjumppoint -msgid "Add jump point" -msgstr "Добавить точку перехода" - -#: lazarusidestrconsts:lismenuaddjumppointtohistory -msgid "Add jump point to history" -msgstr "Добавить точку перехода в историю" - -#: lazarusidestrconsts:lislazdocaddlinkbutton -msgid "Add link" -msgstr "" - -#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects -msgid "Add options to dependent packages and projects" -msgstr "Добавить параметры к зависимым пакетам и проектам" - -#: lazarusidestrconsts:lislazdocaddpathbutton -msgid "Add path" -msgstr "" - -#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects -msgid "Add paths to dependent packages/projects" -msgstr "Добавить пути к зависимым пакетам/проектам" - -#: lazarusidestrconsts:lisoifaddtofavouriteproperties -msgid "Add to favourite properties" -msgstr "Добавить свойства в избранное" - -#: lazarusidestrconsts:lisa2paddtopackage -msgid "Add to package" -msgstr "Добавить к пакету" - -#: lazarusidestrconsts:lisprojaddtoproject -msgid "Add to project" -msgstr "Добавить к проекту" - -#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit -msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." -msgstr "Добавьте модуль для использования пакетом. Выключите это только для модулей, которые не должны быть собраны в любом случае." - -#: lazarusidestrconsts:lismenuaddwatch -msgid "Add watch ..." -msgstr "Добавить наблюдение..." - -#: lazarusidestrconsts:dlgedadd -msgid "Add..." -msgstr "Добав." - -#: lazarusidestrconsts:dlgadditionalsrcpath -msgid "Additional Source search path for all projects (.pp;.pas)" -msgstr "Дополнительные пути исходников для всех проектов (.pp;.pas)" - -#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages -msgid "Additional compiler options inherited from packages" -msgstr "Дополнительные параметры компилятора, унаследованные от пакетов" - -#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp -msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "Дополнительные файлы для поиска (напр. /path/*.pas;/path2/*.pp)" - -#: lazarusidestrconsts:dlgadjusttopline -msgid "Adjust top line due to comment in front" -msgstr "Выровнять верхнюю строку по комментарию" - -#: lazarusidestrconsts:fdmalignword -msgid "Align" -msgstr "Выравнивание" - -#: lazarusidestrconsts:lisalignment -msgid "Alignment" -msgstr "Выравнивание" - -#: lazarusidestrconsts:lisallfiles -msgid "All Files" -msgstr "Все файлы" - -#: lazarusidestrconsts:dlgallfiles -msgid "All files" -msgstr "Все файлы" - -#: lazarusidestrconsts:lisedtdefallpackages -msgid "All packages" -msgstr "Все пакеты" - -#: lazarusidestrconsts:lisedtdefsallprojects -msgid "All projects" -msgstr "" - -#: lazarusidestrconsts:dlglabelgoto -msgid "Allow LABEL and GOTO" -msgstr "Разрешить LABEL и GOTO" - -#: lazarusidestrconsts:lisallowsearchingformultiplelines -msgid "Allow searching for multiple lines" -msgstr "Разрешить поиск для нескольких строк" - -#: lazarusidestrconsts:dlgalphabetically -msgid "Alphabetically" -msgstr "По алфавиту" - -#: lazarusidestrconsts:lisedtexttoolalt -msgid "Alt" -msgstr "Alt" - -#: lazarusidestrconsts:dlgaltsetclmode -msgid "Alt-Key sets column mode" -msgstr "Кнопка Alt - режим колонок" - -#: lazarusidestrconsts:srkmalternkey -msgid "Alternative Key" -msgstr "Альтернативная клавиша" - -#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged -msgid "Always build (even if nothing changed)" -msgstr "" - -#: lazarusidestrconsts:lisa2pambiguousancestortype -msgid "Ambiguous Ancestor Type" -msgstr "Неясный тип предка" - -#: lazarusidestrconsts:lisa2pambiguousclassname -msgid "Ambiguous Class Name" -msgstr "Неясное имя класса" - -#: lazarusidestrconsts:lisa2pambiguousunitname -msgid "Ambiguous Unit Name" -msgstr "Двусмысленное имя модуля" - -#: lazarusidestrconsts:lisambiguousunitfound -msgid "Ambiguous Unit found" -msgstr "Найден модуль с тем же именем" - -#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile -msgid "Ambiguous additional compiler config file" -msgstr "Найден дополнительный файл настроек компилятора с тем же именем" - -#: lazarusidestrconsts:dlgambigfileact -msgid "Ambiguous file action:" -msgstr "Неясное действие с файлом:" - -#: lazarusidestrconsts:lisambiguousfilefound -msgid "Ambiguous file found" -msgstr "Найдены разные файлы" - -#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete -msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" -msgstr "Найден неправильный файл: %s%s%s%sОн может быть перепутан с %s%s%s%s%sУдалить этот файл?" - -#: lazarusidestrconsts:lisambiguousfilesfound -msgid "Ambiguous files found" -msgstr "Найдены разные файлы" - -#: lazarusidestrconsts:lispkgmangambiguousunitsfound -msgid "Ambiguous units found" -msgstr "Найдены модули с одинаково опознаваемыми именами" - -#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro -msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" -msgstr "" - -#: lazarusidestrconsts:lisa2pancestortype -msgid "Ancestor Type" -msgstr "Тип предка" - -#: lazarusidestrconsts:lismakeresstrappendtosection -msgid "Append to section" -msgstr "Добавить к секции" - -#: lazarusidestrconsts:dlgpoapplication -msgid "Application" -msgstr "Приложение" - -#: lazarusidestrconsts:dlgapplicationsettings -msgid "Application Settings" -msgstr "Параметры приложения" - -#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra -msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "Приложение%sГрафическая программа на lcl/freepascal. Программный файл автоматически поддерживается lazarus." - -#: lazarusidestrconsts:dlgbutapply -msgid "Apply" -msgstr "Применить" - -#: lazarusidestrconsts:lispckeditapplychanges -msgid "Apply changes" -msgstr "Применить" - -#: lazarusidestrconsts:rslanguagearabic -msgid "Arabic" -msgstr "Арабский" - -#: lazarusidestrconsts:dlgcoasis -msgid "As-Is" -msgstr "Как-есть" - -#: lazarusidestrconsts:lissortselascending -msgid "Ascending" -msgstr "Наследуемый" - -#: lazarusidestrconsts:dlgenvask -msgid "Ask" -msgstr "Спросить" - -#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext -msgid "Ask before replacing each found text" -msgstr "Спросить перед заменой каждого фрагмента" - -#: lazarusidestrconsts:liscodetoolsoptsat -msgid "At" -msgstr "К" - -#: lazarusidestrconsts:lispckoptsauthor -msgid "Author:" -msgstr "Автор:" - -#: lazarusidestrconsts:dlgautoform -msgid "Auto create form when opening unit" -msgstr "Автосоздание форм при открытии модуля" - -#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly -msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." -msgstr "Автосоздаваемые элементы не могут ни редактироваться,%s ни содержать неавтосоздаваемые дочерние элементы" - -#: lazarusidestrconsts:dlgautodel -msgid "Auto delete file" -msgstr "Автоудаление файлов" - -#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited -msgid "Auto generated nodes can not be edited." -msgstr "Автосоздаваемые элементы не могут редактироваться." - -#: lazarusidestrconsts:dlgautoident -msgid "Auto indent" -msgstr "Автовыделение" - -#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall -msgid "Auto rebuild when rebuilding all" -msgstr "Пересобрать при пересборке всех" - -#: lazarusidestrconsts:dlgautoren -msgid "Auto rename file lowercase" -msgstr "Автопереименование в нижний регистр" - -#: lazarusidestrconsts:dlgautosave -msgid "Auto save" -msgstr "Автосохранение" - -#: lazarusidestrconsts:dlgautocreateforms -msgid "Auto-create forms:" -msgstr "Автосоздаваемые формы:" - -#: lazarusidestrconsts:lispckexplautocreated -msgid "AutoCreated" -msgstr "Создан автоматически" - -#: lazarusidestrconsts:rslanguageautomatic -msgid "Automatic (or english)" -msgstr "Автоматически (или английский)" - -#: lazarusidestrconsts:lisautomaticfeatures -msgid "Automatic features" -msgstr "" - -#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild -msgid "Automatically increment version on build" -msgstr "Автоматически увеличить версию при сборке" - -#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages -msgid "Automatically installed packages" -msgstr "Автоустановленные пакеты" - -#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded -msgid "Automatically rebuild as needed" -msgstr "Автоматически пересобирать при необходимости" - -#: lazarusidestrconsts:dlgavailableforms -msgid "Available forms:" -msgstr "Доступные формы:" - -#: lazarusidestrconsts:lisavailablepackages -msgid "Available packages" -msgstr "Доступные пакеты" - -#: lazarusidestrconsts:dlgedback -msgid "Back" -msgstr "Назад" - -#: lazarusidestrconsts:fdmorderbackone -msgid "Back one" -msgstr "Один задний" - -#: lazarusidestrconsts:dlgbackcolor -msgid "Background" -msgstr "Задний фон" - -#: lazarusidestrconsts:srvk_back -msgid "Backspace" -msgstr "Пробел" - -#: lazarusidestrconsts:dlgenvbckup -msgid "Backup" -msgstr "Резервирование" - -#: lazarusidestrconsts:lisbackupfilefailed -msgid "Backup file failed" -msgstr "Резервирование не удалось" - -#: lazarusidestrconsts:lisfrbackwardsearch -msgid "Backward search" -msgstr "Обратный поиск" - -#: lazarusidestrconsts:dlgbehindmethods -msgid "Behind methods" -msgstr "После методов" - -#: lazarusidestrconsts:lispkgfiletypebinary -msgid "Binary" -msgstr "Двоичный" - -#: lazarusidestrconsts:liscodetoolsdefsblock -msgid "Block" -msgstr "Блок" - -#: lazarusidestrconsts:dlgblockindent -msgid "Block indent" -msgstr "" - -#: lazarusidestrconsts:dlgedbold -msgid "Bold" -msgstr "Жирный" - -#: lazarusidestrconsts:uembookmarkn -msgid "Bookmark" -msgstr "Закладка" - -#: lazarusidestrconsts:lisbottomspaceequally -msgid "Bottom space equally" -msgstr "Место основания одинаково" - -#: lazarusidestrconsts:lisbottoms -msgid "Bottoms" -msgstr "Нижняя" - -#: lazarusidestrconsts:dlgbrachighlight -msgid "Bracket highlighting" -msgstr "Подсветка скобок" - -#: lazarusidestrconsts:lismenubeaklinesinselection -msgid "Break Lines in selection" -msgstr "Разрыв строк в выделенном" - -#: lazarusidestrconsts:srkmeclinebreak -msgid "Break line and move cursor" -msgstr "Разорвать строку, сдвинуть курсор" - -#: lazarusidestrconsts:srkmecinsertline -msgid "Break line, leave cursor" -msgstr "Разорвать строку, оставить курсор" - -#: lazarusidestrconsts:lismenuviewbreakpoints -msgid "BreakPoints" -msgstr "Точки останова" - -#: lazarusidestrconsts:lisa2pbrokendependencies -msgid "Broken Dependencies" -msgstr "Нарушенные зависимости" - -#: lazarusidestrconsts:lispkgmangbrokendependency -msgid "Broken dependency" -msgstr "Нарушенная зависимость" - -#: lazarusidestrconsts:lispatheditbrowse -msgid "Browse" -msgstr "Обзор" - -#: lazarusidestrconsts:lisbrowseforcompiler -msgid "Browse for Compiler (%s)" -msgstr "Обзор (поиск компилятора) (%s)" - -#: lazarusidestrconsts:dlgunitdepbrowse -msgid "Browse..." -msgstr "Обзор..." - -#: lazarusidestrconsts:lismenubuild -msgid "Build" -msgstr "Сборка" - -#: lazarusidestrconsts:lisbuildcodetools -msgid "Build CodeTools" -msgstr "Собрать CodeTools" - -#: lazarusidestrconsts:lisbuildcomponent -msgid "Build Component" -msgstr "Собрать компонент" - -#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools -msgid "Build Components (SynEdit, CodeTools)" -msgstr "Собрать компоненты (SynEdit, CodeTools)" - -#: lazarusidestrconsts:lisbuildexamples -msgid "Build Examples" -msgstr "Собрать примеры" - -#: lazarusidestrconsts:lismenubuildfile -msgid "Build File" -msgstr "Собрать файл" - -#: lazarusidestrconsts:lisbuildide -msgid "Build IDE" -msgstr "Собрать IDE" - -#: lazarusidestrconsts:lisbuildideintf -msgid "Build IDE Interface" -msgstr "Собрать интерфейс IDE" - -#: lazarusidestrconsts:lisbuildjitform -msgid "Build JIT Form" -msgstr "Собрать JIT Form" - -#: lazarusidestrconsts:lislazbuildbuildjitform -msgid "Build JITForm" -msgstr "Собрать JITForm" - -#: lazarusidestrconsts:lisbuildlcl -msgid "Build LCL" -msgstr "Собрать LCL" - -#: lazarusidestrconsts:lismenubuildlazarus -msgid "Build Lazarus" -msgstr "Собрать Lazarus" - -#: lazarusidestrconsts:lisbuildnumber -msgid "Build Number" -msgstr "Номер сборки" - -#: lazarusidestrconsts:lisbuildpkgreg -msgid "Build Package Registration" -msgstr "Зарегистрировать пакет" - -#: lazarusidestrconsts:lisbuildstarter -msgid "Build Starter" -msgstr "Собрать Загрузчик" - -#: lazarusidestrconsts:lisbuildsynedit -msgid "Build SynEdit" -msgstr "Собрать SynEdit" - -#: lazarusidestrconsts:lismenubuildall -msgid "Build all" -msgstr "Собрать все" - -#: lazarusidestrconsts:srkmecbuildlazarus -msgid "Build lazarus" -msgstr "Собрать lazarus" - -#: lazarusidestrconsts:lisbuildnewproject -msgid "Build new project" -msgstr "Собрать новый проект" - -#: lazarusidestrconsts:dlgcmacro -msgid "C Style Macros (global)" -msgstr "Макросы стиля C (глобально)" - -#: lazarusidestrconsts:dlgcocops -msgid "C Style Operators (*=, +=, /= and -=)" -msgstr "Операторы стиля C (*=, +=, /= and -=)" - -#: lazarusidestrconsts:dlgcppinline -msgid "C++ Styled INLINE" -msgstr "INLINE стиля C++" - -#: lazarusidestrconsts:lismenuinsertcvskeyword -msgid "CVS keyword" -msgstr "Ключ CVS" - -#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit -msgid "Call %sRegister%s procedure of selected unit" -msgstr "Вызвать процедуру %sRegister%s выбранного модуля" - -#: lazarusidestrconsts:lismenuviewcallstack -msgid "Call Stack" -msgstr "Стек вызовов" - -#: lazarusidestrconsts:liscocallon -msgid "Call on:" -msgstr "Вызов:" - -#: lazarusidestrconsts:liscannotcopytoplevelcomponent -msgid "Can not copy top level component." -msgstr "Не могу скопировать компонент верхнего уровня." - -#: lazarusidestrconsts:liscannotcreatefile -msgid "Can not create file %s%s%s" -msgstr "Не могу создать файл %s%s%s" - -#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit -msgid "Can not register components without unit" -msgstr "Не могу зарегистрировать компоненты без модуля" - -#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents -msgid "Can only change the class of TComponents." -msgstr "Могу только поменять класс у TComponents" - -#: lazarusidestrconsts:dlgcancel -msgid "Cancel" -msgstr "Отмена" - -#: lazarusidestrconsts:liscancelloadingunit -msgid "Cancel loading unit" -msgstr "" - -#: lazarusidestrconsts:liscancelrenaming -msgid "Cancel renaming" -msgstr "" - -#: lazarusidestrconsts:lisaboutnocontributors -msgid "Cannot find contributors list." -msgstr "Не могу найти список контрибуторов" - -#: lazarusidestrconsts:liscannotfindlazarusstarter -msgid "Cannot find lazarus starter:%s%s" -msgstr "Не могу найти пускатель lazarus:%s%s" - -#: lazarusidestrconsts:srvk_capital -msgid "Capital" -msgstr "Заглавный" - -#: lazarusidestrconsts:dlgcaretskipsselection -msgid "Caret skips selection" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgcaseinsensitive -msgid "Case Insensitive" -msgstr "Нечувствительный к регистру" - -#: lazarusidestrconsts:dlgcasesensitive -msgid "Case Sensitive" -msgstr "С учетом регистра" - -#: lazarusidestrconsts:lisfindfilecasesensitive -msgid "Case sensitive" -msgstr "С учётом регистра" - -#: lazarusidestrconsts:rslanguagecatalan -msgid "Catalan" -msgstr "Каталанский" - -#: lazarusidestrconsts:dlgcentercursorline -msgid "Center Cursor Line" -msgstr "Курсор в центре" - -#: lazarusidestrconsts:liscenterinwindow -msgid "Center in window" -msgstr "Центр окна" - -#: lazarusidestrconsts:liscenters -msgid "Centers" -msgstr "Центры" - -#: lazarusidestrconsts:liscodetemplchange -msgid "Change" -msgstr "Изменить" - -#: lazarusidestrconsts:lischangeclass -msgid "Change Class" -msgstr "Изменить класс" - -#: lazarusidestrconsts:lismenuinsertchangelogentry -msgid "ChangeLog entry" -msgstr "Элемент ChangeLog" - -#: lazarusidestrconsts:lisdiskdiffchangedfiles -msgid "Changed files:" -msgstr "Изменённые файлы:" - -#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies -msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "Изменение имени пакета или версии нарушит зависимости. Изменить ли эти зависимости?%sВыберите Да для замены всех перечисленных зависимостей.%sПропуск - для разрыва зависимостей и продолжения." - -#: lazarusidestrconsts:srkmecchar -msgid "Char" -msgstr "Символ" - -#: lazarusidestrconsts:lischaractermap -msgid "Character Map" -msgstr "Таблица символов" - -#: lazarusidestrconsts:lismenuchecklfm -msgid "Check LFM file in editor" -msgstr "Проверить файл LFM в редакторе" - -#: lazarusidestrconsts:lischeckchangesondiskwithloading -msgid "Check changes on disk with loading" -msgstr "" - -#: lazarusidestrconsts:dlgcheckconsistency -msgid "Check consistency" -msgstr "Целостность?" - -#: lazarusidestrconsts:dlgcochecks -msgid "Checks:" -msgstr "Проверка:" - -#: lazarusidestrconsts:lischoosedelphiproject -msgid "Choose Delphi project (*.dpr)" -msgstr "Выберите проект Delphi (*.dpr)" - -#: lazarusidestrconsts:lischoosedelphiunit -msgid "Choose Delphi unit (*.pas)" -msgstr "Выберите модуль Delphi (*.pas)" - -#: lazarusidestrconsts:lisctdefchoosedirectory -msgid "Choose Directory" -msgstr "Выберите каталог" - -#: lazarusidestrconsts:lischoosefpcsourcedir -msgid "Choose FPC source directory" -msgstr "Выберите каталог исходников FPC" - -#: lazarusidestrconsts:lischooselazarussourcedirectory -msgid "Choose Lazarus Directory" -msgstr "Выберите каталог Lazarus" - -#: lazarusidestrconsts:lisedoptschoosescheme -msgid "Choose Scheme" -msgstr "Выбрать схему" - -#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty -msgid "Choose a base class for the favourite property %s%s%s." -msgstr "Выберите базовый класс для избранного свойства %s%s%s." - -#: lazarusidestrconsts:lischooseadifferentname -msgid "Choose a different name" -msgstr "Выберите другое имя" - -#: lazarusidestrconsts:dlgchscodetempl -msgid "Choose code template file (*.dci)" -msgstr "Выберите файл шаблонов кода (*.dci)" - -#: lazarusidestrconsts:lischoosecompilerpath -msgid "Choose compiler filename (%s)" -msgstr "Выберите имя компилятора (%s)" - -#: lazarusidestrconsts:lischoosedebuggerpath -msgid "Choose debugger filename" -msgstr "Выберите имя отладчика" - -#: lazarusidestrconsts:lischoosedirectory -msgid "Choose directory" -msgstr "Выбор каталога" - -#: lazarusidestrconsts:lischoosemakepath -msgid "Choose make path" -msgstr "Выберите путь make" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile -msgid "Choose one of these items to create a new File" -msgstr "Выберите один из этих элементов для создания нового файла" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage -msgid "Choose one of these items to create a new Package" -msgstr "Выберите один из этих элементов для создания нового пакета" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject -msgid "Choose one of these items to create a new Project" -msgstr "Выберите один из этих элементов для создания нового проекта" - -#: lazarusidestrconsts:lischooseprogramsourcepppaslpr -msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "Выберите исходник программы (*.pp,*.pas,*.lpr)" - -#: lazarusidestrconsts:lischoosestructuretoencloseselection -msgid "Choose structure to enclose selection" -msgstr "Выберите структуру для заключения в неё выделения" - -#: lazarusidestrconsts:lischoosetestbuilddir -msgid "Choose the directory for tests" -msgstr "Выберите каталог для проб" - -#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies -msgid "Circle in package dependencies" -msgstr "Циклическая зависимость пакетов" - -#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste -msgid "Class %s%s%s is not a registered component class.%sUnable to paste." -msgstr "Класс %s%s%s - не зарегистрированный класс компонента.%sНе могу вставить." - -#: lazarusidestrconsts:lisoifclassnotfound -msgid "Class %s%s%s not found." -msgstr "Класс %s%s%s не найден." - -#: lazarusidestrconsts:lisa2pclassnamealreadyexists -msgid "Class Name already exists" -msgstr "Имя класса уже существует" - -#: lazarusidestrconsts:lisclassnotfound -msgid "Class not found" -msgstr "Класс не найден" - -#: lazarusidestrconsts:dlgcdtclassorder -msgid "Class order" -msgstr "В порядке классов" - -#: lazarusidestrconsts:dlgclassinsertpolicy -msgid "Class part insert policy" -msgstr "Политика вставки частей класса" - -#: lazarusidestrconsts:liscldircleandirectory -msgid "Clean Directory" -msgstr "Очистить каталог" - -#: lazarusidestrconsts:liscleanlazarussource -msgid "Clean Lazarus Source" -msgstr "Очистить исходники Lazarus" - -#: lazarusidestrconsts:lislazbuildcleanall -msgid "Clean all" -msgstr "Очистить всё" - -#: lazarusidestrconsts:lismenucleandirectory -msgid "Clean directory" -msgstr "Очистить каталог" - -#: lazarusidestrconsts:liscldircleansubdirectories -msgid "Clean sub directories" -msgstr "Очистить подкаталоги" - -#: lazarusidestrconsts:liscleanupunitpath -msgid "Clean up unit path?" -msgstr "" - -#: lazarusidestrconsts:lislazbuildcleanbuild -msgid "Clean+Build" -msgstr "Очистить+Собрать" - -#: lazarusidestrconsts:srvk_clear -msgid "Clear" -msgstr "Очистить" - -#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff -msgid "Click on one of the above items to see the diff" -msgstr "Выберите один из элементов выше, чтобы увидеть разницу" - -#: lazarusidestrconsts:lismenuclose -msgid "Close" -msgstr "Закрыть" - -#: lazarusidestrconsts:srkmeccloseall -msgid "Close all" -msgstr "Закрыть все" - -#: lazarusidestrconsts:lismenucloseall -msgid "Close all editor files" -msgstr "Закрыть все файлы редактора" - -#: lazarusidestrconsts:dlgcodegeneration -msgid "Code" -msgstr "Код" - -#: lazarusidestrconsts:dlgcodecreation -msgid "Code Creation" -msgstr "Создание кода" - -#: lazarusidestrconsts:lismenuviewcodeexplorer -msgid "Code Explorer" -msgstr "Обозреватель кода" - -#: lazarusidestrconsts:lismenueditcodetemplates -msgid "Code Templates" -msgstr "" - -#: lazarusidestrconsts:dlgcodetoolstab -msgid "Code Tools" -msgstr "CodeTools" - -#: lazarusidestrconsts:dlgusecodefolding -msgid "Code folding (experimental)" -msgstr "" - -#: lazarusidestrconsts:dlgedcodeparams -msgid "Code parameters" -msgstr "Параметры кода" - -#: lazarusidestrconsts:srkmecautocompletion -msgid "Code template completion" -msgstr "Завершение шаблонов кода" - -#: lazarusidestrconsts:dlgedcodetempl -msgid "Code templates" -msgstr "Шаблоны кода" - -#: lazarusidestrconsts:lisceocodeexplorer -msgid "CodeExplorer Options" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor -msgid "CodeTools Defines Editor" -msgstr "Редактор определений Codetools" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview -msgid "CodeTools Defines Preview" -msgstr "Просмотр настроек CodeTools" - -#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues -msgid "CodeTools Directory Values" -msgstr "Параметры каталогов CodeTools" - -#: lazarusidestrconsts:dlgcodetoolsopts -msgid "CodeTools Options" -msgstr "Настройки CodeTools" - -#: lazarusidestrconsts:srkmcatcodetools -msgid "CodeTools commands" -msgstr "Команды CodeTools" - -#: lazarusidestrconsts:lismenucodetoolsdefineseditor -msgid "CodeTools defines editor" -msgstr "Настройки редактора CodeTools" - -#: lazarusidestrconsts:lismenucodetoolsoptions -msgid "CodeTools options" -msgstr "Настройки CodeTools" - -#: lazarusidestrconsts:srkmeccodetoolsdefinesed -msgid "Codetools defines editor" -msgstr "Редактор определений Codetools" - -#: lazarusidestrconsts:srkmeccodetoolsoptions -msgid "Codetools options" -msgstr "Настройки Codetools" - -#: lazarusidestrconsts:lismenucollectpofil -msgid "Collect .po files" -msgstr "Собрать файлы .po" - -#: lazarusidestrconsts:liscodetoolsoptscolon -msgid "Colon" -msgstr "Колонка" - -#: lazarusidestrconsts:dlgedcolor -msgid "Color" -msgstr "Цвет" - -#: lazarusidestrconsts:dlgclrscheme -msgid "Color Scheme:" -msgstr "Цветовая схема:" - -#: lazarusidestrconsts:dlgenvcolors -msgid "Colors" -msgstr "Цвета" - -#: lazarusidestrconsts:srkmeccolumnselect -msgid "Column selection mode" -msgstr "Режим выбора колонки" - -#: lazarusidestrconsts:liscodetoolsoptscomma -msgid "Comma" -msgstr "Запятая" - -#: lazarusidestrconsts:srkmcommand -msgid "Command " -msgstr "Команда" - -#: lazarusidestrconsts:liscommandafter -msgid "Command after" -msgstr "" - -#: lazarusidestrconsts:liscommandafterinvalid -msgid "Command after invalid" -msgstr "Команда \"после\" некорректна" - -#: lazarusidestrconsts:liscommandafterpublishingmodule -msgid "Command after publishing module" -msgstr "Команда после установки модуля" - -#: lazarusidestrconsts:srkmcatcmdcmd -msgid "Command commands" -msgstr "Команда команды" - -#: lazarusidestrconsts:dlgcommandlineparams -msgid "Command line parameters (without application name)" -msgstr "Параметры командной строки (без имени приложения)" - -#: lazarusidestrconsts:liscommandlineparamsofprogram -msgid "Command line parameters of program" -msgstr "Параметры командной строки программы" - -#: lazarusidestrconsts:liscocommand -msgid "Command:" -msgstr "Команда:" - -#: lazarusidestrconsts:lismenucommentselection -msgid "Comment selection" -msgstr "Закомментировать" - -#: lazarusidestrconsts:liscodetemplcomment -msgid "Comment:" -msgstr "Комментарий:" - -#: lazarusidestrconsts:dlgcocompilation -msgid "Compilation" -msgstr "Компиляция" - -#: lazarusidestrconsts:liscocalloncompile -msgid "Compile" -msgstr "Компилировать" - -#: lazarusidestrconsts:liscompileidewithoutlinking -msgid "Compile IDE (without linking)" -msgstr "Компиляция IDE (без сборки)" - -#: lazarusidestrconsts:lispckeditcompileeverything -msgid "Compile everything?" -msgstr "Собрать всё?" - -#: lazarusidestrconsts:lispckeditcompilepackage -msgid "Compile package" -msgstr "Собрать пакет" - -#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition -msgid "CompiledSrcPath addition" -msgstr "Добавление CompiledSrcPath" - -#: lazarusidestrconsts:liscompiler -msgid "Compiler" -msgstr "Компилятор" - -#: lazarusidestrconsts:dlgcompileroptions -msgid "Compiler Options" -msgstr "Опции компилятора" - -#: lazarusidestrconsts:lispckeditcompileroptionsforpackage -msgid "Compiler Options for Package %s" -msgstr "Параметры компилятора для пакета %s" - -#: lazarusidestrconsts:liscompileroptionsforproject -msgid "Compiler Options for Project: %s" -msgstr "Параметры компилятора для проекта: %s" - -#: lazarusidestrconsts:lismenucompileroptions -msgid "Compiler Options..." -msgstr "Параметры компилятора..." - -#: lazarusidestrconsts:liscompilererror -msgid "Compiler error" -msgstr "Ошибка компилятора" - -#: lazarusidestrconsts:liscompilerfilename -msgid "Compiler filename" -msgstr "Имя файла компилятора" - -#: lazarusidestrconsts:dlgfpcpath -msgid "Compiler path (%s)" -msgstr "Путь компилятора (%s)" - -#: lazarusidestrconsts:lismenucompletecode -msgid "Complete Code" -msgstr "Завершить код" - -#: lazarusidestrconsts:srkmeccompletecode -msgid "Complete code" -msgstr "Завершить код" - -#: lazarusidestrconsts:dlgcompleteproperties -msgid "Complete properties" -msgstr "Завершать свойства" - -#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined -msgid "Component Class %s%s%s already defined" -msgstr "Класс компонента %s%s%s уже определён" - -#: lazarusidestrconsts:liscomponentnameiskeyword -msgid "Component name %s%s%s is keyword" -msgstr "Имя компонента %s%s%s зарезервировано" - -#: lazarusidestrconsts:liscomponentnameisnotavalididentifier -msgid "Component name %s%s%s is not a valid identifier" -msgstr "Имя компонента %s%s%s - некорректный идентификатор" - -#: lazarusidestrconsts:srkmcatcomponentsmenu -msgid "Components menu commands" -msgstr "Команды компонентов меню" - -#: lazarusidestrconsts:dlgconfigfiles -msgid "Config Files:" -msgstr "Файлы настроек:" - -#: lazarusidestrconsts:lisconfigurebuildlazarus -msgid "Configure %sBuild Lazarus%s" -msgstr "Настроить сборку Lazarus'а" - -#: lazarusidestrconsts:lismenuconfigbuildfile -msgid "Configure Build+Run File" -msgstr "Настроить сборку+Запустить Файл" - -#: lazarusidestrconsts:lismenuconfigurehelp -msgid "Configure Help" -msgstr "Настроить Справку" - -#: lazarusidestrconsts:lismenuconfigurebuildlazarus -msgid "Configure \"Build Lazarus\"" -msgstr "Настроить сборку Lazarus'а" - -#: lazarusidestrconsts:lismenuconfigcustomcomps -msgid "Configure custom components" -msgstr "Настроить компоненты пользователя" - -#: lazarusidestrconsts:lismenusettings -msgid "Configure custom tools ..." -msgstr "Настроить инструменты пользователя" - -#: lazarusidestrconsts:lismenueditinstallpkgs -msgid "Configure installed packages" -msgstr "Настроить установленные пакеты" - -#: lazarusidestrconsts:lislazbuildconfirmbuild -msgid "Confirm Before ReBuild Lazarus" -msgstr "" - -#: lazarusidestrconsts:lisconfirmchanges -msgid "Confirm changes" -msgstr "Подтвердить изменения" - -#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency -msgid "Confirm deleting dependency" -msgstr "Подтвердите удаление зависимости" - -#: lazarusidestrconsts:lisprojinspconfirmremovingfile -msgid "Confirm removing file" -msgstr "Подтвердите удаление файла" - -#: lazarusidestrconsts:srkmconflic -msgid "Conflict " -msgstr "Конфликт " - -#: lazarusidestrconsts:dlginitdoneonly -msgid "Constructor name must be 'init' (destructor must be 'done')" -msgstr "Конструктор должен быть 'init' (деструктор - 'done')" - -#: lazarusidestrconsts:lismenutemplatecontents -msgid "Contents" -msgstr "Содержание" - -#: lazarusidestrconsts:lismenucontexthelp -msgid "Context sensitive Help" -msgstr "Справка, зависимая от контекста" - -#: lazarusidestrconsts:liscontinue -msgid "Continue" -msgstr "" - -#: lazarusidestrconsts:liscontinuewithoutloadingform -msgid "Continue without loading form" -msgstr "" - -#: lazarusidestrconsts:liscontributors -msgid "Contributors" -msgstr "Благодарности" - -#: lazarusidestrconsts:srvk_control -msgid "Control" -msgstr "Элемент управления" - -#: lazarusidestrconsts:liscontrolneedsparent -msgid "Control needs parent" -msgstr "Элемент управления требует \"родителя\"" - -#: lazarusidestrconsts:lismakeresstrconversionoptions -msgid "Conversion Options" -msgstr "Настройки преобразований" - -#: lazarusidestrconsts:lisconversionerror -msgid "Conversion error" -msgstr "Ошибка преобразования" - -#: lazarusidestrconsts:srvk_convert -msgid "Convert" -msgstr "Преобразовать" - -#: lazarusidestrconsts:lismenuconvertdfmtolfm -msgid "Convert DFM file to LFM" -msgstr "Преобразовать DFM в LFM" - -#: lazarusidestrconsts:lismenuconvertdelphiproject -msgid "Convert Delphi Project to Lazarus Project" -msgstr "Преобразовать проект Delphi в проект Lazarus" - -#: lazarusidestrconsts:lismenuconvertdelphiunit -msgid "Convert Delphi unit to Lazarus unit" -msgstr "Преобразовать модуль Delphi в Lazarus" - -#: lazarusidestrconsts:liscodetoolsdefsconvertnode -msgid "Convert node" -msgstr "Преобразовать элемент" - -#: lazarusidestrconsts:srkmecselectiontabs2spaces -msgid "Convert tabs to spaces in selection" -msgstr "Преобразовать ТАБ в пробелы в выделенном" - -#: lazarusidestrconsts:lismenucopy -msgid "Copy" -msgstr "Копировать" - -#: lazarusidestrconsts:liscopyerror -msgid "Copy Error" -msgstr "Ошибка копирования" - -#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard -msgid "Copy all and hidden messages to clipboard" -msgstr "" - -#: lazarusidestrconsts:liscopyallmessagestoclipboard -msgid "Copy all messages to clipboard" -msgstr "Скопировать все сообщения в буфер" - -#: lazarusidestrconsts:liscopyerror2 -msgid "Copy error" -msgstr "Ошибка копирования" - -#: lazarusidestrconsts:lisdsgcopycomponents -msgid "Copy selected components to clipboard" -msgstr "Скопировать выбранные компоненты в буфер обмена" - -#: lazarusidestrconsts:liscopyselectedmessagestoclipboard -msgid "Copy selected messages to clipboard" -msgstr "Скопировать выбранные сообщения в буфер обмена" - -#: lazarusidestrconsts:srkmeccopy -msgid "Copy selection to clipboard" -msgstr "Копировать выделение в буфер обмена" - -#: lazarusidestrconsts:dlgcopywordatcursoroncopynone -msgid "Copy word on copy none" -msgstr "Слово при пустом копировании" - -#: lazarusidestrconsts:liscopyingawholeformisnotimplemented -msgid "Copying a whole form is not implemented." -msgstr "Копирование всей формы не реализовано." - -#: lazarusidestrconsts:lisgplnotice -msgid "Copyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "" - -#: lazarusidestrconsts:lislgplnotice -msgid "Copyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "Авторское право (С) <год> <имя автора>%sЭта библиотека - бесплатное ПО; Вы можете распространять её и/или изменять по условиям GNU Library General Public License как опубликовано Free Software Foundation; или версии 2 Лицензии, или (на Ваш выбор) любой поздней версии. %sЭта программа распространяется с надеждой быть полезной, но БЕЗО ВСЯКОЙ ГАРАНТИИ; даже без подразумеваемой ТОРГОВОЙ гарантии или СООТВЕТСТВИЯ ОПРЕДЕЛЁННОЙ ЦЕЛИ. См. GNU Library General Public License для дальнейшей информации. %sВы должны были получить копию GNU Library General Public License с этой библиотекой; если нет, пишите в Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, США." - -#: lazarusidestrconsts:dlgsmbcounter -msgid "Counter (.pp;1)" -msgstr "Счетчик (.pp;1)" - -#: lazarusidestrconsts:lisnpcreate -msgid "Create" -msgstr "Создать" - -#: lazarusidestrconsts:lismenucreatepofile -msgid "Create .po files" -msgstr "Создать файлы .po" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory -msgid "Create Defines for %s Directory" -msgstr "Создать настройки для %s Каталога" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject -msgid "Create Defines for %s Project" -msgstr "Создать настройки для %s Проекта" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler -msgid "Create Defines for Free Pascal Compiler" -msgstr "Создать настройки для компилятора FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources -msgid "Create Defines for Free Pascal SVN Sources" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir -msgid "Create Defines for Lazarus Directory" -msgstr "Создать настройки для каталога Lazarus" - -#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory -msgid "Create FPC Macros and paths for a fpc project directory" -msgstr "Создать макросы FPC и пути к каталогу проекта FPC" - -#: lazarusidestrconsts:lispckeditcreatemakefile -msgid "Create Makefile" -msgstr "" - -#: lazarusidestrconsts:lismenueditorcreatesubmenu -msgid "Create Submenu" -msgstr "Создать подменю" - -#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained -msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "Создать новое приложение cgi.%sФайл программы поддерживается Lazarus" - -#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype -msgid "Create a new editor file.%sChoose a type." -msgstr "Создать новый файл редактора.%s Выберите тип." - -#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile -msgid "Create a new empty text file." -msgstr "Создать новый пустой текстовый файл." - -#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication -msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "Создать новое графическое приложение.%sЭта программа поддерживается Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "Создать модуль паскаля." - -#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram -msgid "Create a new program." -msgstr "Создать программу." - -#: lazarusidestrconsts:lisnewdlgcreateanewprogram -msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "Создать программу.%sФайл программы поддерживается Lazarus." - -#: lazarusidestrconsts:lisnpcreateanewproject -msgid "Create a new project" -msgstr "Создать новый проект" - -#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype -msgid "Create a new project.%sChoose a type." -msgstr "Создать проект.%sВыберите тип." - -#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun -msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "Создать стандартный пакет%sПакет - это набор модулей и компонентов." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform -msgid "Create a new unit with a LCL form." -msgstr "Создать модуль с формой LCL." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule -msgid "Create a new unit with a datamodule." -msgstr "Создать модуль с модулем данных." - -#: lazarusidestrconsts:liscreateaprojectfirst -msgid "Create a project first!" -msgstr "Создайте сперва проект!" - -#: lazarusidestrconsts:lisa2pcreatenewfile -msgid "Create new file" -msgstr "Создать новый файл" - -#: lazarusidestrconsts:dlgruberbandcreationcolor -msgid "Creation" -msgstr "Создание" - -#: lazarusidestrconsts:lisedtexttoolctrl -msgid "Ctrl" -msgstr "Ctrl" - -#: lazarusidestrconsts:lisedtdefcurrentproject -msgid "Current Project" -msgstr "Текущий проект" - -#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory -msgid "Current Project Directory" -msgstr "Каталог текущего проекта" - -#: lazarusidestrconsts:lismenuinsertdatetime -msgid "Current date and time" -msgstr "Текущие дата и время" - -#: lazarusidestrconsts:lismenuinsertusername -msgid "Current username" -msgstr "Текущее имя пользователя" - -#: lazarusidestrconsts:dlgcursorbeyondeol -msgid "Cursor beyond EOL" -msgstr "Курсор вне конца строки" - -#: lazarusidestrconsts:liscursorcolumnincurrenteditor -msgid "Cursor column in current editor" -msgstr "Колонка курсора в этом редакторе" - -#: lazarusidestrconsts:srkmcatcursormoving -msgid "Cursor moving commands" -msgstr "Команды перемещения курсора" - -#: lazarusidestrconsts:liscursorrowincurrenteditor -msgid "Cursor row in current editor" -msgstr "Ряд курсора в этом редакторе" - -#: lazarusidestrconsts:lispckoptscustom -msgid "Custom" -msgstr "Пользовательский" - -#: lazarusidestrconsts:lismakeresstrcustomidentifier -msgid "Custom Identifier" -msgstr "Пользовательский ID" - -#: lazarusidestrconsts:liscustomprogram -msgid "Custom Program" -msgstr "Программа пользователя" - -#: lazarusidestrconsts:liscustomprogramafreepascalprogram -msgid "Custom Program%sA freepascal program." -msgstr "Программа пользователя%sПрограмма на языке FreePascal" - -#: lazarusidestrconsts:liskeycatcustom -msgid "Custom commands" -msgstr "Команды пользователя" - -#: lazarusidestrconsts:liscustomoptions2 -msgid "Custom options" -msgstr "Параметры пользователя" - -#: lazarusidestrconsts:rsiwpcustomposition -msgid "Custom position" -msgstr "Пользовательская позиция" - -#: lazarusidestrconsts:srkmeccustomtool -msgid "Custom tool %d" -msgstr "Инструмент пользователя %d" - -#: lazarusidestrconsts:lismenucut -msgid "Cut" -msgstr "Вырезать" - -#: lazarusidestrconsts:lisdsgcutcomponents -msgid "Cut selected components to clipboard" -msgstr "Вырезать выбранные компоненты в буфер" - -#: lazarusidestrconsts:srkmeccut -msgid "Cut selection to clipboard" -msgstr "Вырезать выделение в буфер" - -#: lazarusidestrconsts:lishlpoptsdatabases -msgid "Databases" -msgstr "Базы данных" - -#: lazarusidestrconsts:lisdate -msgid "Date" -msgstr "Дата" - -#: lazarusidestrconsts:uemdebugword -msgid "Debug" -msgstr "Отладка" - -#: lazarusidestrconsts:lismenuviewdebugoutput -msgid "Debug output" -msgstr "Вывод отладчика" - -#: lazarusidestrconsts:lismenudebugwindows -msgid "Debug windows" -msgstr "Окно отладки..." - -#: lazarusidestrconsts:lismendebuggeroptions -msgid "Debugger Options" -msgstr "Параметры отладчика" - -#: lazarusidestrconsts:lisdebuggererror -msgid "Debugger error" -msgstr "Ошибка отладчика" - -#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate -msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "Ошибка отладчика%sОп, отладчик находится в нерабочем состоянии%sСохраните работу!%sНажмите Стоп и надейтесь на лучшее!" - -#: lazarusidestrconsts:lisdebuggerinvalid -msgid "Debugger invalid" -msgstr "Неправильный отладчик" - -#: lazarusidestrconsts:dlgcodebugpath -msgid "Debugger path addition (none):" -msgstr "Дополнения к путям отладчика (нет):" - -#: lazarusidestrconsts:dlgdebugtype -msgid "Debugger type and path" -msgstr "Тип отладчика и путь" - -#: lazarusidestrconsts:dlgcodebugging -msgid "Debugging:" -msgstr "Отладка:" - -#: lazarusidestrconsts:rsiwpdefault -msgid "Default" -msgstr "По умолчанию" - -#: lazarusidestrconsts:dlgdefaulteditorfont -msgid "Default editor font" -msgstr "Шрифт редактора по умолчанию" - -#: lazarusidestrconsts:dlgpasext -msgid "Default pascal extension" -msgstr "Стандартное расширение паскаля" - -#: lazarusidestrconsts:dlgdefvaluecolor -msgid "Default value" -msgstr "Значение по умолчанию" - -#: lazarusidestrconsts:liscodetoolsdefsdefine -msgid "Define" -msgstr "Определение" - -#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse -msgid "Define Recurse" -msgstr "Определить рекурсивно" - -#: lazarusidestrconsts:dlgeddelay -msgid "Delay" -msgstr "Задержка" - -#: lazarusidestrconsts:dlgeddelete -msgid "Delete" -msgstr "Удалить" - -#: lazarusidestrconsts:lismenueditordeletefromtemplate -msgid "Delete From Template..." -msgstr "Удалить шаблон формы" - -#: lazarusidestrconsts:lismenueditordeleteitem -msgid "Delete Item" -msgstr "Удалить элемент" - -#: lazarusidestrconsts:srkmecdeletelastchar -msgid "Delete Last Char" -msgstr "Удалить последний символ" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile -msgid "Delete Old Package File?" -msgstr "Удалить старый файл пакета?" - -#: lazarusidestrconsts:lisdeleteallthesefiles -msgid "Delete all these files?" -msgstr "" - -#: lazarusidestrconsts:lisdeleteambiguousfile -msgid "Delete ambiguous file?" -msgstr "Удалить файл с подобным именем?" - -#: lazarusidestrconsts:srkmecdeletechar -msgid "Delete char at cursor" -msgstr "Удалить символ у курсора" - -#: lazarusidestrconsts:srkmecdeleteline -msgid "Delete current line" -msgstr "Удалить текущую строку" - -#: lazarusidestrconsts:lisprojinspdeletedependencyfor -msgid "Delete dependency for %s?" -msgstr "Удалить зависимость для %s?" - -#: lazarusidestrconsts:lispkgmangdeletefailed -msgid "Delete failed" -msgstr "Удаление не удалось" - -#: lazarusidestrconsts:lisdeletefilefailed -msgid "Delete file failed" -msgstr "Удаление файла не удалось" - -#: lazarusidestrconsts:lislazdocdeletelinkbutton -msgid "Delete link" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsdeletenode -msgid "Delete node" -msgstr "Удалить элемент" - -#: lazarusidestrconsts:lisdeleteoldfile -msgid "Delete old file %s%s%s?" -msgstr "Удалить старый файл %s%s%s?" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 -msgid "Delete old package file %s%s%s?" -msgstr "Удалить старый файл пакета %s%s%s?" - -#: lazarusidestrconsts:fdmdeleteselection -msgid "Delete selection" -msgstr "Удалить выбранное" - -#: lazarusidestrconsts:dlgdeltemplate -msgid "Delete template " -msgstr "Удалить шаблон " - -#: lazarusidestrconsts:srkmecdeletebol -msgid "Delete to beginning of line" -msgstr "Удалить до начала строки" - -#: lazarusidestrconsts:srkmecdeleteeol -msgid "Delete to end of line" -msgstr "Удалить до конца строки" - -#: lazarusidestrconsts:srkmecdeleteword -msgid "Delete to end of word" -msgstr "Удалить до конца слова" - -#: lazarusidestrconsts:srkmecdeletelastword -msgid "Delete to start of word" -msgstr "Удалить до начала слова" - -#: lazarusidestrconsts:srkmecclearall -msgid "Delete whole text" -msgstr "Удалить весь текст" - -#: lazarusidestrconsts:lisdeletingoffilefailed -msgid "Deleting of file %s%s%s failed." -msgstr "Удаление файла %s%s%s не удалось." - -#: lazarusidestrconsts:dlgdelphi2ext -msgid "Delphi 2 Extensions" -msgstr "Расширения Delphi 2" - -#: lazarusidestrconsts:dlgdeplhicomp -msgid "Delphi Compatible" -msgstr "Совместимость с Delphi" - -#: lazarusidestrconsts:lisdelphiproject -msgid "Delphi project" -msgstr "Проект Delphi" - -#: lazarusidestrconsts:lisa2pdependency -msgid "Dependency" -msgstr "Зависимость" - -#: lazarusidestrconsts:lispckeditdependencyproperties -msgid "Dependency Properties" -msgstr "Свойства зависимости" - -#: lazarusidestrconsts:lisprojadddependencyalreadyexists -msgid "Dependency already exists" -msgstr "Зависимость уже есть" - -#: lazarusidestrconsts:lispkgmangdependencywithoutowner -msgid "Dependency without Owner: %s" -msgstr "Зависимость без владельца:%s" - -#: lazarusidestrconsts:lissortseldescending -msgid "Descending" -msgstr "По убыванию" - -#: lazarusidestrconsts:listodoldescription -msgid "Description" -msgstr "Описание" - -#: lazarusidestrconsts:lispckoptsdescriptionabstract -msgid "Description/Abstract" -msgstr "Описание/кратко" - -#: lazarusidestrconsts:liscodetoolsdefsdescription -msgid "Description:" -msgstr "Описание:" - -#: lazarusidestrconsts:lisoipdescription -msgid "Description: " -msgstr "Описание: " - -#: lazarusidestrconsts:liskeycatdesigner -msgid "Designer commands" -msgstr "Команды дизайнера" - -#: lazarusidestrconsts:lispckoptsdesigntimeandruntime -msgid "Designtime and Runtime" -msgstr "При разработке и запуске" - -#: lazarusidestrconsts:lispckoptsdesigntimeonly -msgid "Designtime only" -msgstr "Только для разработки" - -#: lazarusidestrconsts:dlgdesktop -msgid "Desktop" -msgstr "Рабочий стол" - -#: lazarusidestrconsts:dlgdesktopfiles -msgid "Desktop files" -msgstr "Файлы рабочего стола" - -#: lazarusidestrconsts:lisaf2pdestinationpackage -msgid "Destination Package" -msgstr "Пакет назначения" - -#: lazarusidestrconsts:lisdestinationdirectory -msgid "Destination directory" -msgstr "" - -#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete -msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." -msgstr "Каталог %s%s%s некорркетен.%sВыберите путь к компилятору." - -#: lazarusidestrconsts:lismenudiff -msgid "Diff" -msgstr "Разница Diff" - -#: lazarusidestrconsts:dlgdirection -msgid "Direction" -msgstr "Направление" - -#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory -msgid "Directory" -msgstr "Каталог" - -#: lazarusidestrconsts:dlgdirectorydoesnotexist -msgid "Directory does not exist" -msgstr "Каталог не существует" - -#: lazarusidestrconsts:dlgtestprjdir -msgid "Directory for building test projects" -msgstr "Каталог для сборки пробных проектов" - -#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound -msgid "Directory not found" -msgstr "Каталог не найден" - -#: lazarusidestrconsts:lisfindfiledirectoryoptions -msgid "Directory options" -msgstr "Настройки каталогов" - -#: lazarusidestrconsts:lisdiscardchanges -msgid "Discard changes" -msgstr "" - -#: lazarusidestrconsts:dlgeddisplay -msgid "Display" -msgstr "Дисплей" - -#: lazarusidestrconsts:dlgrunodisplay -msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" -msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)" - -#: lazarusidestrconsts:dlglnumsbct -msgid "Display Line Numbers in Run-time Error Backtraces" -msgstr "Выдать номера строк в ошибках времени исполнения" - -#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda -msgid "Distinguish big and small letters e.g. A and a" -msgstr "Различать регистр букв, например, А и а" - -#: lazarusidestrconsts:lisdonotclosetheide -msgid "Do not close the IDE" -msgstr "" - -#: lazarusidestrconsts:lispodonotsaveanysessioninfo -msgid "Do not save any session info" -msgstr "" - -#: lazarusidestrconsts:lisdonotshowsplashscreen -msgid "Do not show splash screen" -msgstr "" - -#: lazarusidestrconsts:dlgnotsplitlinefront -msgid "Do not split line In front of:" -msgstr "Не разрывать строку перед:" - -#: lazarusidestrconsts:dlgnotsplitlineafter -msgid "Do not split line after:" -msgstr "Не разрывать строку после:" - -#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand -msgid "Do you really want to forget all changes to package %s and reload it from file?" -msgstr "Вы действительно хотите сбросить все изменения в пакете %s и загрузить его из файла?" - -#: lazarusidestrconsts:lisconfirmlazarusrebuild -msgid "Do you want to rebuild Lazarus?" -msgstr "" - -#: lazarusidestrconsts:rsiwpdocked -msgid "Docked" -msgstr "Прикреплён" - -#: lazarusidestrconsts:lisdocumentationeditor -msgid "Documentation Editor" -msgstr "Редактор документации" - -#: lazarusidestrconsts:lislazdocnodocumentation -msgid "Documentation entry does not exist" -msgstr "" - -#: lazarusidestrconsts:lissortseldomain -msgid "Domain" -msgstr "Домен" - -#: lazarusidestrconsts:dlgdoubleclickline -msgid "Double click line" -msgstr "Выделить строку дв. щелчком" - -#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick -msgid "Double click on messages jumps (otherwise: single click)" -msgstr "Двойной щелчёк на переходах по сообщениям (иначе - одинарный)" - -#: lazarusidestrconsts:dlgdownword -msgid "Down" -msgstr "Вниз" - -#: lazarusidestrconsts:dlgdragdroped -msgid "Drag Drop editing" -msgstr "Редактор Drag Drop" - -#: lazarusidestrconsts:dlgdropfiles -msgid "Drop files" -msgstr "Бросить файлы" - -#: lazarusidestrconsts:rslanguagedutch -msgid "Dutch" -msgstr "" - -#: lazarusidestrconsts:lismenuenvironent -msgid "E&nvironment" -msgstr "&Окружение" - -#: lazarusidestrconsts:liscodetoolsdefsedit -msgid "Edit" -msgstr "Правка" - -#: lazarusidestrconsts:lispckediteditgeneraloptions -msgid "Edit General Options" -msgstr "Изменить общие настройки" - -#: lazarusidestrconsts:srkmeditkeys -msgid "Edit Keys" -msgstr "Изменить клавиши" - -#: lazarusidestrconsts:lispckediteditoptionstocompilepackage -msgid "Edit Options to compile package" -msgstr "Изменить настройки для компиляции пакета" - -#: lazarusidestrconsts:lisedtexttooledittool -msgid "Edit Tool" -msgstr "Инструмент правки" - -#: lazarusidestrconsts:liscodetempleditcodetemplate -msgid "Edit code template" -msgstr "Править шаблоны кода" - -#: lazarusidestrconsts:srkmeditforcmd -msgid "Edit keys for command" -msgstr "Править клавиши для команды" - -#: lazarusidestrconsts:dlgededit -msgid "Edit..." -msgstr "Правка" - -#: lazarusidestrconsts:dlgedfiles -msgid "Editor files" -msgstr "Файлы редактора" - -#: lazarusidestrconsts:dlgeditorfont -msgid "Editor font" -msgstr "Шрифт редактора" - -#: lazarusidestrconsts:dlgeditorfontheight -msgid "Editor font height" -msgstr "Высота шрифта" - -#: lazarusidestrconsts:lismenueditoroptions -msgid "Editor options" -msgstr "Настройки редактора" - -#: lazarusidestrconsts:uemeditorproperties -msgid "Editor properties" -msgstr "Настройки редактора" - -#: lazarusidestrconsts:dlgedelement -msgid "Element" -msgstr "Элемент" - -#: lazarusidestrconsts:liscodetoolsdefselse -msgid "Else" -msgstr "Else" - -#: lazarusidestrconsts:liscodetoolsdefselseif -msgid "ElseIf" -msgstr "ElseIf" - -#: lazarusidestrconsts:lisenablemakros -msgid "Enable Makros" -msgstr "" - -#: lazarusidestrconsts:lisenclose -msgid "Enclose" -msgstr "Заключить" - -#: lazarusidestrconsts:uemencloseselection -msgid "Enclose Selection" -msgstr "Заключить выделенное" - -#: lazarusidestrconsts:lismenuencloseselection -msgid "Enclose selection" -msgstr "Заключить выделение в..." - -#: lazarusidestrconsts:srvk_end -msgid "End" -msgstr "End" - -#: lazarusidestrconsts:rslanguageenglish -msgid "English" -msgstr "Английский" - -#: lazarusidestrconsts:lismacropromptenterdata -msgid "Enter data" -msgstr "Введите данные" - -#: lazarusidestrconsts:lismacropromptenterrunparameters -msgid "Enter run parameters" -msgstr "Введите параметры запуска" - -#: lazarusidestrconsts:lisentertransla -msgid "Enter translation language" -msgstr "Введите язык перевода" - -#: lazarusidestrconsts:dlgentirescope -msgid "Entire Scope" -msgstr "С начала" - -#: lazarusidestrconsts:dlgrunoenvironment -msgid "Environment" -msgstr "Окружения" - -#: lazarusidestrconsts:srkmcatenvmenu -msgid "Environment menu commands" -msgstr "Команды меню окружения" - -#: lazarusidestrconsts:lismenugeneraloptions -msgid "Environment options" -msgstr "Параметры окружения" - -#: lazarusidestrconsts:liscodetemplerror -msgid "Error" -msgstr "Ошибка" - -#: lazarusidestrconsts:lispkgmangerrorreadingpackage -msgid "Error Reading Package" -msgstr "Ошибка чтения пакета" - -#: lazarusidestrconsts:lispkgmangerrorwritingpackage -msgid "Error Writing Package" -msgstr "Ошибка записи пакета" - -#: lazarusidestrconsts:liserrorcreatingfile -msgid "Error creating file" -msgstr "Ошибка создания файла" - -#: lazarusidestrconsts:liserrorcreatinglrs -msgid "Error creating lrs" -msgstr "Ошибка создания lrs" - -#: lazarusidestrconsts:liserrordeletingfile -msgid "Error deleting file" -msgstr "Ошибка удаления файла" - -#: lazarusidestrconsts:liserrorin -msgid "Error in %s" -msgstr "Ошибка в %s" - -#: lazarusidestrconsts:lisueerrorinregularexpression -msgid "Error in regular expression" -msgstr "Ошибка в регулярном выражении" - -#: lazarusidestrconsts:liserrorinitializingprogramserrors -msgid "Error initializing program%s%s%s%s%sError: %s" -msgstr "Ошибка инициализации программы %s%s%s%s%sОшибка: %s" - -#: lazarusidestrconsts:liserrormovingcomponent -msgid "Error moving component" -msgstr "Ошибка перемещения компонента" - -#: lazarusidestrconsts:liserrormovingcomponent2 -msgid "Error moving component %s:%s" -msgstr "Ошибка перемещения компонента %s:%s" - -#: lazarusidestrconsts:liserrorparsinglfmcomponentstream -msgid "Error parsing lfm component stream." -msgstr "Ошибка при чтении lfm сомпонента" - -#: lazarusidestrconsts:liscodetoolsdefserrorreading -msgid "Error reading %s%s%s%s%s" -msgstr "Ошибка чтения %s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangerrorreadingfile -msgid "Error reading file" -msgstr "Ошибка чтения файла" - -#: lazarusidestrconsts:lisdiskdifferrorreadingfile -msgid "Error reading file: %s" -msgstr "Ошибка чтения файла: %s" - -#: lazarusidestrconsts:liserrorreadingpackagelistfromfile -msgid "Error reading package list from file%s%s%s%s" -msgstr "Ошибка чтения списка пакетов из файла%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile -msgid "Error reading project info file %s%s%s%s%s" -msgstr "Ошибка чтения файла сведений проекта %s%s%s%s%s" - -#: lazarusidestrconsts:liserrorrenamingfile -msgid "Error renaming file" -msgstr "Ошибка переименования файла" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting -msgid "Error while writing %s%s%s%s%s" -msgstr "Ошибка записи %s%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile -msgid "Error while writing project info file %s%s%s%s%s" -msgstr "Ошибка записи проекта в файл %s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangerrorwritingfile -msgid "Error writing file" -msgstr "Ошибка записи файла" - -#: lazarusidestrconsts:liserrorwritingpackagelisttofile -msgid "Error writing package list to file%s%s%s%s" -msgstr "Ошибка записи списка пакетов в файл%s%s%s%s" - -#: lazarusidestrconsts:liserror -msgid "Error: " -msgstr "Ошибка:" - -#: lazarusidestrconsts:liscompilererrorinvalidcompiler -msgid "Error: invalid compiler: %s" -msgstr "Ошибка: неправильный компилятор:%s" - -#: lazarusidestrconsts:liserrors -msgid "Errors" -msgstr "Ошибки" - -#: lazarusidestrconsts:srvk_escape -msgid "Escape" -msgstr "Отмена (Esc)" - -#: lazarusidestrconsts:lismenuevaluate -msgid "Evaluate/Modify ..." -msgstr "Вычислить/Изменить..." - -#: lazarusidestrconsts:lislazdocexampletag -msgid "Example" -msgstr "" - -#: lazarusidestrconsts:lisexcludefilter -msgid "Exclude Filter" -msgstr "" - -#: lazarusidestrconsts:srvk_execute -msgid "Execute" -msgstr "Выполнить" - -#: lazarusidestrconsts:liscoexecuteafter -msgid "Execute after" -msgstr "Выполнить после" - -#: lazarusidestrconsts:liscoexecutebefore -msgid "Execute before" -msgstr "Выполнить перед" - -#: lazarusidestrconsts:lisexecutingcommandafter -msgid "Executing command after" -msgstr "Выполнить команду после" - -#: lazarusidestrconsts:lisexecutingcommandbefore -msgid "Executing command befor" -msgstr "Выполнить команду до" - -#: lazarusidestrconsts:lisexecutionpaused -msgid "Execution paused" -msgstr "Выполнение приостановлено" - -#: lazarusidestrconsts:lisexecutionpausedadress -msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" -msgstr "Выполнение остановлено%s Адрес: %s%s Процедура: %s%s Файл: %s%s(Когда-нибудь здесь появится окно ассемблера :)%s" - -#: lazarusidestrconsts:lisexecutionstopped -msgid "Execution stopped" -msgstr "Выполнение остановлено" - -#: lazarusidestrconsts:lisexecutionstoppedon -msgid "Execution stopped%s" -msgstr "Выполнение остановлено %s" - -#: lazarusidestrconsts:liscodetoolsdefsexit -msgid "Exit" -msgstr "Выход" - -#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave -msgid "Exit without Save" -msgstr "Выход без сохранения" - -#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor -msgid "Expanded filename of current editor file" -msgstr "Полное имя файла в данном редакторе" - -#: lazarusidestrconsts:lisexportlist -msgid "Export list" -msgstr "Список экспорта" - -#: lazarusidestrconsts:lisextendunitpath -msgid "Extend unit path?" -msgstr "" - -#: lazarusidestrconsts:lisexttoolexternaltools -msgid "External Tools" -msgstr "Внешние инструменты" - -#: lazarusidestrconsts:srkmecexttool -msgid "External tool %d" -msgstr "Внешний инструмент %d" - -#: lazarusidestrconsts:srkmecexttoolsettings -msgid "External tools settings" -msgstr "Настройки внешнего инструмента" - -#: lazarusidestrconsts:dlgextralinespacing -msgid "Extra line spacing" -msgstr "Межстрочный интервал" - -#: lazarusidestrconsts:lisextract -msgid "Extract" -msgstr "Извлечь" - -#: lazarusidestrconsts:uemextractproc -msgid "Extract Procedure" -msgstr "Выделить процедуру" - -#: lazarusidestrconsts:lismenuextractproc -msgid "Extract procedure" -msgstr "Выделить процедуру" - -#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory -msgid "FPC SVN source directory" -msgstr "" - -#: lazarusidestrconsts:lisfpcsourcedirectoryerror -msgid "FPC Source Directory error" -msgstr "Ошибка каталога исходников FPC" - -#: lazarusidestrconsts:dlgfpcsrcpath -msgid "FPC source directory" -msgstr "Каталог исходников FPC" - -#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg -msgid "FPC source directory \"%s\" not found." -msgstr "Каталог исходников FPC \"%s\" не найден." - -#: lazarusidestrconsts:lisexttoolfailedtoruntool -msgid "Failed to run tool" -msgstr "Не удалось запустить инструмент" - -#: lazarusidestrconsts:dlgcofast -msgid "Faster Code" -msgstr "Быстрый код" - -#: lazarusidestrconsts:listodolfile -msgid "File" -msgstr "Файл" - -#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject -msgid "File %s%s%s already exists in the project." -msgstr "Файл %s%s%s уже есть в проекте." - -#: lazarusidestrconsts:lisfilehaschangedsave -msgid "File %s%s%s has changed. Save?" -msgstr "Файл %s%s%s изменён. Сохранить?" - -#: lazarusidestrconsts:lisfileisvirtual -msgid "File %s%s%s is virtual." -msgstr "Файл %s%s%s виртуальный." - -#: lazarusidestrconsts:lispkgmangfilenotfound -msgid "File %s%s%s not found." -msgstr "Файл %s%s%s не найден." - -#: lazarusidestrconsts:lisfilenotfound2 -msgid "File %s%s%s not found.%s" -msgstr "Файл %s%s%s не найден.%s" - -#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit -msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "Файл %s%s%s не найден.%sСоздать его?%s" - -#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway -msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "Файл %s%s%s%sне похож на текстовый.%sВсё равно открыть?" - -#: lazarusidestrconsts:lispckeditfileproperties -msgid "File Properties" -msgstr "Свойства файла" - -#: lazarusidestrconsts:lisaf2pfiletype -msgid "File Type" -msgstr "Тип файла" - -#: lazarusidestrconsts:lisa2pfilealreadyexists -msgid "File already exists" -msgstr "Файл уже существует" - -#: lazarusidestrconsts:lisa2pfilealreadyinpackage -msgid "File already in package" -msgstr "Файл уже в пакете" - -#: lazarusidestrconsts:dlgfileexts -msgid "File extensions:" -msgstr "Расш-я файлов:" - -#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage -msgid "File is already in package" -msgstr "Файл уже есть в пакете" - -#: lazarusidestrconsts:lispkgmangfileisinproject -msgid "File is in Project" -msgstr "Файл в проекте" - -#: lazarusidestrconsts:lisfileisnotwritable -msgid "File is not writable" -msgstr "В файл нельзя писать" - -#: lazarusidestrconsts:uefilerocap -msgid "File is readonly" -msgstr "Файл только для чтения" - -#: lazarusidestrconsts:lisa2pfileisused -msgid "File is used" -msgstr "Файл используется" - -#: lazarusidestrconsts:lisfindfilefilemaskbak -msgid "File mask (*;*.*;*.bak?)" -msgstr "Маска файла (*;*.*;*.bak?)" - -#: lazarusidestrconsts:srkmcatfilemenu -msgid "File menu commands" -msgstr "Команды меню файл" - -#: lazarusidestrconsts:lisa2pfilename -msgid "File name:" -msgstr "Имя файла:" - -#: lazarusidestrconsts:lisrunparamsfilenotexecutable -msgid "File not executable" -msgstr "Файл не исполняемый" - -#: lazarusidestrconsts:lisfilenotfound -msgid "File not found" -msgstr "Файл не найден" - -#: lazarusidestrconsts:lisfilenotlowercase -msgid "File not lowercase" -msgstr "Файл не в нижнем регистре" - -#: lazarusidestrconsts:lispkgmangfilenotsaved -msgid "File not saved" -msgstr "Файл не сохранён" - -#: lazarusidestrconsts:lisfilenottext -msgid "File not text" -msgstr "Файл не текстовый" - -#: lazarusidestrconsts:lisa2pfilenotunit -msgid "File not unit" -msgstr "Файл - не модуль" - -#: lazarusidestrconsts:lisa2pfilename2 -msgid "Filename" -msgstr "Имя файла" - -#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename -msgid "Filename differs from Packagename" -msgstr "Имя файла отличается от имени пакета" - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage -msgid "Filename is used by other package" -msgstr "Имя файла использовано другим пакетом" - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject -msgid "Filename is used by project" -msgstr "Имя файла использовано проектом" - -#: lazarusidestrconsts:lisoipfilename -msgid "Filename: %s" -msgstr "Имя файла: %s" - -#: lazarusidestrconsts:dlgenvfiles -msgid "Files" -msgstr "Файлы" - -#: lazarusidestrconsts:srvk_final -msgid "Final" -msgstr "Финальный" - -#: lazarusidestrconsts:lismenufind -msgid "Find" -msgstr "Найти" - -#: lazarusidestrconsts:lismenufindnext -msgid "Find &Next" -msgstr "Найти далее" - -#: lazarusidestrconsts:lismenufindprevious -msgid "Find &Previous" -msgstr "Найти предыдущее совпадение" - -#: lazarusidestrconsts:lismenufindinfiles -msgid "Find &in files" -msgstr "Поиск в файлах" - -#: lazarusidestrconsts:lismenufinddeclarationatcursor -msgid "Find Declaration at cursor" -msgstr "Найти описание под курсора" - -#: lazarusidestrconsts:lismenufindidentifierrefs -msgid "Find Identifier References" -msgstr "Найти ссылки на идентификатор" - -#: lazarusidestrconsts:lismenutemplatefindnext -msgid "Find Next" -msgstr "Найти далее" - -#: lazarusidestrconsts:lisfrifindreferences -msgid "Find References" -msgstr "Найти ссылки" - -#: lazarusidestrconsts:srkmecfindblockotherend -msgid "Find block other end" -msgstr "Найти другой конец блока" - -#: lazarusidestrconsts:srkmecfindblockstart -msgid "Find block start" -msgstr "Найти начало блока" - -#: lazarusidestrconsts:lismenufindcodeblockstart -msgid "Find code block start" -msgstr "Найти начало блока кода" - -#: lazarusidestrconsts:srkmecfinddeclaration -msgid "Find declaration" -msgstr "Найти описание" - -#: lazarusidestrconsts:srkmecfindidentifierrefs -msgid "Find identifier references" -msgstr "Найти ссылки на идентификатор" - -#: lazarusidestrconsts:srkmecfindinfiles -msgid "Find in files" -msgstr "Найти в файлах" - -#: lazarusidestrconsts:srkmecfindnext -msgid "Find next" -msgstr "Найти далее" - -#: lazarusidestrconsts:lisfrifindorrenameidentifier -msgid "Find or Rename Identifier" -msgstr "Найти или переименовать ID" - -#: lazarusidestrconsts:lismenufindblockotherendofcodeblock -msgid "Find other end of code block" -msgstr "Найти другой конец блока кода" - -#: lazarusidestrconsts:srkmecfindprevious -msgid "Find previous" -msgstr "Найти предыдущее" - -#: lazarusidestrconsts:srkmecfindproceduredefinition -msgid "Find procedure definiton" -msgstr "Найти описание процедуры" - -#: lazarusidestrconsts:srkmecfindproceduremethod -msgid "Find procedure method" -msgstr "Найти метод процедуры" - -#: lazarusidestrconsts:srkmecfind -msgid "Find text" -msgstr "Найти текст" - -#: lazarusidestrconsts:dlgfindtextatcursor -msgid "Find text at cursor" -msgstr "Найти текст под курсором" - -#: lazarusidestrconsts:rslanguagefinnish -msgid "Finnish" -msgstr "Финский" - -#: lazarusidestrconsts:lisfixlfmfile -msgid "Fix LFM file" -msgstr "Исправить файл LFM" - -#: lazarusidestrconsts:srkmecjumptoeditor -msgid "Focus to source editor" -msgstr "Фокус в редактор исходников" - -#: lazarusidestrconsts:liscefollowcursor -msgid "Follow cursor" -msgstr "" - -#: lazarusidestrconsts:lisforcerenaming -msgid "Force renaming" -msgstr "" - -#: lazarusidestrconsts:dlgforecolor -msgid "Foreground color" -msgstr "Цвет текста" - -#: lazarusidestrconsts:dlgfrmeditor -msgid "Form Editor" -msgstr "Редактор форм" - -#: lazarusidestrconsts:lisformloaderror -msgid "Form load error" -msgstr "Ошибка загрузки формы" - -#: lazarusidestrconsts:lisformaterror -msgid "Format error" -msgstr "Ошибка форматирования" - -#: lazarusidestrconsts:dlgpofroms -msgid "Forms" -msgstr "Формы" - -#: lazarusidestrconsts:lismenuviewforms -msgid "Forms..." -msgstr "Формы..." - -#: lazarusidestrconsts:fdmorderforwardone -msgid "Forward one" -msgstr "Передний" - -#: lazarusidestrconsts:lisfrforwardsearch -msgid "Forward search" -msgstr "Поиск вперёд" - -#: lazarusidestrconsts:lisfreepascalcompilernotfound -msgid "Free Pascal Compiler not found" -msgstr "Компилятор FreePascal не найден" - -#: lazarusidestrconsts:lisfreepascalsourcesnotfound -msgid "Free Pascal Sources not found" -msgstr "Не найдены исходники FreePascal" - -#: lazarusidestrconsts:lisfreepascalsourcefile -msgid "FreePascal source file" -msgstr "Исходный код Free Pascal" - -#: lazarusidestrconsts:lisfreepascalsourcedirectory -msgid "Freepascal source directory" -msgstr "Каталог исходников FreePascal" - -#: lazarusidestrconsts:rslanguagefrench -msgid "French" -msgstr "Французский" - -#: lazarusidestrconsts:dlgfromcursor -msgid "From Cursor" -msgstr "От курсора" - -#: lazarusidestrconsts:listmfunctionappendpathdelimiter -msgid "Function: append path delimiter" -msgstr "Функция: добавить разделитель путей" - -#: lazarusidestrconsts:listmfunctionchomppathdelimiter -msgid "Function: chomp path delimiter" -msgstr "Функция: убрать разделитель путей" - -#: lazarusidestrconsts:listmfunctionextractfileextension -msgid "Function: extract file extension" -msgstr "Функция: извлечь расширение файла" - -#: lazarusidestrconsts:listmfunctionextractfilenameonly -msgid "Function: extract file name only" -msgstr "Функция: извлечь только имя файла" - -#: lazarusidestrconsts:listmfunctionextractfilenameextension -msgid "Function: extract file name+extension" -msgstr "Функция: извлечь имя файла с расширением" - -#: lazarusidestrconsts:listmfunctionextractfilepath -msgid "Function: extract file path" -msgstr "Функция: извлечь путь файла" - -#: lazarusidestrconsts:dlggpccomp -msgid "GPC (GNU Pascal Compiler) Compatible" -msgstr "Совместимость с GPC (GNU Pascal Compiler)" - -#: lazarusidestrconsts:lismenuinsertgplnotice -msgid "GPL notice" -msgstr "Заметка GPL" - -#: lazarusidestrconsts:lismenuinsertgeneral -msgid "General" -msgstr "Общие" - -#: lazarusidestrconsts:lispckeditgeneraloptions -msgid "General Options" -msgstr "Общие настройки" - -#: lazarusidestrconsts:srkmecenvironmentoptions -msgid "General environment options" -msgstr "Общие настройки окружения" - -#: lazarusidestrconsts:dlgcodbx -msgid "Generate Debugging Info For DBX (Slows Compiling)" -msgstr "Генерировать информацию для DBX (замедляет сборку)" - -#: lazarusidestrconsts:dlgcogdb -msgid "Generate Debugging Info For GDB (Slows Compiling)" -msgstr "Генерировать информацию для GDB (замедляет сборку)" - -#: lazarusidestrconsts:dlggprof -msgid "Generate code for gprof" -msgstr "Создать код для gprof" - -#: lazarusidestrconsts:dlgcovalgrind -msgid "Generate code for valgrind" -msgstr "Создать код для valgrind" - -#: lazarusidestrconsts:dlgcogenerate -msgid "Generate:" -msgstr "Создать:" - -#: lazarusidestrconsts:rslanguagegerman -msgid "German" -msgstr "" - -#: lazarusidestrconsts:dlggetposition -msgid "Get position" -msgstr "Принять позицию" - -#: lazarusidestrconsts:dlgglobal -msgid "Global" -msgstr "Везде" - -#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition -msgid "Global Source Path addition" -msgstr "Глобально добавить путь исходников" - -#: lazarusidestrconsts:srkmecgotomarker -msgid "Go to Marker %d" -msgstr "Переход к маркеру %d" - -#: lazarusidestrconsts:srkmecgotoeditor -msgid "Go to editor %d" -msgstr "Переход к редактору %d" - -#: lazarusidestrconsts:srkmecgotolinenumber -msgid "Go to line number" -msgstr "Переход к строке номер" - -#: lazarusidestrconsts:srkmecmatchbracket -msgid "Go to matching bracket" -msgstr "Переход к соотв. скобке" - -#: lazarusidestrconsts:srkmecnexteditor -msgid "Go to next editor" -msgstr "Переход к следующему редактору" - -#: lazarusidestrconsts:srkmecpreveditor -msgid "Go to prior editor" -msgstr "Переход к предыдущему редактору" - -#: lazarusidestrconsts:srkmecgotoincludedirective -msgid "Go to to include directive of current include file" -msgstr "Переход по директиве include текущего включаемого файла" - -#: lazarusidestrconsts:srkmecgotoxy -msgid "Goto XY" -msgstr "Переход по координате" - -#: lazarusidestrconsts:lismenugotoincludedirective -msgid "Goto include directive" -msgstr "Переход по директиве $I" - -#: lazarusidestrconsts:lismenugotoline -msgid "Goto line" -msgstr "Переход к строке" - -#: lazarusidestrconsts:lisuegotoline -msgid "Goto line :" -msgstr "Строка :" - -#: lazarusidestrconsts:uemnextbookmark -msgid "Goto next Bookmark" -msgstr "" - -#: lazarusidestrconsts:uemprevbookmark -msgid "Goto previous Bookmark" -msgstr "" - -#: lazarusidestrconsts:listodolistgotoline -msgid "Goto selected source line" -msgstr "Переход к выделенной строке исходника" - -#: lazarusidestrconsts:srkmgrabkey -msgid "Grab Key" -msgstr "Захват клавиш" - -#: lazarusidestrconsts:dlggrabbercolor -msgid "Grabber color" -msgstr "Цвет выделения" - -#: lazarusidestrconsts:dlgenvgrid -msgid "Grid" -msgstr "Сетка" - -#: lazarusidestrconsts:dlggridcolor -msgid "Grid color" -msgstr "Цвет сетки" - -#: lazarusidestrconsts:dlggridx -msgid "Grid size X" -msgstr "Размер X сетки" - -#: lazarusidestrconsts:dlggridy -msgid "Grid size Y" -msgstr "Размер Y сетки" - -#: lazarusidestrconsts:srkmecguessmisplacedifdef -msgid "Guess misplaced $IFDEF" -msgstr "Предположить отсутствие $IFDEF" - -#: lazarusidestrconsts:lismenuguessmisplacedifdef -msgid "Guess misplaced IFDEF/ENDIF" -msgstr "Исправить несоответствие IFDEF/ENDIF" - -#: lazarusidestrconsts:lismenuguessunclosedblock -msgid "Guess unclosed block" -msgstr "Исправить незаконченный блок" - -#: lazarusidestrconsts:dlgenvlguidelines -msgid "Guide lines" -msgstr "Линии помощи" - -#: lazarusidestrconsts:dlgguttercolor -msgid "Gutter color" -msgstr "Цвет поля (лев)" - -#: lazarusidestrconsts:dlggutterwidth -msgid "Gutter width" -msgstr "Ширина поля (лев)" - -#: lazarusidestrconsts:dlghalfpagescroll -msgid "Half page scroll" -msgstr "Прокрутка на половину страницы" - -#: lazarusidestrconsts:lismenueditorhandleonclickevent -msgid "Handle OnClick Event" -msgstr "Обработать событие OnClick" - -#: lazarusidestrconsts:srvk_hanja -msgid "Hanja" -msgstr "Hanja" - -#: lazarusidestrconsts:lisaf2phasregisterprocedure -msgid "Has Register procedure" -msgstr "Имеет проц-ру Register" - -#: lazarusidestrconsts:lisheadercommentforclass -msgid "Header comment for class" -msgstr "Комментарий-заголовок для класса" - -#: lazarusidestrconsts:dlgheapsize -msgid "Heap Size" -msgstr "Размер кучи" - -#: lazarusidestrconsts:rslanguagehebrew -msgid "Hebrew" -msgstr "" - -#: lazarusidestrconsts:dlgheightpos -msgid "Height:" -msgstr "Высота:" - -#: lazarusidestrconsts:srvk_help -msgid "Help" -msgstr "Справка" - -#: lazarusidestrconsts:lishelpcontextnotfound -msgid "Help Context not found" -msgstr "Содержание справки не найдено" - -#: lazarusidestrconsts:lishelpdatabasenotfound -msgid "Help Database not found" -msgstr "База данных справки не найдена" - -#: lazarusidestrconsts:lishlpoptshelpoptions -msgid "Help Options" -msgstr "Параметры справки" - -#: lazarusidestrconsts:lishelpselectorerror -msgid "Help Selector Error" -msgstr "Ошибка выбора справки" - -#: lazarusidestrconsts:lishelpviewererror -msgid "Help Viewer Error" -msgstr "Ошибка просмотра справки" - -#: lazarusidestrconsts:lishelpviewernotfound -msgid "Help Viewer not found" -msgstr "Просмотрщик справки не найден" - -#: lazarusidestrconsts:srkmcarhelpmenu -msgid "Help menu commands" -msgstr "Команды меню Справка" - -#: lazarusidestrconsts:lishelpnotfound -msgid "Help not found" -msgstr "Справки не найдено" - -#: lazarusidestrconsts:dlghideideonrun -msgid "Hide IDE windows on run" -msgstr "Скрыть окна IDE при пуске" - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 -msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again." -msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите только строковое выражение и попробуйте снова." - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon -msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again." -msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите выражение и попробуйте снова." - -#: lazarusidestrconsts:dlgedhintcommand -msgid "Hint: click on the command you want to edit" -msgstr "Подсказка: щелкните по команде, которая Вам нужна" - -#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath -msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "Подсказка: Вы можете задать путь компилятора в Окружение->Параметры окружения->Файлы->Путь компилятора" - -#: lazarusidestrconsts:dlgpalhints -msgid "Hints for component palette" -msgstr "Подсказки палитры компонентов" - -#: lazarusidestrconsts:dlgspbhints -msgid "Hints for main speed buttons (open, save, ...)" -msgstr "Подсказки командных кнопок (открыть, сохранить и т.д.)" - -#: lazarusidestrconsts:srvk_home -msgid "Home" -msgstr "Дом" - -#: lazarusidestrconsts:dlghomekeyjumpstoneareststart -msgid "Home key jumps to nearest start" -msgstr "" - -#: lazarusidestrconsts:lishorizontal -msgid "Horizontal" -msgstr "Горизонтально" - -#: lazarusidestrconsts:dlggridxhint -msgid "Horizontal grid step size" -msgstr "Шаг сетки по горизонтали" - -#: lazarusidestrconsts:dlghostapplication -msgid "Host application" -msgstr "Главное приложение" - -#: lazarusidestrconsts:uenotimplcapagain -msgid "I told You: Not implemented yet" -msgstr "Вам сказано - не реализовано" - -#: lazarusidestrconsts:lispckoptsideintegration -msgid "IDE Integration" -msgstr "Встраивание в IDE" - -#: lazarusidestrconsts:lisideoptions -msgid "IDE Options:" -msgstr "Параметры IDE:" - -#: lazarusidestrconsts:uepins -msgid "INS" -msgstr "ВСТ" - -#: lazarusidestrconsts:liscodetoolsoptsidentifier -msgid "Identifier" -msgstr "Идентификатор" - -#: lazarusidestrconsts:lismakeresstridentifierlength -msgid "Identifier Length:" -msgstr "Длина идентификатора:" - -#: lazarusidestrconsts:lismakeresstridentifierprefix -msgid "Identifier Prefix:" -msgstr "Префикс идентификатора:" - -#: lazarusidestrconsts:dlgedidcomlet -msgid "Identifier completion" -msgstr "Завершение идентификаторов" - -#: lazarusidestrconsts:dlgidentifierpolicy -msgid "Identifier policy" -msgstr "Политика идентификаторов" - -#: lazarusidestrconsts:lisfriidentifier -msgid "Identifier: %s" -msgstr "Идентификатор: %s" - -#: lazarusidestrconsts:liscodetoolsdefsif -msgid "If" -msgstr "If" - -#: lazarusidestrconsts:uenotimpltext -msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "Если Вы можете помочь нам реализовать эту функцию, пишите lazarus@miraclec.com" - -#: lazarusidestrconsts:liscodetoolsdefsifdef -msgid "IfDef" -msgstr "IfDef" - -#: lazarusidestrconsts:liscodetoolsdefsifndef -msgid "IfNDef" -msgstr "IfNDef" - -#: lazarusidestrconsts:dlgignoreverb -msgid "Ignore" -msgstr "Пропуск" - -#: lazarusidestrconsts:lissortselignorespace -msgid "Ignore Space" -msgstr "Игнорировать пробелы" - -#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd -msgid "Ignore amount of space chars" -msgstr "Игнорировать количество пробелов" - -#: lazarusidestrconsts:lisignorebinaries -msgid "Ignore binaries" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe -msgid "Ignore difference in line ends (e.g. #10 = #13#10)" -msgstr "Игнорировать разные концы строк (напр., #10 = #13#10)" - -#: lazarusidestrconsts:lisdiskdiffignorediskchanges -msgid "Ignore disk changes" -msgstr "Игнорировать изменения на диске" - -#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd -msgid "Ignore if empty lines were added or removed" -msgstr "Игнорировать добавление/удаление пустых строк" - -#: lazarusidestrconsts:lisignoremissingfile -msgid "Ignore missing file" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgignorespaces -msgid "Ignore spaces (newline chars not included)" -msgstr "Игнорировать пробелы (не включая перевод строки)" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline -msgid "Ignore spaces at end of line" -msgstr "Игнорировать пробелы в конце строки" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline -msgid "Ignore spaces at start of line" -msgstr "Игнорировать пробелы в начале строки" - -#: lazarusidestrconsts:srkmecimestr -msgid "Ime Str" -msgstr "" - -#: lazarusidestrconsts:lisimportlist -msgid "Import list" -msgstr "Список импорта" - -#: lazarusidestrconsts:dlginfrontofmethods -msgid "In front of methods" -msgstr "Перед методами" - -#: lazarusidestrconsts:lispckoptsinclude -msgid "Include" -msgstr "Включает" - -#: lazarusidestrconsts:dlgassertcode -msgid "Include Assertion Code" -msgstr "Включить код Assert" - -#: lazarusidestrconsts:dlgcoincfiles -msgid "Include Files (-Fi):" -msgstr "Включаемые файлы (-Fi):" - -#: lazarusidestrconsts:lisincludefilter -msgid "Include Filter" -msgstr "" - -#: lazarusidestrconsts:lispkgfiletypeinclude -msgid "Include file" -msgstr "Включаемый файл:" - -#: lazarusidestrconsts:lisfindfileincludesubdirectories -msgid "Include sub directories" -msgstr "Включить подкаталоги" - -#: lazarusidestrconsts:dlgincludesystemvariables -msgid "Include system variables" -msgstr "Включить системные переменные" - -#: lazarusidestrconsts:lisuidincludedby -msgid "Included by:" -msgstr "Включён:" - -#: lazarusidestrconsts:lismenuincrementalfind -msgid "Incremental Find" -msgstr "Поиск с нарастанием" - -#: lazarusidestrconsts:srkmecblockindent -msgid "Indent block" -msgstr "Отделить блок" - -#: lazarusidestrconsts:dlgindentcodeto -msgid "Indent code to" -msgstr "Выровнять код по" - -#: lazarusidestrconsts:lismenuindentselection -msgid "Indent selection" -msgstr "Сдвинуть блок вправо" - -#: lazarusidestrconsts:lisinformationaboutunit -msgid "Information about %s" -msgstr "Информация о %s" - -#: lazarusidestrconsts:dlgcoinherited -msgid "Inherited" -msgstr "Унаследован" - -#: lazarusidestrconsts:srvk_insert -msgid "Insert" -msgstr "Вставить" - -#: lazarusidestrconsts:lismenuconditionalselection -msgid "Insert $IFDEF..." -msgstr "Вставить $IFDEF..." - -#: lazarusidestrconsts:srkmecinsertcvsauthor -msgid "Insert CVS keyword Author" -msgstr "Вставить ключевое слово CVS Author" - -#: lazarusidestrconsts:srkmecinsertcvsdate -msgid "Insert CVS keyword Date" -msgstr "Вставить ключевое слово CVS Date" - -#: lazarusidestrconsts:srkmecinsertcvsheader -msgid "Insert CVS keyword Header" -msgstr "Вставить ключевое слово CVS Header" - -#: lazarusidestrconsts:srkmecinsertcvsid -msgid "Insert CVS keyword ID" -msgstr "Вставить ключевое слово CVS ID" - -#: lazarusidestrconsts:srkmecinsertcvslog -msgid "Insert CVS keyword Log" -msgstr "Вставить ключевое слово CVS Log" - -#: lazarusidestrconsts:srkmecinsertcvsname -msgid "Insert CVS keyword Name" -msgstr "Вставить ключевое слово CVS Name" - -#: lazarusidestrconsts:srkmecinsertcvsrevision -msgid "Insert CVS keyword Revision" -msgstr "Вставить ключевое слово CVS Revision" - -#: lazarusidestrconsts:srkmecinsertcvssource -msgid "Insert CVS keyword Source" -msgstr "Вставить ключевое слово CVS Source" - -#: lazarusidestrconsts:srkmecinsertchangelogentry -msgid "Insert ChangeLog entry" -msgstr "Вставить элемент ChangeLog" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp -msgid "Insert Delphi 5 Compiler Template" -msgstr "Вставить шаблон компилятора Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem -msgid "Insert Delphi 5 Directory Template" -msgstr "Вставить шаблон каталога Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl -msgid "Insert Delphi 5 Project Template" -msgstr "Вставить шаблон проекта Delphi 5" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp -msgid "Insert Delphi 6 Compiler Template" -msgstr "Вставить шаблон компилятора Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem -msgid "Insert Delphi 6 Directory Template" -msgstr "Вставить шаблон каталога Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl -msgid "Insert Delphi 6 Project Template" -msgstr "Вставить шаблон проекта Delphi 6" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp -msgid "Insert Delphi 7 Compiler Template" -msgstr "Вставить шаблон компилятора Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem -msgid "Insert Delphi 7 Directory Template" -msgstr "Вставить шаблон каталога Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl -msgid "Insert Delphi 7 Project Template" -msgstr "Вставить шаблон проекта Delphi 7" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert -msgid "Insert Free Pascal Compiler Template" -msgstr "Вставить шаблон компилятора FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte -msgid "Insert Free Pascal Project Template" -msgstr "Вставить шаблон проекта FreePascal" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource -msgid "Insert Free Pascal SVN Source Template" -msgstr "" - -#: lazarusidestrconsts:lismenueditorinsertfromtemplate -msgid "Insert From Template..." -msgstr "Вставить шаблон формы..." - -#: lazarusidestrconsts:srkmecinsertgplnotice -msgid "Insert GPL notice" -msgstr "Вставить заметку о GPL" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp -msgid "Insert Kylix 3 Compiler Template" -msgstr "Вставить шаблон компилятора Kylix 3" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem -msgid "Insert Kylix 3 Directory Template" -msgstr "Вставить шаблон каталога Kylix 3" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl -msgid "Insert Kylix 3 Project Template" -msgstr "Вставить шаблон проекта Kylix 3" - -#: lazarusidestrconsts:srkmecinsertlgplnotice -msgid "Insert LGPL notice" -msgstr "Вставить заметку о LGPL" - -#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem -msgid "Insert Lazarus Directory Template" -msgstr "Вставить шаблон каталога Lazarus" - -#: lazarusidestrconsts:lisctinsertmacro -msgid "Insert Macro" -msgstr "" - -#: lazarusidestrconsts:srkmecinsertmode -msgid "Insert Mode" -msgstr "Режим вставки" - -#: lazarusidestrconsts:lismenueditorinsertnewitemafter -msgid "Insert New Item (after)" -msgstr "Вставить новый пункт (после)" - -#: lazarusidestrconsts:lismenueditorinsertnewitembefore -msgid "Insert New Item (before)" -msgstr "Вставить новый пункт (перед)" - -#: lazarusidestrconsts:liscodetoolsdefsinserttemplate -msgid "Insert Template" -msgstr "Вставить шаблон" - -#: lazarusidestrconsts:lismakeresstrinsertalphabetically -msgid "Insert alphabetically" -msgstr "Вставить по алфавиту" - -#: lazarusidestrconsts:lislazdochintboldformat -msgid "Insert bold formatting tag" -msgstr "" - -#: lazarusidestrconsts:lislazdochintinsertcodetag -msgid "Insert code formatting tag" -msgstr "" - -#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive -msgid "Insert context sensitive" -msgstr "Вставить с учётом контекста" - -#: lazarusidestrconsts:srkmecinsertdatetime -msgid "Insert current date and time" -msgstr "Вставить текущие дату и время" - -#: lazarusidestrconsts:srkmecinsertusername -msgid "Insert current username" -msgstr "Вставить текущее имя пользователя" - -#: lazarusidestrconsts:lismenuinsertcharacter -msgid "Insert from Character Map" -msgstr "Вставить из таблицы символов" - -#: lazarusidestrconsts:srkmecinsertcharacter -msgid "Insert from Charactermap" -msgstr "Вставить из таблицы символов" - -#: lazarusidestrconsts:lislazdochintitalicformat -msgid "Insert italic formatting tag" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild -msgid "Insert node as child" -msgstr "Вставить элемент как дочерний" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow -msgid "Insert node below" -msgstr "Вставить элемент ниже" - -#: lazarusidestrconsts:lislazdochintremarktag -msgid "Insert remark formatting tag" -msgstr "" - -#: lazarusidestrconsts:dlginsspaceafter -msgid "Insert space after" -msgstr "Вставлять пробелы после" - -#: lazarusidestrconsts:dlginsspacefront -msgid "Insert space in front of" -msgstr "Вставлять пробелы перед" - -#: lazarusidestrconsts:lismenuinserttext -msgid "Insert text" -msgstr "Вставить текст" - -#: lazarusidestrconsts:lislazdochintunderlineformat -msgid "Insert underline formatting tag" -msgstr "" - -#: lazarusidestrconsts:lislazdochintvartag -msgid "Insert var formatting tag" -msgstr "" - -#: lazarusidestrconsts:lismenuinspect -msgid "Inspect ..." -msgstr "Следить за ..." - -#: lazarusidestrconsts:lispckeditinstall -msgid "Install" -msgstr "Установить" - -#: lazarusidestrconsts:lispckexplinstallonnextstart -msgid "Install on next start" -msgstr "Установить при след. запуске" - -#: lazarusidestrconsts:lispckeditinstallpackageintheide -msgid "Install package in the IDE" -msgstr "Установить пакет в IDE" - -#: lazarusidestrconsts:lisinstallselection -msgid "Install selection" -msgstr "Установить выбранное" - -#: lazarusidestrconsts:lisinstallationfailed -msgid "Installation failed" -msgstr "" - -#: lazarusidestrconsts:lispckexplinstalled -msgid "Installed" -msgstr "Установлен" - -#: lazarusidestrconsts:lisinstalledpackages -msgid "Installed Packages" -msgstr "Установленные пакеты" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac -msgid "Installing the package %s will automatically install the package:" -msgstr "Инталляция пакета %s автоматически установит остальные:" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 -msgid "Installing the package %s will automatically install the packages:" -msgstr "Инталляция пакета %s автоматически установит остальные:" - -#: lazarusidestrconsts:dlgintvinsec -msgid "Interval in secs" -msgstr "Интервал в сек" - -#: lazarusidestrconsts:lisa2pinvalidancestortype -msgid "Invalid Ancestor Type" -msgstr "Неправильный тип предка" - -#: lazarusidestrconsts:lisa2pinvalidcircle -msgid "Invalid Circle" -msgstr "Неправильный цикл" - -#: lazarusidestrconsts:lisa2pinvalidclassname -msgid "Invalid Class Name" -msgstr "Неправильное имя класса" - -#: lazarusidestrconsts:lisinvalidcompilerfilename -msgid "Invalid Compiler Filename" -msgstr "Неправильное имя файла компилятора" - -#: lazarusidestrconsts:lispublprojinvalidexcludefilter -msgid "Invalid Exclude filter" -msgstr "Неправильный фильтр исключений" - -#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory -msgid "Invalid Free Pascal source directory" -msgstr "Неправильный каталог исходников FPC" - -#: lazarusidestrconsts:lisfriinvalididentifier -msgid "Invalid Identifier" -msgstr "Некорректный идентификатор" - -#: lazarusidestrconsts:lispublprojinvalidincludefilter -msgid "Invalid Include filter" -msgstr "Неправильный фильтр включений" - -#: lazarusidestrconsts:lisprojaddinvalidminmaxversion -msgid "Invalid Min-Max version" -msgstr "Неправильные версии (минимальная/максимальная)" - -#: lazarusidestrconsts:lisaf2pinvalidpackage -msgid "Invalid Package" -msgstr "Неправильный пакет" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename2 -msgid "Invalid Package Name" -msgstr "Неправильное имя пакета" - -#: lazarusidestrconsts:lisinvalidpascalidentifiercap -msgid "Invalid Pascal Identifier" -msgstr "Некорректный идентификатор паскаля" - -#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect -msgid "Invalid Resourcestring section" -msgstr "Неправильная секция Resourcestring" - -#: lazarusidestrconsts:lisa2pinvalidunitname -msgid "Invalid Unit Name" -msgstr "Неправильное имя модуля" - -#: lazarusidestrconsts:lispkgsysinvalidunitname -msgid "Invalid Unitname: %s" -msgstr "Неправильное имя модуля: %s" - -#: lazarusidestrconsts:lisinvalidcommand -msgid "Invalid command" -msgstr "Неправильная команда" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename -msgid "Invalid compiler filename" -msgstr "Некорректное имя компилятора" - -#: lazarusidestrconsts:lispkgsysinvalidcomponentclass -msgid "Invalid component class" -msgstr "Неправильный класс компонента" - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename -msgid "Invalid debugger filename" -msgstr "Некорректное имя отладчика" - -#: lazarusidestrconsts:lisinvaliddelete -msgid "Invalid delete" -msgstr "Недопустимое удаление" - -#: lazarusidestrconsts:lisinvaliddestinationdirectory -msgid "Invalid destination directory" -msgstr "Неправильный каталог назначения" - -#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction -msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again." -msgstr "Неправильное выражение.%sПодсказка: функция Создать строку ресурсов требует строковую константу в одном файле. Выделите выражение и попробуйте ещё." - -#: lazarusidestrconsts:lisa2pinvalidfile -msgid "Invalid file" -msgstr "Неправильный файл" - -#: lazarusidestrconsts:lispkgmanginvalidfileextension -msgid "Invalid file extension" -msgstr "Неправильное расширение файла" - -#: lazarusidestrconsts:lisa2pinvalidfilename -msgid "Invalid filename" -msgstr "Неправильное имя файла" - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename -msgid "Invalid make filename" -msgstr "Неправильное имя файла make" - -#: lazarusidestrconsts:lispckeditinvalidmaximumversion -msgid "Invalid maximum version" -msgstr "Неправильная максимальная версия" - -#: lazarusidestrconsts:lispckeditinvalidminimumversion -msgid "Invalid minimum version" -msgstr "Неправильная минимальная версия" - -#: lazarusidestrconsts:lisinvalidmultiselection -msgid "Invalid multiselection" -msgstr "Неправильный множественный выбор" - -#: lazarusidestrconsts:fdinvalidmutliselectioncap -msgid "Invalid mutliselection" -msgstr "Неправильный множественный выбор" - -#: lazarusidestrconsts:lisaf2pinvalidpackageid -msgid "Invalid package ID: %s%s%s" -msgstr "Неправильный идентификатор пакета: %s%s%s" - -#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension -msgid "Invalid package file extension" -msgstr "Неправильное расширение файла пакета" - -#: lazarusidestrconsts:lispkgmanginvalidpackagefilename -msgid "Invalid package filename" -msgstr "Неправильное имя файла пакета" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename -msgid "Invalid package name" -msgstr "Неправильное имя пакета" - -#: lazarusidestrconsts:lispckoptsinvalidpackagetype -msgid "Invalid package type" -msgstr "Неправильный тип пакета" - -#: lazarusidestrconsts:lisprojaddinvalidpackagename -msgid "Invalid packagename" -msgstr "Неправильное имя пакета" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparent -msgid "Invalid parent" -msgstr "Неправильный \"предок\"" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode -msgid "Invalid parent node" -msgstr "Неправильный родительский элемент" - -#: lazarusidestrconsts:lisprojaddinvalidpascalunitname -msgid "Invalid pascal unit name" -msgstr "Неправильное имя модуля паскаля" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode -msgid "Invalid previous node" -msgstr "Неправильный предыдущий элемент" - -#: lazarusidestrconsts:lisinvalidprocname -msgid "Invalid proc name" -msgstr "Неправильное имя проц-ры" - -#: lazarusidestrconsts:lisinvalidprojectfilename -msgid "Invalid project filename" -msgstr "Неправильное имя файла проекта" - -#: lazarusidestrconsts:lisinvalidselection -msgid "Invalid selection" -msgstr "Неправильное выделение" - -#: lazarusidestrconsts:lissvuoinvalidvariablename -msgid "Invalid variable name" -msgstr "Неправильное имя переменной" - -#: lazarusidestrconsts:lisprojaddinvalidversion -msgid "Invalid version" -msgstr "Неправильная версия" - -#: lazarusidestrconsts:ueminvertassignment -msgid "Invert Assignment" -msgstr "Инвертировать присвоение" - -#: lazarusidestrconsts:srkmecinvertassignment -msgid "Invert assignment" -msgstr "Инвертировать присвоение" - -#: lazarusidestrconsts:srvk_irregular -msgid "Irregular " -msgstr "Нерегулярный " - -#: lazarusidestrconsts:rslanguageitalian -msgid "Italian" -msgstr "итальянский" - -#: lazarusidestrconsts:rslanguageitalianiso -msgid "Italian(ISO 8859-1)" -msgstr "Итальянский (ISO 8859-1)" - -#: lazarusidestrconsts:dlgedital -msgid "Italic" -msgstr "Курсив" - -#: lazarusidestrconsts:dlgoiitemheight -msgid "Item height" -msgstr "Высота элемента" - -#: lazarusidestrconsts:rslanguagejapanese -msgid "Japanese" -msgstr "" - -#: lazarusidestrconsts:lismenujumpback -msgid "Jump back" -msgstr "Переход назад" - -#: lazarusidestrconsts:lismenujumpforward -msgid "Jump forward" -msgstr "Переход вперед" - -#: lazarusidestrconsts:lismenujumpto -msgid "Jump to" -msgstr "" - -#: lazarusidestrconsts:lismenujumptonextbookmark -msgid "Jump to next bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenujumptonexterror -msgid "Jump to next error" -msgstr "Переход к след. ошибке" - -#: lazarusidestrconsts:lismenujumptoprevbookmark -msgid "Jump to previous bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenujumptopreverror -msgid "Jump to previous error" -msgstr "Переход к пред. ошибке" - -#: lazarusidestrconsts:dlgjumpingetc -msgid "Jumping (e.g. Method Jumping)" -msgstr "Переход (например, по методу)" - -#: lazarusidestrconsts:srvk_junja -msgid "Junja" -msgstr "Junja" - -#: lazarusidestrconsts:srvk_kana -msgid "Kana" -msgstr "Kana" - -#: lazarusidestrconsts:liscldirkeepalltextfiles -msgid "Keep all text files" -msgstr "Оставлять все текстовые файлы" - -#: lazarusidestrconsts:dlgkeepcaretx -msgid "Keep caret X position" -msgstr "" - -#: lazarusidestrconsts:dlgcokeepvarsreg -msgid "Keep certain variables in registers" -msgstr "Хранить нек. переменные в регистрах" - -#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter -msgid "Keep files matching filter" -msgstr "Сохранять файлы, соотв. фильтру" - -#: lazarusidestrconsts:liskeepname -msgid "Keep name" -msgstr "" - -#: lazarusidestrconsts:dlgforwardprocskeeporder -msgid "Keep order of procedures" -msgstr "Сохранять порядок процедур" - -#: lazarusidestrconsts:srkmkey -msgid "Key" -msgstr "Клавиша" - -#: lazarusidestrconsts:dlgkeymappingscheme -msgid "Key Mapping Scheme" -msgstr "Схема раскладки клавиш" - -#: lazarusidestrconsts:dlgkeymapping -msgid "Key Mappings" -msgstr "Клавиши" - -#: lazarusidestrconsts:dlgkeymappingerrors -msgid "Key mapping errors" -msgstr "Ошибки комбинаций клавиш" - -#: lazarusidestrconsts:liscodetoolsoptskeyword -msgid "Keyword" -msgstr "Ключевое слово" - -#: lazarusidestrconsts:dlgkeywordpolicy -msgid "Keyword policy" -msgstr "Политика ключевых слов" - -#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions -msgid "LCL Interface specific options:" -msgstr "Опции LCL, зависящие от интерфейса:" - -#: lazarusidestrconsts:lislclwidgettype -msgid "LCL Widget Type" -msgstr "Тип элемента управления LCL" - -#: lazarusidestrconsts:lislazbuildlclinterface -msgid "LCL interface" -msgstr "Интерфейс LCL" - -#: lazarusidestrconsts:lislclunitpathmissing -msgid "LCL unit path missing" -msgstr "Отсутствует путь модуля LCL" - -#: lazarusidestrconsts:lispkgfiletypelfm -msgid "LFM - Lazarus form text" -msgstr "LFM - текст формы Lazarus" - -#: lazarusidestrconsts:lislfmfile -msgid "LFM file" -msgstr "Файл LFM" - -#: lazarusidestrconsts:lislfmfilecorrupt -msgid "LFM file corrupt" -msgstr "Файл LFM повреждён" - -#: lazarusidestrconsts:lislfmfilenotfound -msgid "LFM file not found" -msgstr "Файл LFM не найден" - -#: lazarusidestrconsts:lismenuinsertlgplnotice -msgid "LGPL notice" -msgstr "Заметка о LGPL" - -#: lazarusidestrconsts:lispkgfiletypelrs -msgid "LRS - Lazarus resource" -msgstr "LRS - ресурс Lazarus" - -#: lazarusidestrconsts:dlgenvlanguage -msgid "Language" -msgstr "Язык" - -#: lazarusidestrconsts:dlglang -msgid "Language:" -msgstr "Язык:" - -#: lazarusidestrconsts:dlgcdtlast -msgid "Last" -msgstr "Последним" - -#: lazarusidestrconsts:dlglast -msgid "Last (i.e. at end of source)" -msgstr "Последний (т.е. в конце исходника)" - -#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox -msgid "Launching application" -msgstr "" - -#: lazarusidestrconsts:lislaunchingapplicationinvalid -msgid "Launching application invalid" -msgstr "Запускающее приложение недопустимо" - -#: lazarusidestrconsts:lislaunchingcmdline -msgid "Launching target command line" -msgstr "Командная строка для запуска" - -#: lazarusidestrconsts:lislazdoc -msgid "LazDoc" -msgstr "" - -#: lazarusidestrconsts:lismenulazdoc -msgid "LazDoc Editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocmainformcaption -msgid "LazDoc editor" -msgstr "" - -#: lazarusidestrconsts:lislazdocpathsgroupbox -msgid "LazDoc settings" -msgstr "" - -#: lazarusidestrconsts:lispkgmanglazarus -msgid "Lazarus" -msgstr "Lazarus" - -#: lazarusidestrconsts:lislazarusdesktopsettings -msgid "Lazarus Desktop Settings" -msgstr "Настройки рабочего стола Lazarus" - -#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory -msgid "Lazarus Directory" -msgstr "Каталог Lazarus" - -#: lazarusidestrconsts:lislazaruseditorv -msgid "Lazarus Editor v%s" -msgstr "Редактор Lazarus v%s" - -#: lazarusidestrconsts:lislazarusfile -msgid "Lazarus File" -msgstr "Файл Lazarus" - -#: lazarusidestrconsts:lislazarusprojectinfofile -msgid "Lazarus Project Info file" -msgstr "Файл информации о проекте Lazarus" - -#: lazarusidestrconsts:locwndsrceditor -msgid "Lazarus Source Editor" -msgstr "Редактор исходного кода Lazarus" - -#: lazarusidestrconsts:lisconfigdirectory -msgid "Lazarus config directory" -msgstr "Каталог конфигурации Lazarus" - -#: lazarusidestrconsts:lislazarusdirectory -msgid "Lazarus directory" -msgstr "Каталог Lazarus" - -#: lazarusidestrconsts:dlglazarusdir -msgid "Lazarus directory (default for all projects)" -msgstr "Каталог Lazarus (общий для всех проектов)" - -#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg -msgid "Lazarus directory \"%s\" not found." -msgstr "Каталог Lazarus \"%s\" не найден." - -#: lazarusidestrconsts:lislazarusdirectorynotfound -msgid "Lazarus directory not found" -msgstr "Каталог Lazarus не найден" - -#: lazarusidestrconsts:lislazarusform -msgid "Lazarus form" -msgstr "Форма Lazarus'а" - -#: lazarusidestrconsts:lislazaruspackage -msgid "Lazarus package" -msgstr "Пакет Lazarus'а" - -#: lazarusidestrconsts:lislazarusproject -msgid "Lazarus project" -msgstr "Проект Lazarus'а" - -#: lazarusidestrconsts:lislazarusprojectsource -msgid "Lazarus project source" -msgstr "Исходный код проета" - -#: lazarusidestrconsts:lislazarusunit -msgid "Lazarus unit" -msgstr "Модуль Lazarus'а" - -#: lazarusidestrconsts:lisleaveemptyfo -msgid "Leave empty for default .po file" -msgstr "Оставьте пустым для файла .po по умолчанию" - -#: lazarusidestrconsts:srvk_left -msgid "Left" -msgstr "Влево" - -#: lazarusidestrconsts:lisleftsides -msgid "Left sides" -msgstr "Левые края" - -#: lazarusidestrconsts:lisleftspaceequally -msgid "Left space equally" -msgstr "" - -#: lazarusidestrconsts:dlgleftpos -msgid "Left:" -msgstr "Слева:" - -#: lazarusidestrconsts:dlglevelnoneopt -msgid "Level 0 (no extra Optimizations)" -msgstr "Уровень 0 (без особой оптимизации)" - -#: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Уровень 1 (быстрая)" - -#: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Уровень 2 (уровень 1 + более медленная)" - -#: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Уровень 3 (уровень 3 + нестандартная)" - -#: lazarusidestrconsts:dlgcolibraries -msgid "Libraries (-Fl):" -msgstr "Библиотеки (-Fl):" - -#: lazarusidestrconsts:lispckoptslibrary -msgid "Library" -msgstr "Библиотека" - -#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin -msgid "Library%sA freepascal library (.dll under windows, .so under linux, .so under macosx). The library source file is automatically maintained by Lazarus." -msgstr "" - -#: lazarusidestrconsts:lispckoptslicense -msgid "License:" -msgstr "Лицензия:" - -#: lazarusidestrconsts:lisaboutlazarusmsg -msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers." -msgstr "Лицензия: GPL/LGPL%sLazarus - это библиотеки классов для FreePascal, эмулирующие Delphi. FreePascal - это (L)GPL'ьный компилятор, работающий под Linux, Win32, OS/2, 68K и др. FreePascal разработан, чтобы разбирать и компилировать программы с синтаксисом Delphi, который, естественно, ООП.%sLazarus - недостающее звено цепи, позволяющей Вам разрабатывать программы типа Delphi на всех вышеуказанных платформах. IDE вдруг станет инструментом RAD, как Delphi.%sТ.к. проект Lazarus растёт, нам нужно больше разработчиков." - -#: lazarusidestrconsts:listodolline -msgid "Line" -msgstr "Строка" - -#: lazarusidestrconsts:dlglinesplitting -msgid "Line Splitting" -msgstr "Разрыв строк" - -#: lazarusidestrconsts:srkmeclineselect -msgid "Line selection mode" -msgstr "Режим выбора строк" - -#: lazarusidestrconsts:lissortsellines -msgid "Lines" -msgstr "Строки" - -#: lazarusidestrconsts:lisuidlines -msgid "Lines:" -msgstr "" - -#: lazarusidestrconsts:dlglinksmart -msgid "Link Smart" -msgstr "Умное связывание" - -#: lazarusidestrconsts:dlglinklibraries -msgid "Link Style:" -msgstr "Стиль сборки:" - -#: lazarusidestrconsts:lispckoptslinker -msgid "Linker" -msgstr "Линкер" - -#: lazarusidestrconsts:dlgcolinking -msgid "Linking" -msgstr "Связывание" - -#: lazarusidestrconsts:dlgloaddfile -msgid "Load desktop settings from file" -msgstr "Загр. рабочий стол из файла" - -#: lazarusidestrconsts:dlgcoloadsave -msgid "Load/Save" -msgstr "Загрузка/сохранение" - -#: lazarusidestrconsts:lispckexplloadedpackages -msgid "Loaded Packages:" -msgstr "Загруженные пакеты:" - -#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage -msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" -msgstr "Загрузка пакета %s заменит пакет %s%sиз файла %s.%sСтарый пакет изменён. Сохранить старый пакет %s?" - -#: lazarusidestrconsts:dlgrunolocal -msgid "Local" -msgstr "Локальные" - -#: lazarusidestrconsts:lismenuviewlocalvariables -msgid "Local Variables" -msgstr "Локальные переменные" - -#: lazarusidestrconsts:lismenulowercaseselection -msgid "Lowercase selection" -msgstr "Нижний регистр выделения" - -#: lazarusidestrconsts:dlg1up2low -msgid "Lowercase, first letter up" -msgstr "Только 1я буква заглавная" - -#: lazarusidestrconsts:lisedtexttoolmacros -msgid "Macros" -msgstr "Макросы" - -#: lazarusidestrconsts:dlgmainmenu -msgid "Main Menu" -msgstr "Главное меню" - -#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements -msgid "Main Unit has Application.CreateForm statements" -msgstr "Главный модуль имеет выражения Application.CreateForm" - -#: lazarusidestrconsts:lismainunithasapplicationtitlestatements -msgid "Main Unit has Application.Title statements" -msgstr "Главный модуль имеет выражение Application.Title" - -#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject -msgid "Main Unit has Uses Section containing all Units of project" -msgstr "Главный модуль имеет секцию uses, включающую все модули проекта" - -#: lazarusidestrconsts:lismainunitispascalsource -msgid "Main Unit is Pascal Source" -msgstr "Главный модуль - исходник Паскаля" - -#: lazarusidestrconsts:lispckoptsmajor -msgid "Major" -msgstr "Главная" - -#: lazarusidestrconsts:lismakeexe -msgid "Make Executable" -msgstr "Создать исполняемый" - -#: lazarusidestrconsts:lismenumakeresourcestring -msgid "Make Resource String" -msgstr "Создать строку ресурсов" - -#: lazarusidestrconsts:lismakeresourcestring -msgid "Make ResourceString" -msgstr "Создать строку ресурсов" - -#: lazarusidestrconsts:lismakenotfound -msgid "Make not found" -msgstr "Не найден Make" - -#: lazarusidestrconsts:dlgmakepath -msgid "Make path" -msgstr "Путь к Make" - -#: lazarusidestrconsts:srkmecmakeresourcestring -msgid "Make resource string" -msgstr "Создать строку ресурсов" - -#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically -msgid "Manual compilation (never automatically)" -msgstr "Ручная компиляция (не автоматически)" - -#: lazarusidestrconsts:dlgmargingutter -msgid "Margin and gutter" -msgstr "Границы" - -#: lazarusidestrconsts:dlgmarkercolor -msgid "Marker color" -msgstr "Цвет маркера" - -#: lazarusidestrconsts:lissmatches -msgid "Matches" -msgstr "" - -#: lazarusidestrconsts:dlgmaxlinelength -msgid "Max line length:" -msgstr "max длина строки:" - -#: lazarusidestrconsts:dlgmaxrecentfiles -msgid "Max recent files" -msgstr "Предел недавних файлов" - -#: lazarusidestrconsts:dlgmaxrecentprojs -msgid "Max recent project files" -msgstr "Предел недавних проектов" - -#: lazarusidestrconsts:lisexttoolmaximumtoolsreached -msgid "Maximum Tools reached" -msgstr "Достигнут предел инструментов" - -#: lazarusidestrconsts:lisprojaddmaximumversionoptional -msgid "Maximum Version (optional):" -msgstr "Макс. версия (по выбору):" - -#: lazarusidestrconsts:lispckeditmaximumversion -msgid "Maximum Version:" -msgstr "Макс. версия" - -#: lazarusidestrconsts:dlgmaxcntr -msgid "Maximum counter" -msgstr "Максимальный счетчик" - -#: lazarusidestrconsts:srvk_menu -msgid "Menu" -msgstr "Меню" - -#: lazarusidestrconsts:lismenueditormenueditor -msgid "Menu Editor" -msgstr "Редактор меню" - -#: lazarusidestrconsts:lismenuviewmessages -msgid "Messages" -msgstr "Сообщения..." - -#: lazarusidestrconsts:dlgmethodinspolicy -msgid "Method insert policy" -msgstr "Политика вставки методов" - -#: lazarusidestrconsts:dlgminimizeallonminimizemain -msgid "Minimize all on minimize main" -msgstr "Минимизировать все при минимизации главной" - -#: lazarusidestrconsts:lisprojaddminimumversionoptional -msgid "Minimum Version (optional):" -msgstr "Миним. версия (по выбору):" - -#: lazarusidestrconsts:lispckeditminimumversion -msgid "Minimum Version:" -msgstr "Миним. версия:" - -#: lazarusidestrconsts:lispckoptsminor -msgid "Minor" -msgstr "Вторичная" - -#: lazarusidestrconsts:fdmmirrorhorizontal -msgid "Mirror horizontal" -msgstr "Отразить по горизонтали" - -#: lazarusidestrconsts:fdmmirrorvertical -msgid "Mirror vertical" -msgstr "Отразить по вертикали" - -#: lazarusidestrconsts:dlgenvmisc -msgid "Miscellaneous" -msgstr "Разное" - -#: lazarusidestrconsts:lismissingpackages -msgid "Missing Packages" -msgstr "Отсутствующие пакеты" - -#: lazarusidestrconsts:dlgmixmethodsandproperties -msgid "Mix methods and properties" -msgstr "Смешивать методы и свойства" - -#: lazarusidestrconsts:srvk_modechange -msgid "Mode Change" -msgstr "Сменить режим" - -#: lazarusidestrconsts:uemodified -msgid "Modified" -msgstr "Изменён" - -#: lazarusidestrconsts:lispckeditmodified -msgid "Modified: %s" -msgstr "Изменён: %s" - -#: lazarusidestrconsts:lispckeditmore -msgid "More ..." -msgstr "Больше..." - -#: lazarusidestrconsts:srvk_lbutton -msgid "Mouse Button Left" -msgstr "Левая кнопка мыши" - -#: lazarusidestrconsts:srvk_mbutton -msgid "Mouse Button Middle" -msgstr "Средняя кнопка мыши" - -#: lazarusidestrconsts:srvk_rbutton -msgid "Mouse Button Right" -msgstr "Правая кнопка мыши" - -#: lazarusidestrconsts:dlgmouselinks -msgid "Mouse links" -msgstr "Ссылки мыши" - -#: lazarusidestrconsts:lisexttoolmovedown -msgid "Move Down" -msgstr "Сдвинуть вниз" - -#: lazarusidestrconsts:lismenueditormovedown -msgid "Move Down (or right)" -msgstr "Переместить вниз (или вправо)" - -#: lazarusidestrconsts:uemmoveeditorleft -msgid "Move Editor Left" -msgstr "Подвинуть страницу влево" - -#: lazarusidestrconsts:uemmoveeditorright -msgid "Move Editor Right" -msgstr "Подвинуть страницу вправо" - -#: lazarusidestrconsts:lisexttoolmoveup -msgid "Move Up" -msgstr "Вверх" - -#: lazarusidestrconsts:lismenueditormoveup -msgid "Move Up (or left)" -msgstr "Переместить вверх (или влево)" - -#: lazarusidestrconsts:lisdsgorderbackone -msgid "Move component one back" -msgstr "Передвинуть через один компонент назад" - -#: lazarusidestrconsts:lisdsgorderforwardone -msgid "Move component one forward" -msgstr "Передвинуть через один компонент вперёд" - -#: lazarusidestrconsts:lisdsgordermovetoback -msgid "Move component to back" -msgstr "Передвинуть компонент назад" - -#: lazarusidestrconsts:lisdsgordermovetofront -msgid "Move component to front" -msgstr "Передвинуть компонент вперёд" - -#: lazarusidestrconsts:srkmecpagedown -msgid "Move cursor down one page" -msgstr "Переместить курсор вниз на 1 страницу" - -#: lazarusidestrconsts:srkmecpageleft -msgid "Move cursor left one page" -msgstr "Переместить курсор влево на 1 страницу" - -#: lazarusidestrconsts:srkmecpageright -msgid "Move cursor right one page" -msgstr "Переместить курсор вправо на 1 страницу" - -#: lazarusidestrconsts:srkmeceditortop -msgid "Move cursor to absolute beginning" -msgstr "Переместить курсор в самое начало" - -#: lazarusidestrconsts:srkmeceditorbottom -msgid "Move cursor to absolute end" -msgstr "Переместить курсор в самый конец" - -#: lazarusidestrconsts:srkmecpagebottom -msgid "Move cursor to bottom of page" -msgstr "Переместить курсор в конец страницы" - -#: lazarusidestrconsts:srkmeclineend -msgid "Move cursor to line end" -msgstr "Переместить курсор в конец строки" - -#: lazarusidestrconsts:srkmeclinestart -msgid "Move cursor to line start" -msgstr "Переместить курсор в начало строки" - -#: lazarusidestrconsts:srkmecpagetop -msgid "Move cursor to top of page" -msgstr "Переместить курсор в начало страницы" - -#: lazarusidestrconsts:srkmecpageup -msgid "Move cursor up one page" -msgstr "Переместить курсор вверх на одну страницу" - -#: lazarusidestrconsts:srkmecwordleft -msgid "Move cursor word left" -msgstr "Переместить курсор на слово влево" - -#: lazarusidestrconsts:srkmecwordright -msgid "Move cursor word right" -msgstr "Переместить курсор на слово вправо" - -#: lazarusidestrconsts:lispckeditmovedependencydown -msgid "Move dependency down" -msgstr "Зависимость - вниз" - -#: lazarusidestrconsts:lispckeditmovedependencyup -msgid "Move dependency up" -msgstr "Зависимость вверх" - -#: lazarusidestrconsts:srkmecmoveeditorleft -msgid "Move editor left" -msgstr "Сместить редактор влево" - -#: lazarusidestrconsts:srkmecmoveeditorright -msgid "Move editor right" -msgstr "Сместить редактор вправо" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodedown -msgid "Move node down" -msgstr "Переместить элемент вниз" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown -msgid "Move node one level down" -msgstr "Переместить элемент на уровень вниз" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup -msgid "Move node one level up" -msgstr "Переместить элемент на уровень вверх" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeup -msgid "Move node up" -msgstr "Переместить элемент вверх" - -#: lazarusidestrconsts:lispatheditmovepathdown -msgid "Move path down" -msgstr "Путь - вниз" - -#: lazarusidestrconsts:lispatheditmovepathup -msgid "Move path up" -msgstr "Путь - вверх" - -#: lazarusidestrconsts:fdmordermovetoback -msgid "Move to back" -msgstr "Передвинуть назад" - -#: lazarusidestrconsts:fdmordermovetofront -msgid "Move to front" -msgstr "Передвинуть вперёд" - -#: lazarusidestrconsts:dlgmultiline -msgid "Multi Line" -msgstr "Многострочный" - -#: lazarusidestrconsts:dlgmultiselect -msgid "Multi Select" -msgstr "" - -#: lazarusidestrconsts:fdinvalidmutliselectiontext -msgid "Multiselected components must be of a single form." -msgstr "Множественный выбор компонентов должен быть на одной форме" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal -msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "ЗАМЕТКА: Не могу создать шаблон определений из исходников FPC" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources -msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "ЗАМЕТКА: Не могу создать шаблон определений из исходников Lazarus" - -#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults -msgid "NOTE: codetools config file not found - using defaults" -msgstr "ЗАМЕТКА: файл настроек CodeTools не найден - используем умолчания" - -#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile -msgid "NOTE: loading old codetools options file: " -msgstr "ЗАМЕТКА: грузим старый файл настроек CodeTools: " - -#: lazarusidestrconsts:lisnameofnewprocedure -msgid "Name of new procedure" -msgstr "Имя новой процедуры" - -#: lazarusidestrconsts:liscodetoolsdefsname -msgid "Name:" -msgstr "Имя:" - -#: lazarusidestrconsts:dlgnaming -msgid "Naming" -msgstr "Названия" - -#: lazarusidestrconsts:lisceoneveronlymanually -msgid "Never, only manually" -msgstr "" - -#: lazarusidestrconsts:srkmecnew -msgid "New" -msgstr "Создать" - -#: lazarusidestrconsts:lismenunewother -msgid "New ..." -msgstr "Создать ..." - -#: lazarusidestrconsts:lisnewancestors -msgid "New Ancestors" -msgstr "" - -#: lazarusidestrconsts:lisnewclass -msgid "New Class" -msgstr "Новый класс" - -#: lazarusidestrconsts:lisa2pnewcomponent -msgid "New Component" -msgstr "Новый компонент" - -#: lazarusidestrconsts:lisa2pnewfile -msgid "New File" -msgstr "Новый файл" - -#: lazarusidestrconsts:lismenunewform -msgid "New Form" -msgstr "Создать форму" - -#: lazarusidestrconsts:lismenunewproject -msgid "New Project" -msgstr "Создать проект" - -#: lazarusidestrconsts:lismenunewprojectfromfile -msgid "New Project from file" -msgstr "Создать проект из файла" - -#: lazarusidestrconsts:lisprojaddnewrequirement -msgid "New Requirement" -msgstr "Новое требование" - -#: lazarusidestrconsts:lismenueditornewtemplatedescription -msgid "New Template Description..." -msgstr "Новое описание шаблона..." - -#: lazarusidestrconsts:lismenunewunit -msgid "New Unit" -msgstr "Создать модуль" - -#: lazarusidestrconsts:lisa2pnewclassname -msgid "New class name:" -msgstr "Новое имя класса:" - -#: lazarusidestrconsts:srkmecnewform -msgid "New form" -msgstr "Создать форму" - -#: lazarusidestrconsts:srkmecnewunit -msgid "New unit" -msgstr "Создать модуль" - -#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath -msgid "New unit not in unitpath" -msgstr "Новый модуль не в пути поиска" - -#: lazarusidestrconsts:liscodetoolsdefsnewnode -msgid "NewNode" -msgstr "Новый элемент" - -#: lazarusidestrconsts:lispkgmangnewpackage -msgid "NewPackage" -msgstr "Новый Пакет" - -#: lazarusidestrconsts:liscodetoolsoptsnewline -msgid "Newline" -msgstr "Новая строка" - -#: lazarusidestrconsts:srvk_next -msgid "Next" -msgstr "Следующий" - -#: lazarusidestrconsts:srkmecnextbookmark -msgid "Next Bookmark" -msgstr "" - -#: lazarusidestrconsts:lisnoresourcestringsectionfound -msgid "No ResourceString Section found" -msgstr "Не найдено секции ResourceString" - -#: lazarusidestrconsts:lisnostringconstantfound -msgid "No String Constant Found" -msgstr "Не найдено строковой константы" - -#: lazarusidestrconsts:lisnochange -msgid "No change" -msgstr "Без изменений" - -#: lazarusidestrconsts:lisnocodeselected -msgid "No code selected" -msgstr "Не выбрано кода" - -#: lazarusidestrconsts:lisnocompileroptionsinherited -msgid "No compiler options inherited." -msgstr "Не унаследовано параметров компилятора." - -#: lazarusidestrconsts:lisdbgmangnodebuggerspecified -msgid "No debugger specified" -msgstr "" - -#: lazarusidestrconsts:dlgednoerr -msgid "No errors in key mapping found." -msgstr "Не найдено ошибок раскладок." - -#: lazarusidestrconsts:lisnewdlgnoitemselected -msgid "No item selected" -msgstr "Не выделено элементов" - -#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting -msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." -msgstr "Не найдено пакета для зависимости %s%s%s.%sВыберите существующий пакет." - -#: lazarusidestrconsts:lisoipnopackageselected -msgid "No package selected" -msgstr "Не выбрано пакетов" - -#: lazarusidestrconsts:lisnoprogramfilesfound -msgid "No program file %s%s%s found." -msgstr "Файла программы %s%s%s не найдено." - -#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly -msgid "Node and its children are only valid for this project" -msgstr "Элемент и его \"потомки\" доступны только для этого проекта" - -#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly -msgid "Node is readonly" -msgstr "Элемент только для чтения" - -#: lazarusidestrconsts:srvk_nonconvert -msgid "Nonconvert" -msgstr "Без конвертации" - -#: lazarusidestrconsts:dlgenvnone -msgid "None" -msgstr "Нет" - -#: lazarusidestrconsts:dlgconormal -msgid "Normal Code" -msgstr "Нормальный код" - -#: lazarusidestrconsts:srkmecnormalselect -msgid "Normal selection mode" -msgstr "Нормальный режим выбора" - -#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta -msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" -msgstr "" - -#: lazarusidestrconsts:lisnotadelphiproject -msgid "Not a Delphi project" -msgstr "Не проект Delphi" - -#: lazarusidestrconsts:lisnotadelphiunit -msgid "Not a Delphi unit" -msgstr "Не модуль Delphi" - -#: lazarusidestrconsts:lisuenotfound -msgid "Not found" -msgstr "Не найден" - -#: lazarusidestrconsts:uenotimplcap -msgid "Not implemented yet" -msgstr "Еще не реализовано" - -#: lazarusidestrconsts:lisnotnow -msgid "Not now" -msgstr "Не сейчас" - -#: lazarusidestrconsts:dlgenvbackuphelpnote -msgid "Notes: Project files are all files in the project directory" -msgstr "Внимание, файлы проекта - все файлы в его каталоге" - -#: lazarusidestrconsts:liscodetoolsoptsnumber -msgid "Number" -msgstr "Число" - -#: lazarusidestrconsts:srvk_numlock -msgid "Numlock" -msgstr "NumLock" - -#: lazarusidestrconsts:srvk_numpad -msgid "Numpad %d" -msgstr "%d цифровой клавиатуры" - -#: lazarusidestrconsts:uepovr -msgid "OVR" -msgstr "ЗАМ" - -#: lazarusidestrconsts:lispckoptsobject -msgid "Object" -msgstr "Объект" - -#: lazarusidestrconsts:lismenuviewobjectinspector -msgid "Object Inspector" -msgstr "Инспектор объектов" - -#: lazarusidestrconsts:lisokbtn -msgid "Ok" -msgstr "ОК" - -#: lazarusidestrconsts:lisoldancestors -msgid "Old Ancestors" -msgstr "" - -#: lazarusidestrconsts:lisoldclass -msgid "Old Class" -msgstr "Старый класс" - -#: lazarusidestrconsts:lisceoonidle -msgid "On idle" -msgstr "" - -#: lazarusidestrconsts:lismenuonlinehelp -msgid "Online Help" -msgstr "Справка On-line" - -#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented -msgid "Online Help not yet implemented" -msgstr "Контекстная справка ещё не реализована" - -#: lazarusidestrconsts:lisonlysearchforwholewords -msgid "Only search for whole words" -msgstr "Поиск только целых слов" - -#: lazarusidestrconsts:lisdiffdlgonlyselection -msgid "Only selection" -msgstr "Только выбранное" - -#: lazarusidestrconsts:lisfindfileonlytextfiles -msgid "Only text files" -msgstr "Только текстовые файлы" - -#: lazarusidestrconsts:lismenuopen -msgid "Open" -msgstr "Открыть" - -#: lazarusidestrconsts:lisopenlfm -msgid "Open %s" -msgstr "" - -#: lazarusidestrconsts:lisdiffdlgopendiffineditor -msgid "Open Diff in editor" -msgstr "Откр. Diff в редакторе" - -#: lazarusidestrconsts:lisopenpackagefile -msgid "Open Package File" -msgstr "Открыть файл пакета" - -#: lazarusidestrconsts:lisopenpackage -msgid "Open Package?" -msgstr "Открыть пакет?" - -#: lazarusidestrconsts:lisctdefsopenpreview -msgid "Open Preview" -msgstr "Открыть предпросмотр" - -#: lazarusidestrconsts:lismenuopenproject -msgid "Open Project" -msgstr "Открыть проект" - -#: lazarusidestrconsts:lisopenprojectfile -msgid "Open Project File" -msgstr "Открыть проект" - -#: lazarusidestrconsts:lisopenproject -msgid "Open Project?" -msgstr "Открыть проект?" - -#: lazarusidestrconsts:lismenuopenrecent -msgid "Open Recent" -msgstr "Открыть недавнее" - -#: lazarusidestrconsts:lismenuopenrecentproject -msgid "Open Recent Project" -msgstr "Открыть недавний проект" - -#: lazarusidestrconsts:lisopenastextfile -msgid "Open as text file" -msgstr "" - -#: lazarusidestrconsts:lisopenfile -msgid "Open file" -msgstr "Открыть файл" - -#: lazarusidestrconsts:srkmecopenfileatcursor -msgid "Open file at cursor" -msgstr "Открыть файл у курсора" - -#: lazarusidestrconsts:lismenuopenfilenameatcursor -msgid "Open filename at cursor" -msgstr "Открыть имя файла под курсором" - -#: lazarusidestrconsts:dlgqopenlastprj -msgid "Open last project at start" -msgstr "Грузить последний проект при пуске" - -#: lazarusidestrconsts:lismenuopenpackage -msgid "Open loaded package" -msgstr "Открыть загруженный пакет" - -#: lazarusidestrconsts:liscomppalopenpackage -msgid "Open package" -msgstr "Открыть пакет" - -#: lazarusidestrconsts:lismenuopenpackagefile -msgid "Open package file (.lpk)" -msgstr "Открыть файл пакета (.lpk)" - -#: lazarusidestrconsts:lismenuopenpackageofcurunit -msgid "Open package of current unit" -msgstr "Открыть пакет текущего модуля" - -#: lazarusidestrconsts:lisopenproject2 -msgid "Open project" -msgstr "" - -#: lazarusidestrconsts:lisopenprojectagain -msgid "Open project again" -msgstr "" - -#: lazarusidestrconsts:lismenuopenrecentpkg -msgid "Open recent package" -msgstr "Открыть недавний пакет" - -#: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile -msgid "Open the package %s?%sAnswer No to load it as xml file." -msgstr "Открыть пакет %s?%s Ответьте Нет, чтобы загрузить его как xml." - -#: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile -msgid "Open the project %s?%sAnswer No to load it as xml file." -msgstr "Открыть проект %s?%s Ответьте Нет, чтобы загрузить его как xml." - -#: lazarusidestrconsts:liscomppalopenunit -msgid "Open unit" -msgstr "Открыть модуль" - -#: lazarusidestrconsts:dlgoptimiz -msgid "Optimizations:" -msgstr "Оптимизация:" - -#: lazarusidestrconsts:fdmsnaptogridoption -msgid "Option: Snap to grid" -msgstr "Параметр: Выровнять по сетке" - -#: lazarusidestrconsts:fdmsnaptoguidelinesoption -msgid "Option: Snap to guide lines" -msgstr "Параметр: Выровнять по линиям помощи" - -#: lazarusidestrconsts:dlgfropts -msgid "Options" -msgstr "Параметры" - -#: lazarusidestrconsts:lislazbuildoptions -msgid "Options:" -msgstr "Параметры:" - -#: lazarusidestrconsts:dlgcoopts -msgid "Options: " -msgstr "Параметры: " - -#: lazarusidestrconsts:fdmorder -msgid "Order" -msgstr "" - -#: lazarusidestrconsts:dlgsrorigin -msgid "Origin" -msgstr "Начинать" - -#: lazarusidestrconsts:dlgcoother -msgid "Other" -msgstr "Другое" - -#: lazarusidestrconsts:dlgcosources -msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" -msgstr "Другие исходники (.pp/.pas files, нужны только IDE, не компилятору)" - -#: lazarusidestrconsts:dlgotherunitfiles -msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" -msgstr "Другие модули (-Fu) (разделитель точка с запятой):" - -#: lazarusidestrconsts:dlgenvotherfiles -msgid "Other files" -msgstr "Др. файлы" - -#: lazarusidestrconsts:dlgpooutputsettings -msgid "Output Settings" -msgstr "Параметры вывода" - -#: lazarusidestrconsts:lispkgdefsoutputdirectory -msgid "Output directory" -msgstr "Каталог сохранений" - -#: lazarusidestrconsts:dlgcooverflow -msgid "Overflow" -msgstr "Переполнения" - -#: lazarusidestrconsts:lisoverridelanguage -msgid "Override language. For example --language=de. For possible values see files in the languages directory." -msgstr "" - -#: lazarusidestrconsts:lissvuooverridesystemvariable -msgid "Override system variable" -msgstr "Перекрыть системную переменную" - -#: lazarusidestrconsts:srkmecoverwritemode -msgid "Overwrite Mode" -msgstr "Режим замены" - -#: lazarusidestrconsts:lisoverwritefileondisk -msgid "Overwrite file on disk" -msgstr "" - -#: lazarusidestrconsts:lisoverwritefile -msgid "Overwrite file?" -msgstr "Переписать файл?" - -#: lazarusidestrconsts:lispackage -msgid "Package" -msgstr "Пакет" - -#: lazarusidestrconsts:lispckeditpackage -msgid "Package %s" -msgstr "Пакет %s" - -#: lazarusidestrconsts:lispckexplpackagenotfound -msgid "Package %s not found" -msgstr "Пакет %s не найден" - -#: lazarusidestrconsts:lispkgmangpackagechangedsave -msgid "Package %s%s%s changed. Save?" -msgstr "Пакет %s%s%s изменён. Сохранить?" - -#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage -msgid "Package %s%s%s has changed.%sSave package?" -msgstr "Пакет %s%s%s изменён.%s Сохранить пакет?" - -#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory -msgid "Package %s%s%s has no valid output directory:%s%s%s%s" -msgstr "Пакет %s%s%s не имеет правильного каталога сохранений:%s%s%s%s" - -#: lazarusidestrconsts:lisaf2ppackagenotfound -msgid "Package %s%s%s not found." -msgstr "Пакет %s%s%s не найден" - -#: lazarusidestrconsts:lismenupackagegraph -msgid "Package Graph" -msgstr "Диаграмма пакетов" - -#: lazarusidestrconsts:lisoippackagename -msgid "Package Name" -msgstr "Имя пакета" - -#: lazarusidestrconsts:lisprojaddpackagename -msgid "Package Name:" -msgstr "Имя пакета:" - -#: lazarusidestrconsts:lispckoptspackageoptions -msgid "Package Options" -msgstr "Параметры пакета" - -#: lazarusidestrconsts:lispkgdefssrcdirmark -msgid "Package Source Directory Mark" -msgstr "Метка каталога исходника пакета" - -#: lazarusidestrconsts:lispkgmangpackageconflicts -msgid "Package conflicts" -msgstr "Конфликты пакетов" - -#: lazarusidestrconsts:lispkgsyspackagefilenotfound -msgid "Package file not found" -msgstr "Файл пакета не найден" - -#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage -msgid "Package is no designtime package" -msgstr "Пакет - не пакет разработки" - -#: lazarusidestrconsts:lisaf2ppackageisreadonly -msgid "Package is read only" -msgstr "Пакет только для чтения" - -#: lazarusidestrconsts:lispkgmangpackageisrequired -msgid "Package is required" -msgstr "Требуется пакет" - -#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists -msgid "Package name already exists" -msgstr "Имя пакета уже занято" - -#: lazarusidestrconsts:lispackageneedsinstallation -msgid "Package needs installation" -msgstr "Пакет требует установки" - -#: lazarusidestrconsts:lisprojaddpackagenotfound -msgid "Package not found" -msgstr "Пакет не найден" - -#: lazarusidestrconsts:lispkgmangpackage -msgid "Package: %s" -msgstr "Пакет: %s" - -#: lazarusidestrconsts:lispckoptspackagetype -msgid "PackageType" -msgstr "Тип пакета" - -#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk -msgid "Packages must have the extension .lpk" -msgstr "Пакеты должны иметь расширение .lpk" - -#: lazarusidestrconsts:lispackagestoinstallintheide -msgid "Packages to install in the IDE" -msgstr "Пакеты для установки в IDE" - -#: lazarusidestrconsts:lisa2ppagenametoolong -msgid "Page Name too long" -msgstr "Имя страницы слишком длинное" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu -msgid "Paint designer items only on idle (reduce overhead for slow computers)" -msgstr "Рисовать элементы дизайнеров только в паузах (уменьшает нагрузку на медленных машинах)" - -#: lazarusidestrconsts:lisa2ppalettepage -msgid "Palette Page:" -msgstr "Страница палитры:" - -#: lazarusidestrconsts:lissortselparagraphs -msgid "Paragraphs" -msgstr "Абзацы" - -#: lazarusidestrconsts:liscmparameter -msgid "Parameter" -msgstr "" - -#: lazarusidestrconsts:lisedtexttoolparameters -msgid "Parameters:" -msgstr "Параметры:" - -#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch -msgid "Parent node can not contain child nodes." -msgstr "Родительский элемент не может содержать дочерних." - -#: lazarusidestrconsts:dlgcoparsing -msgid "Parsing" -msgstr "Обработка" - -#: lazarusidestrconsts:lispascalsourcefile -msgid "Pascal source file" -msgstr "Исходный файл Pascal" - -#: lazarusidestrconsts:lispascalunit -msgid "Pascal unit" -msgstr "Модуль Pascal" - -#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas -msgid "Pascal units must have the extension .pp or .pas" -msgstr "Модули паскаля должны иметь расширение .pp или .pas" - -#: lazarusidestrconsts:dlgpassoptslinker -msgid "Pass Options To The Linker (Delimiter is space)" -msgstr "Передать опции линкеру (отделять пробелами)" - -#: lazarusidestrconsts:lismenupaste -msgid "Paste" -msgstr "Вставить" - -#: lazarusidestrconsts:srkmecpaste -msgid "Paste clipboard to current position" -msgstr "Вставить из буфера в текущую позицию" - -#: lazarusidestrconsts:lisdsgpastecomponents -msgid "Paste selected components from clipboard" -msgstr "Вставить выбранные компоненты из буфера" - -#: lazarusidestrconsts:lispatheditpathtemplates -msgid "Path templates" -msgstr "Шаблоны пути" - -#: lazarusidestrconsts:listofpcpath -msgid "Path:" -msgstr "Путь:" - -#: lazarusidestrconsts:dlgsearchpaths -msgid "Paths" -msgstr "Пути" - -#: lazarusidestrconsts:lisuidpathsreadonly -msgid "Paths (Read Only)" -msgstr "Пути (только чтение)" - -#: lazarusidestrconsts:lismenupause -msgid "Pause" -msgstr "Пауза" - -#: lazarusidestrconsts:srvk_pause -msgid "Pause key" -msgstr "Клавиша Pause" - -#: lazarusidestrconsts:dlgpersistentcaret -msgid "Persistent caret" -msgstr "Неподвижный курсор" - -#: lazarusidestrconsts:lisplzcheckthecompilername -msgid "Please check the compiler name" -msgstr "Проверьте имя компилятора" - -#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory -msgid "Please check the freepascal source directory" -msgstr "Проверьте каталог исходников FreePascal" - -#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring -msgid "Please choose a resourstring section from the list." -msgstr "Выберите секцию resourcestring из списка." - -#: lazarusidestrconsts:lispleaseopenaunitbeforerun -msgid "Please open a unit before run." -msgstr "Откройте модуль перед запуском." - -#: lazarusidestrconsts:srkmpresskey -msgid "Please press a key ..." -msgstr "Нажмите любую клавишу..." - -#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage -msgid "Please save the file before adding it to a package." -msgstr "Сохраните файл перед добавлением в пакет." - -#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst -msgid "Please save the package first." -msgstr "Пожалуйста сохраните сначала пакет" - -#: lazarusidestrconsts:lisoippleaseselectapackage -msgid "Please select a package" -msgstr "Выберите пакет" - -#: lazarusidestrconsts:lisoippleaseselectapackagetoopen -msgid "Please select a package to open" -msgstr "Выберите пакет, чтобы открыть" - -#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst -msgid "Please select an item first." -msgstr "Выберите сначала элемент" - -#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod -msgid "Please select some code to extract a new procedure/method." -msgstr "Выделите некоторый код, чтобы извлечь новую процедуру/метод." - -#: lazarusidestrconsts:liscodetoolsoptspoint -msgid "Point" -msgstr "Точка" - -#: lazarusidestrconsts:rslanguagepolish -msgid "Polish" -msgstr "Польский" - -#: lazarusidestrconsts:rslanguagepolishwin -msgid "Polish(CP1250)" -msgstr "Польский(CP1250)" - -#: lazarusidestrconsts:rslanguagepolishiso -msgid "Polish(ISO 8859-2)" -msgstr "Польский(ISO 8859-2)" - -#: lazarusidestrconsts:rslanguageportugues -msgid "Portuguese" -msgstr "" - -#: lazarusidestrconsts:dlgwrdpreview -msgid "Preview" -msgstr "Предпросмотр" - -#: lazarusidestrconsts:dlgcdtpreview -msgid "Preview (Max line length = 1)" -msgstr "Предпросмотр(max длина=1)" - -#: lazarusidestrconsts:srkmecprevbookmark -msgid "Previous Bookmark" -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes -msgid "Previous node can not contain child nodes." -msgstr "Предыдущий элемент не может содержать дочерних." - -#: lazarusidestrconsts:srvk_print -msgid "Print" -msgstr "Печать" - -#: lazarusidestrconsts:listodolistprintlist -msgid "Print todo items" -msgstr "Распечатать элементы todo" - -#: lazarusidestrconsts:srvk_prior -msgid "Prior" -msgstr "Перед" - -#: lazarusidestrconsts:lisprivatemethod -msgid "Private Method" -msgstr "Скрытый метод" - -#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti -msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "Возможно вам нужно сначала проинсталлировать несколько пакетов.%s%sВнимание:%s Проект зависит от нескольких пакетов, которые содержат модули с зарегистрированной процедурой. Зарегистрированная процедура обычно используется для инсталляции компонентов в IDE. Но эти модули принадлежат пакетам, которые ещё не проинсталлированы в IDE. Если вы попытаетесь открыть форму, которая использует эти компоненты, вы получите сообщение о потерянных компонентах и загрузка формы может создать не очень хорошие результаты.%s%sЭто не имеет никакого воздействия на открытие проекта или любого из его исходников.%s%sЭто только означает то, что это плохая идея редактировать такие формы, перед инсталляцией потерянных компонентов.%s%s" - -#: lazarusidestrconsts:lisprocedure -msgid "Procedure" -msgstr "Процедура" - -#: lazarusidestrconsts:dlgforwardprocsinsertpolicy -msgid "Procedure insert policy" -msgstr "Политика вставки процедур" - -#: lazarusidestrconsts:lisprocedurewithinterface -msgid "Procedure with interface" -msgstr "Процедура с интерфейсом" - -#: lazarusidestrconsts:lisprogram -msgid "Program" -msgstr "Программа" - -#: lazarusidestrconsts:lisprogramdetected -msgid "Program detected" -msgstr "Обнаружена программа" - -#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp -msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "Исходник программы должен иметь расширение паскаля, напр. .pas, .pp или .lpr" - -#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic -msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "Программа%sПрограмма freepascal. Файл программы автоматически поддерживается lazarus." - -#: lazarusidestrconsts:lisedtexttoolprogramfilename -msgid "Programfilename:" -msgstr "Имя файла программы:" - -#: lazarusidestrconsts:lispdprogress -msgid "Progress" -msgstr "" - -#: lazarusidestrconsts:dlgenvproject -msgid "Project" -msgstr "Проект" - -#: lazarusidestrconsts:lisprojectsuccessfullybuilt -msgid "Project %s%s%s successfully built. :)" -msgstr "Проект %s%s%s успешно собран. :)" - -#: lazarusidestrconsts:lisedtdefprojectincpath -msgid "Project IncPath" -msgstr "Путь вкл.проекта" - -#: lazarusidestrconsts:lisprojectincpath -msgid "Project Include Path" -msgstr "Пути включений проекта" - -#: lazarusidestrconsts:lisprojectinformation -msgid "Project Information" -msgstr "" - -#: lazarusidestrconsts:lismenuprojectinspector -msgid "Project Inspector" -msgstr "Инспектор проекта" - -#: lazarusidestrconsts:lisprojinspprojectinspector -msgid "Project Inspector - %s" -msgstr "Инспектор проекта - %s" - -#: lazarusidestrconsts:dlgprojectoptions -msgid "Project Options" -msgstr "Параметры проекта" - -#: lazarusidestrconsts:lismenuprojectoptions -msgid "Project Options..." -msgstr "Параметры проекта..." - -#: lazarusidestrconsts:lisprojprojectsourcedirectorymark -msgid "Project Source Directory Mark" -msgstr "" - -#: lazarusidestrconsts:lisprojectsrcpath -msgid "Project Src Path" -msgstr "Путь исходников проекта" - -#: lazarusidestrconsts:lisedtdefprojectsrcpath -msgid "Project SrcPath" -msgstr "Путь исх. проекта" - -#: lazarusidestrconsts:lisprojectunitpath -msgid "Project Unit Path" -msgstr "Путь модулей проекта" - -#: lazarusidestrconsts:lisedtdefprojectunitpath -msgid "Project UnitPath" -msgstr "Путь модулей проекта" - -#: lazarusidestrconsts:lisprojectchanged -msgid "Project changed" -msgstr "Проект изменен" - -#: lazarusidestrconsts:lisprojectdirectory -msgid "Project directory" -msgstr "Имя каталога проекта" - -#: lazarusidestrconsts:lisprojectfilename -msgid "Project filename" -msgstr "Имя файла проекта" - -#: lazarusidestrconsts:dlgprojfiles -msgid "Project files" -msgstr "Файлы проекта" - -#: lazarusidestrconsts:lisprojectinfofiledetected -msgid "Project info file detected" -msgstr "Обнаружен файл сведений проекта" - -#: lazarusidestrconsts:lisprojectisrunnable -msgid "Project is runnable" -msgstr "Проект запускаемый" - -#: lazarusidestrconsts:lisprojectmakroproperties -msgid "Project makro properties" -msgstr "" - -#: lazarusidestrconsts:srkmcatprojectmenu -msgid "Project menu commands" -msgstr "Команды меню Проект" - -#: lazarusidestrconsts:lispkgmangproject -msgid "Project: %s" -msgstr "Проект: %s" - -#: lazarusidestrconsts:dlgpromptonreplace -msgid "Prompt On Replace" -msgstr "Подтверждать замену" - -#: lazarusidestrconsts:lispromptforvalue -msgid "Prompt for value" -msgstr "Подсказка по значению" - -#: lazarusidestrconsts:lishlpoptsproperties -msgid "Properties:" -msgstr "Свойства:" - -#: lazarusidestrconsts:dlgpropertycompletion -msgid "Property completion" -msgstr "Завершение свойств" - -#: lazarusidestrconsts:dlgpropnamecolor -msgid "Property name" -msgstr "Имя свойства" - -#: lazarusidestrconsts:lisprotectedmethod -msgid "Protected Method" -msgstr "Защищённый метод" - -#: lazarusidestrconsts:lispublicmethod -msgid "Public Method" -msgstr "Общий метод" - -#: lazarusidestrconsts:lispkgeditpublishpackage -msgid "Publish Package" -msgstr "Опубликовать пакет" - -#: lazarusidestrconsts:lismenupublishproject -msgid "Publish Project" -msgstr "Опубликовать проект" - -#: lazarusidestrconsts:lispublishprojdir -msgid "Publish project directory" -msgstr "Каталог публикации проекта" - -#: lazarusidestrconsts:lispublishedmethod -msgid "Published Method" -msgstr "Опубликованный метод" - -#: lazarusidestrconsts:lismenuquicksyntaxcheck -msgid "Quick syntax check" -msgstr "Быстрая проверка синтаксиса" - -#: lazarusidestrconsts:lismenuquit -msgid "Quit" -msgstr "Выход" - -#: lazarusidestrconsts:dlgcorange -msgid "Range" -msgstr "Диапазона" - -#: lazarusidestrconsts:lispckeditreadddependency -msgid "Re-Add dependency" -msgstr "Обновить зависимость" - -#: lazarusidestrconsts:lispckeditreaddfile -msgid "Re-Add file" -msgstr "Обновить файл" - -#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages -msgid "Re-Compile this and all required packages?" -msgstr "Перекомпилировать" - -#: lazarusidestrconsts:lisreaderror -msgid "Read Error" -msgstr "Ошибка чтения" - -#: lazarusidestrconsts:uemreadonly -msgid "Read Only" -msgstr "Только чтение" - -#: lazarusidestrconsts:lispckeditreadonly -msgid "Read Only: %s" -msgstr "Только чтение:%s" - -#: lazarusidestrconsts:liscodetoolsdefsreaderror -msgid "Read error" -msgstr "Ошибка чтения" - -#: lazarusidestrconsts:dlgcdtreadprefix -msgid "Read prefix" -msgstr "Префикс READ" - -#: lazarusidestrconsts:uepreadonly -msgid "Readonly" -msgstr "Только чтение" - -#: lazarusidestrconsts:lispkgmangrebuildlazarus -msgid "Rebuild Lazarus?" -msgstr "Пересобрать Lazarus?" - -#: lazarusidestrconsts:lispckeditrecompileallrequired -msgid "Recompile all required" -msgstr "Требуется пересобрать все" - -#: lazarusidestrconsts:lispckeditrecompileclean -msgid "Recompile clean" -msgstr "Чистая пересборка" - -#: lazarusidestrconsts:lismenuredo -msgid "Redo" -msgstr "Вернуть" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidle -msgid "Reduce designer painting" -msgstr "Уменьшить прорисовку дизайнеров" - -#: lazarusidestrconsts:uemrefactor -msgid "Refactoring" -msgstr "Переработка кода" - -#: lazarusidestrconsts:dlgreferencecolor -msgid "Reference" -msgstr "Ссылки на объекты" - -#: lazarusidestrconsts:dlgunitdeprefresh -msgid "Refresh" -msgstr "Обновить" - -#: lazarusidestrconsts:lisceorefreshautomatically -msgid "Refresh automatically" -msgstr "" - -#: lazarusidestrconsts:listodolistrefresh -msgid "Refresh todo items" -msgstr "Обновить элементы todo" - -#: lazarusidestrconsts:lispkgsysregisterprocedureisnil -msgid "Register procedure is nil" -msgstr "Процедура регистрации пуста" - -#: lazarusidestrconsts:lispckeditregisterunit -msgid "Register unit" -msgstr "Зарегистрировать модуль" - -#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering -msgid "RegisterUnit was called, but no package is registering." -msgstr "Был вызван RegisterUnit, но пакетов не зарегистрировано." - -#: lazarusidestrconsts:lispckeditregisteredplugins -msgid "Registered plugins" -msgstr "Зарегистрированные дополнения" - -#: lazarusidestrconsts:lispkgsysregistrationerror -msgid "Registration Error" -msgstr "Ошибка регистрации" - -#: lazarusidestrconsts:dlgregularexpressions -msgid "Regular Expressions" -msgstr "Целые выражения" - -#: lazarusidestrconsts:lisfindfileregularexpressions -msgid "Regular expressions" -msgstr "Регулярное выражение" - -#: lazarusidestrconsts:lispckoptsrelease -msgid "Release" -msgstr "Релиз" - -#: lazarusidestrconsts:lisdiskdiffrevertall -msgid "Reload from disk" -msgstr "Перегрузить с диска" - -#: lazarusidestrconsts:lisexttoolremove -msgid "Remove" -msgstr "Удалить" - -#: lazarusidestrconsts:lispckeditremovedependency2 -msgid "Remove Dependency?" -msgstr "Удалить зависимость?" - -#: lazarusidestrconsts:lisremoveallinvalidproperties -msgid "Remove all invalid properties" -msgstr "Удалить все некорректные свойства" - -#: lazarusidestrconsts:lispckeditremovedependency -msgid "Remove dependency" -msgstr "Удалить зависимость" - -#: lazarusidestrconsts:lispckeditremovedependencyfrompackage -msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" -msgstr "Удалить зависимость %s%s%s%sиз пакета %s%s%s?" - -#: lazarusidestrconsts:lispckeditremovefile -msgid "Remove file" -msgstr "Удалить файл" - -#: lazarusidestrconsts:lisprojinspremovefilefromproject -msgid "Remove file %s from project?" -msgstr "Удалить файл %s из проекта?" - -#: lazarusidestrconsts:lispckeditremovefilefrompackage -msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "Удалить файл %s%s%s%s из пакета %s%s%s?" - -#: lazarusidestrconsts:lispckeditremovefile2 -msgid "Remove file?" -msgstr "Удалить файл?" - -#: lazarusidestrconsts:liscldirremovefilesmatchingfilter -msgid "Remove files matching filter" -msgstr "Удалить файлы по фильтру" - -#: lazarusidestrconsts:lismenuremovefromproject -msgid "Remove from Project" -msgstr "Удалить из проекта" - -#: lazarusidestrconsts:lisoifremovefromfavouriteproperties -msgid "Remove from favourite properties" -msgstr "Удалить из избранных свойств" - -#: lazarusidestrconsts:lisremovefromproject -msgid "Remove from project" -msgstr "Удалить из проекта" - -#: lazarusidestrconsts:lislazdocdeletepathbutton -msgid "Remove path" -msgstr "" - -#: lazarusidestrconsts:lispckeditremoveselecteditem -msgid "Remove selected item" -msgstr "Удалить выбранный элемент" - -#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile -msgid "Removed Files (these entries are not saved to the lpk file)" -msgstr "Удалённые файлы (эти элементы не сохранятся в lpk-файле)" - -#: lazarusidestrconsts:lisprojinspremovedrequiredpackages -msgid "Removed required packages" -msgstr "Удалены требуемые пакеты" - -#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved -msgid "Removed required packages (these entries are not saved to the lpk file)" -msgstr "Удалены требуемые пакеты (они не сохранятся в lpk-файле)" - -#: lazarusidestrconsts:lisfrirename -msgid "Rename" -msgstr "Переименовать" - -#: lazarusidestrconsts:lispkgmangrenamefilelowercase -msgid "Rename File lowercase?" -msgstr "Переименовать файл в нижн.рег-ре?" - -#: lazarusidestrconsts:lismenurenameidentifier -msgid "Rename Identifier" -msgstr "Переименовать ID" - -#: lazarusidestrconsts:lisfrirenameallreferences -msgid "Rename all References" -msgstr "Переименовать все ссылки" - -#: lazarusidestrconsts:lisrenamefilefailed -msgid "Rename file failed" -msgstr "Не удалось переименовать файл" - -#: lazarusidestrconsts:lispkgmangrenamefileinpackage -msgid "Rename file in package?" -msgstr "Переименовать файл в пакете?" - -#: lazarusidestrconsts:lisrenamefile -msgid "Rename file?" -msgstr "Переименовать файл?" - -#: lazarusidestrconsts:srkmecrenameidentifier -msgid "Rename identifier" -msgstr "Переименовать ID" - -#: lazarusidestrconsts:lisfrirenameto -msgid "Rename to" -msgstr "Переименовать в" - -#: lazarusidestrconsts:lisrenametolowercase -msgid "Rename to lowercase" -msgstr "" - -#: lazarusidestrconsts:lismenureplace -msgid "Replace" -msgstr "Заменить" - -#: lazarusidestrconsts:dlgreplaceall -msgid "Replace All" -msgstr "Заменить все" - -#: lazarusidestrconsts:lispkgmangreplacefile -msgid "Replace File" -msgstr "Заменить файл" - -#: lazarusidestrconsts:lispkgmangreplaceexistingfile -msgid "Replace existing file %s%s%s?" -msgstr "Заменить существующий файл %s%s%s?" - -#: lazarusidestrconsts:srkmecreplace -msgid "Replace text" -msgstr "Заменить текст" - -#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith -msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "Заменить %s%s%s%s на %s%s%s в этом месте?" - -#: lazarusidestrconsts:lisreplacingselectionfailed -msgid "Replacing selection failed." -msgstr "Перестановка выбранного текста провалилась." - -#: lazarusidestrconsts:dlgreport -msgid "Report" -msgstr "Отчет" - -#: lazarusidestrconsts:lispckeditrequiredpackages -msgid "Required Packages" -msgstr "Требуемые пакеты" - -#: lazarusidestrconsts:lismenurescanfpcsourcedirectory -msgid "Rescan FPC source directory" -msgstr "Пересмотреть каталог исходников FPC" - -#: lazarusidestrconsts:lismenuresetdebugger -msgid "Reset debugger" -msgstr "Сброс отладчика" - -#: lazarusidestrconsts:lisresourceloaderror -msgid "Resource load error" -msgstr "Ошибка загрузки ресурса" - -#: lazarusidestrconsts:lisresourcesaveerror -msgid "Resource save error" -msgstr "Ошибка сохранения ресурса" - -#: lazarusidestrconsts:lismakeresstrresourcestringsection -msgid "Resourcestring Section:" -msgstr "Секция Resourcestring:" - -#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis -msgid "Resourcestring already exists" -msgstr "Строка ресурсов уже существует" - -#: lazarusidestrconsts:lismenurestart -msgid "Restart" -msgstr "Перезапуск" - -#: lazarusidestrconsts:lislazbuildrestartafterbuild -msgid "Restart After Successfull Build" -msgstr "Перезапуск после успешной сборки" - -#: lazarusidestrconsts:rsiwprestorewindowgeometry -msgid "Restore window geometry" -msgstr "Восстановить геометрию окна" - -#: lazarusidestrconsts:rsiwprestorewindowsize -msgid "Restore window size" -msgstr "Восстановить размер окна" - -#: lazarusidestrconsts:srvk_return -msgid "Return" -msgstr "Возврат" - -#: lazarusidestrconsts:lismenurevert -msgid "Revert" -msgstr "Обратный экспорт" - -#: lazarusidestrconsts:lisrevertfailed -msgid "Revert failed" -msgstr "Обращение не удалось" - -#: lazarusidestrconsts:lispkgeditrevertpackage -msgid "Revert package?" -msgstr "Вернуть пакет?" - -#: lazarusidestrconsts:srvk_right -msgid "Right" -msgstr "Справа" - -#: lazarusidestrconsts:dlgrightclickselects -msgid "Right Click selects" -msgstr "Выбор правым щелчком" - -#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav -msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "Правый щелчок на элементе дерева даст меню со всеми доступными функциями пакета." - -#: lazarusidestrconsts:dlgrightmargin -msgid "Right margin" -msgstr "Правая граница" - -#: lazarusidestrconsts:dlgrightmargincolor -msgid "Right margin color" -msgstr "Цвет правой границы" - -#: lazarusidestrconsts:dlgrightmousemovescursor -msgid "Right mouse moves caret" -msgstr "Правая кнопка перемещает курсор" - -#: lazarusidestrconsts:lisrightsides -msgid "Right sides" -msgstr "Правые края" - -#: lazarusidestrconsts:lisrightspaceequally -msgid "Right space equally" -msgstr "" - -#: lazarusidestrconsts:dlgrubberbandgroup -msgid "Rubber band" -msgstr "Поле заметок" - -#: lazarusidestrconsts:lismenuprojectrun -msgid "Run" -msgstr "Запуск" - -#: lazarusidestrconsts:lismenurunfile -msgid "Run File" -msgstr "Запустить файл" - -#: lazarusidestrconsts:lismenurunparameters -msgid "Run Parameters ..." -msgstr "Параметры запуска ..." - -#: lazarusidestrconsts:srkmcatrunmenu -msgid "Run menu commands" -msgstr "Комаднды меню Запуск" - -#: lazarusidestrconsts:dlgrunparameters -msgid "Run parameters" -msgstr "Параметры запуска" - -#: lazarusidestrconsts:lismenuruntocursor -msgid "Run to cursor" -msgstr "Запуск до курсора" - -#: lazarusidestrconsts:lisruntofailed -msgid "Run-to failed" -msgstr "Запуск-до не удался" - -#: lazarusidestrconsts:lispckoptsruntimeonly -msgid "Runtime only" -msgstr "Времени исполнения" - -#: lazarusidestrconsts:rslanguagerussian -msgid "Russian" -msgstr "Русский" - -#: lazarusidestrconsts:rslanguagerussianwin -msgid "Russian(CP1251)" -msgstr "Русский(CP1251)" - -#: lazarusidestrconsts:lissvnrevision -msgid "SVN Revision: " -msgstr "" - -#: lazarusidestrconsts:dlgbckupsubdir -msgid "Same name (in subdirectory)" -msgstr "То же имя (в подкаталоге)" - -#: lazarusidestrconsts:lismenusave -msgid "Save" -msgstr "Сохранить" - -#: lazarusidestrconsts:lissavespace -msgid "Save " -msgstr "Сохранить " - -#: lazarusidestrconsts:lismenusaveall -msgid "Save All" -msgstr "Сохранить все" - -#: lazarusidestrconsts:lismenusaveas -msgid "Save As" -msgstr "Сохранить как" - -#: lazarusidestrconsts:dlgcharcasefileact -msgid "Save As - auto rename pascal files lower case" -msgstr "Сохранить как-автопереименовать в нижний регистр" - -#: lazarusidestrconsts:lismenueditorsaveastemplate -msgid "Save As Template..." -msgstr "Сохранить как шаблон..." - -#: lazarusidestrconsts:lispckeditsavechanges -msgid "Save Changes?" -msgstr "Сохранить изменения?" - -#: lazarusidestrconsts:lispkgmangsavepackagelpk -msgid "Save Package %s (*.lpk)" -msgstr "Сохранить пакет %s (*.lpk)" - -#: lazarusidestrconsts:lispkgmangsavepackage -msgid "Save Package?" -msgstr "Сохранить пакет?" - -#: lazarusidestrconsts:lismenusaveproject -msgid "Save Project" -msgstr "Сохранить проект" - -#: lazarusidestrconsts:lissaveprojectlpi -msgid "Save Project %s (*.lpi)" -msgstr "Сохранить прокет %s (*.lpi)" - -#: lazarusidestrconsts:lismenusaveprojectas -msgid "Save Project As..." -msgstr "Сохранить проект как..." - -#: lazarusidestrconsts:lissavesettings -msgid "Save Settings" -msgstr "" - -#: lazarusidestrconsts:lishintsaveall -msgid "Save all" -msgstr "Сохранить все" - -#: lazarusidestrconsts:lissaveallmessagestofile -msgid "Save all messages to file" -msgstr "Сохранить все сообщения в файл" - -#: lazarusidestrconsts:liscodetoolsdefssaveandexit -msgid "Save and Exit" -msgstr "Сохранить и выйти" - -#: lazarusidestrconsts:lissaveandexitdialog -msgid "Save and exit dialog" -msgstr "Сохранить и выйти из диалога" - -#: lazarusidestrconsts:lissaveandrebuildide -msgid "Save and rebuild IDE" -msgstr "Сохранить и перезапустить IDE" - -#: lazarusidestrconsts:srkmecsaveas -msgid "Save as" -msgstr "Сохранить как" - -#: lazarusidestrconsts:lissavechangestoproject -msgid "Save changes to project %s?" -msgstr "Сохранить изменения в проект %s?" - -#: lazarusidestrconsts:lissavechanges -msgid "Save changes?" -msgstr "Сохранить изменения?" - -#: lazarusidestrconsts:dlgsavedfile -msgid "Save desktop settings to file" -msgstr "Сохр. рабочий стол в файл" - -#: lazarusidestrconsts:dlgsaveeditorinfo -msgid "Save editor info for closed files" -msgstr "Сохранять сведения о закрываемых файлах" - -#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles -msgid "Save editor info of non project files" -msgstr "" - -#: lazarusidestrconsts:dlgsaveeditorinfoproject -msgid "Save editor info only for project files" -msgstr "Сохранять сведения только о файлах проекта" - -#: lazarusidestrconsts:lissavefilebeforeclosingform -msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "Сохранить файл %s%s%sперед закрытием формы %s%s%s?" - -#: lazarusidestrconsts:lisposaveinlpifil -msgid "Save in .lpi file" -msgstr "" - -#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory -msgid "Save in .lps file in project directory" -msgstr "" - -#: lazarusidestrconsts:lisposaveinideconfigdirectory -msgid "Save in IDE config directory" -msgstr "" - -#: lazarusidestrconsts:lissaveinfoofclosededitorfiles -msgid "Save info of closed editor files" -msgstr "" - -#: lazarusidestrconsts:lispckeditsavepackage -msgid "Save package" -msgstr "Сохранить пакет" - -#: lazarusidestrconsts:lispkgmangsavepackage2 -msgid "Save package?" -msgstr "Сохранить пакет?" - -#: lazarusidestrconsts:lisposavesessioninformationin -msgid "Save session information in" -msgstr "" - -#: lazarusidestrconsts:fdmscaleword -msgid "Scale" -msgstr "Масштаб" - -#: lazarusidestrconsts:lisscalingfactor -msgid "Scaling factor:" -msgstr "Масштабный фактор:" - -#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure -msgid "Scan Unit for Unit Name and Register procedure" -msgstr "Искать в модуле имя и процедуру Register" - -#: lazarusidestrconsts:liscoscanforfpcmessages -msgid "Scan for FPC messages" -msgstr "Поиск сообщений FPC" - -#: lazarusidestrconsts:liscoscanformakemessages -msgid "Scan for Make messages" -msgstr "Поиск сообщений Make" - -#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages -msgid "Scan output for Free Pascal Compiler messages" -msgstr "Поиск сообщений компилятора FreePascal в выводе" - -#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages -msgid "Scan output for make messages" -msgstr "Поиск сообщений make в выводе" - -#: lazarusidestrconsts:dlgscope -msgid "Scope" -msgstr "Где" - -#: lazarusidestrconsts:srvk_scroll -msgid "Scroll" -msgstr "Прокрутить" - -#: lazarusidestrconsts:dlgscrollbyoneless -msgid "Scroll by one less" -msgstr "" - -#: lazarusidestrconsts:srkmecscrolldown -msgid "Scroll down one line" -msgstr "Прокрутить вниз 1 строку" - -#: lazarusidestrconsts:srkmecscrollleft -msgid "Scroll left one char" -msgstr "Прокрутить влево 1 символ" - -#: lazarusidestrconsts:dlgscrollpastendfile -msgid "Scroll past end of file" -msgstr "Прокрутить до конца файла" - -#: lazarusidestrconsts:dlgscrollpastendline -msgid "Scroll past end of line" -msgstr "Прокрутить до конца строки" - -#: lazarusidestrconsts:srkmecscrollright -msgid "Scroll right one char" -msgstr "Прокрутить влево 1 символ" - -#: lazarusidestrconsts:srkmecscrollup -msgid "Scroll up one line" -msgstr "Прокрутить вверх 1 строку" - -#: lazarusidestrconsts:lissearchfor -msgid "Search For " -msgstr "Искать " - -#: lazarusidestrconsts:lismenuviewsearchresults -msgid "Search Results" -msgstr "Результаты поиска" - -#: lazarusidestrconsts:lissearchagain -msgid "Search again" -msgstr "Искать снова" - -#: lazarusidestrconsts:lisfrisearchincommentstoo -msgid "Search in comments too" -msgstr "Искать и в комментариях" - -#: lazarusidestrconsts:lispatheditsearchpaths -msgid "Search paths:" -msgstr "Пути поиска:" - -#: lazarusidestrconsts:lisuesearchstringnotfound -msgid "Search string '%s' not found!" -msgstr "Строка поиска '%s' не найдена!" - -#: lazarusidestrconsts:dlgsearchabort -msgid "Search terminated by user." -msgstr "Поиск прерван пользователем." - -#: lazarusidestrconsts:lisssearchtext -msgid "Search text" -msgstr "Текст для поиска" - -#: lazarusidestrconsts:lisfrisearchwhere -msgid "Search where" -msgstr "Искать где" - -#: lazarusidestrconsts:lisssearching -msgid "Searching" -msgstr "Поиск" - -#: lazarusidestrconsts:dlgsearchcaption -msgid "Searching..." -msgstr "Поиск..." - -#: lazarusidestrconsts:lisuesearching -msgid "Searching: %s" -msgstr "Ищу: %s" - -#: lazarusidestrconsts:lislazdocseealsotag -msgid "See also" -msgstr "" - -#: lazarusidestrconsts:lisseemessages -msgid "See messages." -msgstr "См. сообщения." - -#: lazarusidestrconsts:srkmecselleft -msgid "SelLeft" -msgstr "SelLeft" - -#: lazarusidestrconsts:srkmecselright -msgid "SelRight" -msgstr "SelRight" - -#: lazarusidestrconsts:lismenuselect -msgid "Select" -msgstr "Выделить" - -#: lazarusidestrconsts:srkmecselectall -msgid "Select All" -msgstr "Выбрать все" - -#: lazarusidestrconsts:lisctselectcodemacro -msgid "Select Code Macro" -msgstr "" - -#: lazarusidestrconsts:lisselectdfmfiles -msgid "Select Delphi form files (*.dfm)" -msgstr "Выберите файлы форм Delphi (*.dfm)" - -#: lazarusidestrconsts:srkmecseldown -msgid "Select Down" -msgstr "Выделить вниз" - -#: lazarusidestrconsts:srkmecselgotoxy -msgid "Select Goto XY" -msgstr "Выделить переход по коорд." - -#: lazarusidestrconsts:srkmecsellineend -msgid "Select Line End" -msgstr "Выделить конец строки" - -#: lazarusidestrconsts:srkmecsellinestart -msgid "Select Line Start" -msgstr "Выделить начало строки" - -#: lazarusidestrconsts:lismenueditorselectmenu -msgid "Select Menu:" -msgstr "Выбрать меню:" - -#: lazarusidestrconsts:srkmecselpagebottom -msgid "Select Page Bottom" -msgstr "Выделить низ страницы" - -#: lazarusidestrconsts:srkmecselpagedown -msgid "Select Page Down" -msgstr "Выделить страницу снизу" - -#: lazarusidestrconsts:srkmecselpageleft -msgid "Select Page Left" -msgstr "Выделить страницу слева" - -#: lazarusidestrconsts:srkmecselpageright -msgid "Select Page Right" -msgstr "Выделить страницу справа" - -#: lazarusidestrconsts:srkmecselpagetop -msgid "Select Page Top" -msgstr "Выделить верх страницы" - -#: lazarusidestrconsts:srkmecselpageup -msgid "Select Page Up" -msgstr "Выделить страницу сверху" - -#: lazarusidestrconsts:lismenueditorselecttemplate -msgid "Select Template:" -msgstr "Выбрать шаблон:" - -#: lazarusidestrconsts:srkmecselup -msgid "Select Up" -msgstr "Выделить вверх" - -#: lazarusidestrconsts:srkmecselwordleft -msgid "Select Word Left" -msgstr "Выделить слово слева" - -#: lazarusidestrconsts:srkmecselwordright -msgid "Select Word Right" -msgstr "Выделить слово справа" - -#: lazarusidestrconsts:lisselectahelpitem -msgid "Select a help item:" -msgstr "Искать элемент справки:" - -#: lazarusidestrconsts:lisselectanode -msgid "Select a node" -msgstr "Выберите элемент" - -#: lazarusidestrconsts:lisnpselectaprojecttype -msgid "Select a project type" -msgstr "Выберите тип проекта" - -#: lazarusidestrconsts:lismenuselectall -msgid "Select all" -msgstr "Выделить все" - -#: lazarusidestrconsts:lismenuselectcodeblock -msgid "Select code block" -msgstr "Выделить блок кода" - -#: lazarusidestrconsts:lispatheditselectdirectory -msgid "Select directory" -msgstr "Выбрать каталог" - -#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds -msgid "Select grand childs" -msgstr "" - -#: lazarusidestrconsts:lismenuselectline -msgid "Select line" -msgstr "Выделить строку" - -#: lazarusidestrconsts:lismenuselectparagraph -msgid "Select paragraph" -msgstr "Выделить абзац" - -#: lazarusidestrconsts:lisdsgselectparentcomponent -msgid "Select parent component" -msgstr "Выбрать родительский компонент" - -#: lazarusidestrconsts:srkmecseleditortop -msgid "Select to absolute beginning" -msgstr "Выделить до самого начала" - -#: lazarusidestrconsts:srkmecseleditorbottom -msgid "Select to absolute end" -msgstr "Выделить до самого конца" - -#: lazarusidestrconsts:lismenuselecttobrace -msgid "Select to brace" -msgstr "Выделить до скобки" - -#: lazarusidestrconsts:lismenuselectword -msgid "Select word" -msgstr "Выбрать слово" - -#: lazarusidestrconsts:liscodetoolsdefsselectednode -msgid "Selected Node:" -msgstr "Выделить элемент:" - -#: lazarusidestrconsts:dlgselectedtext -msgid "Selected Text" -msgstr "В выделенном" - -#: lazarusidestrconsts:lispckexplisrequiredby -msgid "Selected package is required by:" -msgstr "Выбранный пакет нужен для:" - -#: lazarusidestrconsts:dlgruberbandselectioncolor -msgid "Selection" -msgstr "Выделение" - -#: lazarusidestrconsts:lisselectionexceedsstringconstant -msgid "Selection exceeds string constant" -msgstr "Выбор превышает строковую константу" - -#: lazarusidestrconsts:lisselectiontool -msgid "Selection tool" -msgstr "Инструмент выбора" - -#: lazarusidestrconsts:liscodetoolsoptssemicolon -msgid "Semicolon" -msgstr "Точка с запятой" - -#: lazarusidestrconsts:dlgposavesession -msgid "Session" -msgstr "" - -#: lazarusidestrconsts:srkmecsetmarker -msgid "Set Marker %d" -msgstr "Установить маркер %d" - -#: lazarusidestrconsts:uemsetfreebookmark -msgid "Set a free Bookmark" -msgstr "" - -#: lazarusidestrconsts:lismenusetfreebookmark -msgid "Set a free bookmark" -msgstr "" - -#: lazarusidestrconsts:dlgsetallelementdefault -msgid "Set all elements to default" -msgstr "Установить все элементы по умолчанию" - -#: lazarusidestrconsts:dlgsetelementdefault -msgid "Set element to default" -msgstr "Установить элемент по умолчанию" - -#: lazarusidestrconsts:dlgsetpropertyvariable -msgid "Set property Variable" -msgstr "Переменная свойства" - -#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway -msgid "Set the breakpoint anyway" -msgstr "" - -#: lazarusidestrconsts:lislazbuildsettobuildall -msgid "Set to %sBuild All%s" -msgstr "Установить %sСобрать все%s" - -#: lazarusidestrconsts:srvk_shift -msgid "Shift" -msgstr "Shift" - -#: lazarusidestrconsts:srkmecshifttab -msgid "Shift Tab" -msgstr "" - -#: lazarusidestrconsts:lislazdocshorttag -msgid "Short" -msgstr "" - -#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto -msgid "Should the file be renamed lowercase to%s%s%s%s?" -msgstr "Должен ли файл быть переименован в нижн. рег. в %s%s%s%s?" - -#: lazarusidestrconsts:lisaf2pshowall -msgid "Show All" -msgstr "Показать все" - -#: lazarusidestrconsts:lisuishowcodetoolsvalues -msgid "Show CodeTools Values" -msgstr "Показать значения CodeTools" - -#: lazarusidestrconsts:dlgcoshowerr -msgid "Show Errors" -msgstr "Показать ошибки" - -#: lazarusidestrconsts:dlgguidelines -msgid "Show Guide Lines" -msgstr "Показать линии помощи" - -#: lazarusidestrconsts:dlgshowhint -msgid "Show Hints" -msgstr "Показать подсказки" - -#: lazarusidestrconsts:dlghintsunused -msgid "Show Hints for unused units in main source" -msgstr "Подсказки для ненужных модулей в главном исходнике" - -#: lazarusidestrconsts:uemshowlinenumbers -msgid "Show Line Numbers" -msgstr "" - -#: lazarusidestrconsts:dlgshownotes -msgid "Show Notes" -msgstr "Показать заметки" - -#: lazarusidestrconsts:dlgcoshowoptions -msgid "Show Options" -msgstr "Показать опции" - -#: lazarusidestrconsts:fdmshowoptions -msgid "Show Options for form editing" -msgstr "Показать настройки для редактирования форм" - -#: lazarusidestrconsts:dlgshowwarnings -msgid "Show Warnings" -msgstr "Показать предупреждения" - -#: lazarusidestrconsts:lisa2pshowall -msgid "Show all" -msgstr "Показать все" - -#: lazarusidestrconsts:liscoshowallmessages -msgid "Show all messages" -msgstr "Показать все сообщения" - -#: lazarusidestrconsts:dlgshowprocserror -msgid "Show all procs on error" -msgstr "Все проц-ры при ошибках" - -#: lazarusidestrconsts:dlgqshowborderspacing -msgid "Show border spacing" -msgstr "" - -#: lazarusidestrconsts:dlgclosebuttonsnotebook -msgid "Show close buttons in notebook" -msgstr "Показать кнопки закрытия закладок" - -#: lazarusidestrconsts:srkmecshowcodecontext -msgid "Show code context" -msgstr "" - -#: lazarusidestrconsts:dlgshowcompiledprocedures -msgid "Show compiled procedures" -msgstr "Показать компилируемые процедуры" - -#: lazarusidestrconsts:dlgshowcompileroptions -msgid "Show compiler options" -msgstr "Показать опции компилятора" - -#: lazarusidestrconsts:dlgshowcaps -msgid "Show component captions" -msgstr "Показать названия компонентов" - -#: lazarusidestrconsts:dlgshowconditionals -msgid "Show conditionals" -msgstr "Показать условия" - -#: lazarusidestrconsts:dlgshowdebuginfo -msgid "Show debug info" -msgstr "Показать отладочную инф-ю" - -#: lazarusidestrconsts:dlgshowdefinedmacros -msgid "Show defined macros" -msgstr "Показать определённые макросы" - -#: lazarusidestrconsts:dlgshowedrhints -msgid "Show editor hints" -msgstr "Показвать подсказки редактора" - -#: lazarusidestrconsts:dlgshoweverything -msgid "Show everything" -msgstr "Показать всё" - -#: lazarusidestrconsts:dlgshowexecutableinfo -msgid "Show executable info (Win32 only)" -msgstr "" - -#: lazarusidestrconsts:dlgshowgeneralinfo -msgid "Show general info" -msgstr "Показать общие сведения" - -#: lazarusidestrconsts:dlgqshowgrid -msgid "Show grid" -msgstr "Показать сетку" - -#: lazarusidestrconsts:dlgshowgutterhints -msgid "Show gutter hints" -msgstr "Показать подсказки" - -#: lazarusidestrconsts:lisshowhintsinobjectinspector -msgid "Show hints in Object Inspector" -msgstr "Показывать подсказки в Инспекторе объектов" - -#: lazarusidestrconsts:dlgshowlinenumbers -msgid "Show line numbers" -msgstr "Показать номера строк" - -#: lazarusidestrconsts:dlgshownothing -msgid "Show nothing (only errors)" -msgstr "Ничего не показывать(только ошибки)" - -#: lazarusidestrconsts:dlgshowscrollhint -msgid "Show scroll hint" -msgstr "Показывать прокручиваемые подсказки" - -#: lazarusidestrconsts:dlgshowsummary -msgid "Show summary" -msgstr "Показать обзор" - -#: lazarusidestrconsts:dlgshowtriedfiles -msgid "Show tried files" -msgstr "Показывать пробуемые файлы" - -#: lazarusidestrconsts:dlgshowusedfiles -msgid "Show used files" -msgstr "Показать используемые файлы" - -#: lazarusidestrconsts:lissimplesyntax -msgid "Simple Syntax" -msgstr "" - -#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof -msgid "Simple Syntax (e.g. * instead of .*)" -msgstr "Простой синтаксис (напр., * вместо .*)" - -#: lazarusidestrconsts:fdmsizeword -msgid "Size" -msgstr "Размер" - -#: lazarusidestrconsts:lisuidsize -msgid "Size:" -msgstr "" - -#: lazarusidestrconsts:liscoskipcallingcompiler -msgid "Skip calling Compiler" -msgstr "Пропуск вызова компилятора" - -#: lazarusidestrconsts:lisskipfileandcontinueloading -msgid "Skip file and continue loading" -msgstr "" - -#: lazarusidestrconsts:lisskiploadinglastproject -msgid "Skip loading last project" -msgstr "Пропустить загрузку последнего проекта" - -#: lazarusidestrconsts:dlgcosmaller -msgid "Smaller Code" -msgstr "Меньший код" - -#: lazarusidestrconsts:dlgcosmartlinkable -msgid "Smart Linkable" -msgstr "Умная линковка" - -#: lazarusidestrconsts:dlgsmarttabs -msgid "Smart tabs" -msgstr "Умные закладки" - -#: lazarusidestrconsts:dlgsnapguidelines -msgid "Snap to Guide Lines" -msgstr "Выравнивать по линиям помощи" - -#: lazarusidestrconsts:dlgqsnaptogrid -msgid "Snap to grid" -msgstr "Выравнивать по сетке" - -#: lazarusidestrconsts:srvk_snapshot -msgid "Snapshot" -msgstr "Снимок" - -#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk -msgid "Some files have changed on disk:" -msgstr "Некоторые файлы изменены на диске:" - -#: lazarusidestrconsts:lissorrynotimplementedyet -msgid "Sorry, not implemented yet" -msgstr "Извините, пока не реализовано" - -#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented -msgid "Sorry, this type is not yet implemented" -msgstr "Извините, этот тип ещё не реализован" - -#: lazarusidestrconsts:lismenusortselection -msgid "Sort selection" -msgstr "Сортировка выбранного" - -#: lazarusidestrconsts:lismenuviewsourceeditor -msgid "Source Editor" -msgstr "Редактор исходников" - -#: lazarusidestrconsts:srkmcatsrcnotebook -msgid "Source Notebook commands" -msgstr "Команды закладок исходника" - -#: lazarusidestrconsts:lissourceanddestinationarethesame -msgid "Source and Destination are the same:%s%s" -msgstr "Источник и назначение одинаковы:%s%s" - -#: lazarusidestrconsts:lismenuaddbpsource -msgid "Source breakpoint" -msgstr "Точка останова в исходнике" - -#: lazarusidestrconsts:lissourcedirectorydoesnotexist -msgid "Source directory %s%s%s does not exist." -msgstr "Директория исходников %s%s%s отсутствует." - -#: lazarusidestrconsts:lissourcemodified -msgid "Source modified" -msgstr "Исходник изменён" - -#: lazarusidestrconsts:lissourceofpagehaschangedsave -msgid "Source of page %s%s%s has changed. Save?" -msgstr "Исходник страницы %s%s%s изменён. Сохранить?" - -#: lazarusidestrconsts:lismakeresstrsourcepreview -msgid "Source preview" -msgstr "Предпросмотр исходника" - -#: lazarusidestrconsts:dlgspacenotcosmos -msgid "Space" -msgstr "Пробел" - -#: lazarusidestrconsts:lisspaceequally -msgid "Space equally" -msgstr "" - -#: lazarusidestrconsts:srvk_space -msgid "Space key" -msgstr "Кнопка пробел" - -#: lazarusidestrconsts:rslanguagespanish -msgid "Spanish" -msgstr "Испанский" - -#: lazarusidestrconsts:lisuidsrc -msgid "Src" -msgstr "Исх" - -#: lazarusidestrconsts:dlgcostack -msgid "Stack" -msgstr "Стека" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu -msgid "Standard Edit Menu" -msgstr "Стандартное меню Правка" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu -msgid "Standard File Menu" -msgstr "Стандартное меню Файл" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu -msgid "Standard Help Menu" -msgstr "Стандартное меню Справка" - -#: lazarusidestrconsts:lisstartwithanewproject -msgid "Start with a new project" -msgstr "" - -#: lazarusidestrconsts:lisoipstate -msgid "State" -msgstr "Состояние" - -#: lazarusidestrconsts:dlgstatickeyword -msgid "Static Keyword in Objects" -msgstr "Ключевое слово Static в объектах" - -#: lazarusidestrconsts:lishintstepinto -msgid "Step Into" -msgstr "Шаг со входом" - -#: lazarusidestrconsts:lishintstepover -msgid "Step Over" -msgstr "Шаг в обход" - -#: lazarusidestrconsts:lismenustepinto -msgid "Step into" -msgstr "Шаг со входом" - -#: lazarusidestrconsts:lismenustepover -msgid "Step over" -msgstr "Шаг в обход" - -#: lazarusidestrconsts:lismenustop -msgid "Stop" -msgstr "Останов" - -#: lazarusidestrconsts:lisstopdebugging -msgid "Stop Debugging?" -msgstr "Остановить отладку?" - -#: lazarusidestrconsts:dlgstopafternrerr -msgid "Stop after number of errors:" -msgstr "Останов после числа ошибок" - -#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject -msgid "Stop current debugging and rebuild project?" -msgstr "" - -#: lazarusidestrconsts:lisstopdebugging2 -msgid "Stop debugging?" -msgstr "" - -#: lazarusidestrconsts:lisstopthedebugging -msgid "Stop the debugging?" -msgstr "Остановить отладку?" - -#: lazarusidestrconsts:dlgcdtstoredpostfix -msgid "Stored postfix" -msgstr "Префикс STORED" - -#: lazarusidestrconsts:lisstreamingerror -msgid "Streaming error" -msgstr "Ошибка потоков" - -#: lazarusidestrconsts:lismakeresstrstringconstantinsource -msgid "String Constant in source" -msgstr "Строковая константа в исходнике" - -#: lazarusidestrconsts:liscodetoolsoptsstringconst -msgid "String constant" -msgstr "Строковая константа" - -#: lazarusidestrconsts:lismakeresstrstringswithsamevalue -msgid "Strings with same value:" -msgstr "Строки с тем же значением:" - -#: lazarusidestrconsts:dlgcostrip -msgid "Strip Symbols From Executable" -msgstr "Вырезать символы из бинарника" - -#: lazarusidestrconsts:dlgcostyle -msgid "Style:" -msgstr "Стиль:" - -#: lazarusidestrconsts:lissubprocedure -msgid "Sub Procedure" -msgstr "Подпроцедура" - -#: lazarusidestrconsts:lissubprocedureonsamelevel -msgid "Sub Procedure on same level" -msgstr "Подпроцедура того же уровня" - -#: lazarusidestrconsts:dlgedbsubdir -msgid "Sub directory" -msgstr "Подкаталог" - -#: lazarusidestrconsts:dlgsubpropkcolor -msgid "Subpropertes" -msgstr "Подсвойства" - -#: lazarusidestrconsts:lisa2pswitchpaths -msgid "Switch Paths" -msgstr "Переключить пути" - -#: lazarusidestrconsts:srkmectoggleformunit -msgid "Switch between form and unit" -msgstr "Переключить модуль/форму" - -#: lazarusidestrconsts:liscodetoolsoptssymbol -msgid "Symbol" -msgstr "Символ" - -#: lazarusidestrconsts:dlgsmbbehind -msgid "Symbol behind (.pp~)" -msgstr "Символ сзади (.~pp)" - -#: lazarusidestrconsts:dlgsmbfront -msgid "Symbol in front (.~pp)" -msgstr "Символ спереди (.~pp)" - -#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus -msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" -msgstr "SynEdit - компонент редактора, используемый Lazarus. http://sourceforge.net/projects/synedit/" - -#: lazarusidestrconsts:srkmecsyntaxcheck -msgid "Syntax check" -msgstr "Проверка синтаксиса" - -#: lazarusidestrconsts:dlgsyntaxoptions -msgid "Syntax options" -msgstr "Опции синтаксиса" - -#: lazarusidestrconsts:dlgrunosystemvariables -msgid "System variables" -msgstr "Системные переменные" - -#: lazarusidestrconsts:dlgbp7cptb -msgid "TP/BP 7.0 Compatible" -msgstr "Совместимость с TP/BP 7.0" - -#: lazarusidestrconsts:srvk_tab -msgid "Tab" -msgstr "ТАБ" - -#: lazarusidestrconsts:dlgtabindent -msgid "Tab indents blocks" -msgstr "ТАБ выделяет блоки" - -#: lazarusidestrconsts:fdmtaborder -msgid "Tab order..." -msgstr "" - -#: lazarusidestrconsts:liseotabwidths -msgid "Tab widths" -msgstr "" - -#: lazarusidestrconsts:dlgtabstospaces -msgid "Tabs to spaces" -msgstr "ТАБ в пробелы" - -#: lazarusidestrconsts:lismenutabstospacesselection -msgid "Tabs to spaces in selection" -msgstr "ТАБ сделать пробелами в выделенном" - -#: lazarusidestrconsts:listargetcpu -msgid "Target CPU" -msgstr "Для ЦП:" - -#: lazarusidestrconsts:lislazbuildtargetdirectory -msgid "Target Directory:" -msgstr "Каталог назначения:" - -#: lazarusidestrconsts:listargetos -msgid "Target OS" -msgstr "Для какой ОС" - -#: lazarusidestrconsts:liscotargetosspecificoptions -msgid "Target OS specific options" -msgstr "Специфические параметры ОС" - -#: lazarusidestrconsts:lislazbuildtargetos -msgid "Target OS:" -msgstr "Для ОС:" - -#: lazarusidestrconsts:dlgtargetplatform -msgid "Target Platform:" -msgstr "" - -#: lazarusidestrconsts:dlgpotargetfilename -msgid "Target file name:" -msgstr "Имя исполняемого файла:" - -#: lazarusidestrconsts:listargetfilenameplusparams -msgid "Target filename + params" -msgstr "Имя файла бинарника с параметрами" - -#: lazarusidestrconsts:listargetfilenameofproject -msgid "Target filename of project" -msgstr "Имя файла бинарника проекта" - -#: lazarusidestrconsts:dlgtargetproc -msgid "Target i386" -msgstr "" - -#: lazarusidestrconsts:lismenueditortemplatepreview -msgid "Template Preview" -msgstr "Просмотр шаблона" - -#: lazarusidestrconsts:dlgtplfname -msgid "Template file name" -msgstr "Имя файла шаблона" - -#: lazarusidestrconsts:lisctdtemplates -msgid "Templates" -msgstr "" - -#: lazarusidestrconsts:liscomptest -msgid "Test" -msgstr "Тест" - -#: lazarusidestrconsts:listestdirectory -msgid "Test directory" -msgstr "Каталог проб" - -#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg -msgid "Test directory \"%s\" not found." -msgstr "Каталог проб \"%s\" не найден." - -#: lazarusidestrconsts:lispkgfiletypetext -msgid "Text" -msgstr "Текст" - -#: lazarusidestrconsts:dlgtextattributes -msgid "Text attributes" -msgstr "Параметры текста" - -#: lazarusidestrconsts:srkmcatediting -msgid "Text editing commands" -msgstr "Команды редактирования текста" - -#: lazarusidestrconsts:srkmcatmarker -msgid "Text marker commands" -msgstr "Команды маркера текста" - -#: lazarusidestrconsts:srkmcatsearchreplace -msgid "Text search and replace commands" -msgstr "Команды поиска и замены текста" - -#: lazarusidestrconsts:srkmcatselection -msgid "Text selection commands" -msgstr "Команды выделения текста" - -#: lazarusidestrconsts:lisfindfiletexttofind -msgid "Text to find:" -msgstr "Искать текст:" - -#: lazarusidestrconsts:lisdiffdlgtext1 -msgid "Text1" -msgstr "Текст1" - -#: lazarusidestrconsts:lisdiffdlgtext2 -msgid "Text2" -msgstr "Текст2" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" -msgstr "Главный каталог %s,%sгде Borland установил %s исходники,%sкоторые использует этот %s проект.%sНапример: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "Главный каталог %s, %sгде Borland установил все исходники %s,используемые проектом %s. %sНапример: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" -msgstr "Главный каталог %s,%sгде Borland установил все %s исходники.%sНапример: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "Главный каталог %s, %sгде Borland установил все исходники %s. %sНапример: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory -msgid "The %s project directory,%swhich contains the .dpr, dpk file." -msgstr "Каталог %s проекта,%sсодержащий файлы .dpr, dpk." - -#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase -msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для объектного паскаля." - -#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir -msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ." -msgstr "Каталог исходников FPC \"%s\" выглядит некорректно. Обычно он содержит каталоги rtl, fcl, packages, compiler, ... ." - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir -msgid "The Free Pascal SVN source directory." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory -msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." -msgstr "" - -#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm -msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "Компилятор FreePascal (имя файла: %s) не найден.%sВам рекомендуется установить fpc" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory -msgid "The Free Pascal project directory." -msgstr "Каталог проекта FreePascal." - -#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun -msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "Каталог исходников FPC не найден.%sОтдельные действия с кодом не будут работать.%sРекомендуется установить его и установить путь%sEnvironment -> Environment Options -> Files" - -#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase -msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "LCL - Библиотека компонентов Lazarus - содержит все основные компоненты для редактирования форм." - -#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis -msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что он содержит некоторые свойства/классы, которых нет в текущей версии LCL. Обычно следует убрать эти свойства из lfm и (если надо) исправить код паскаля вручную." - -#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr -msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "Каталог Lazarus не найден.%sВы не сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory -msgid "The Lazarus main directory." -msgstr "Главный каталог Lazarus." - -#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid -msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Максимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10" - -#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion -msgid "The Maximum Version is lower than the Minimim Version." -msgstr "Максимальная версия меньше минимальной." - -#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid -msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Минимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10" - -#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase -msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." -msgstr "" - -#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt -msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "Пробный каталог не найден:%s%s%s%s%s (см. настройки окружения)" - -#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit -msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "Название типа предка %s%s%s совпадает с%sмодулем %s%s%sю" - -#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier -msgid "The ancestor type %s%s%s is not a valid pascal identifier." -msgstr "Тип предка %s%s%s - неправильный идентификатор паскаля" - -#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro -msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "Класс %s%s%s - элемент управления (TControl), его нельзя вставить на что-то другое.%sНе могу вставить." - -#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame -msgid "The class name %s%s%s and ancestor type %s%s%s are the same." -msgstr "Имя класса %s%s%s и его предка %s%s%s совпадают." - -#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile -msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" -msgstr "Имя класса %s%s%s уже есть в%sПакете %s%sФайл: %s%s%s" - -#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit -msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "Имя класса %s%s%s совпадает с %s именем модуля %s%s%s." - -#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier -msgid "The class name %s%s%s is not a valid pascal identifier." -msgstr "Имя класса %s%s%s - недопустимый идентификатор паскаля" - -#: lazarusidestrconsts:listhecommandafterisnotexecutable -msgid "The command after %s%s%s is not executable." -msgstr "Команда после %s%s%s" - -#: lazarusidestrconsts:listhecommandafterpublishingisinvalid -msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "Команда после опубликования некорректна:%s%s%s%s" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg -msgid "The compiler file \"%s\" is not an executable." -msgstr "Файл компилятора \"%s\" не исполняемый." - -#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable -msgid "The compiler file for package %s is not a valid executable:%s%s" -msgstr "Файл компилятора для пакета %s - недопустимый исполняемый:%s%s" - -#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated -msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" -msgstr "Редактор компонента для класса %s%s%sсвязанный со словом #%s %s%s%sвызвал ошибку:%s%s%s%s" - -#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror -msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" -msgstr "Редактор компонента для класса %s%s%sвызвал ошибку:%s%s%s%s" - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "Текущий каталог исходников FPC %s%s%s%sвыглядит неправильно.%sПроверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "Текущий каталог исходников FPC %s%s%s%sвыглядит неправильно.%sВыберите ОК чтобы вернуть используемый по умолчанию %s%s%s,%s или же проверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sПроверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%s или же проверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "%s%s%s.%sИначе проверьте Окружение->Настройки окружения->Файлы" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "Текущее имя компилятора %s%s%s%s - не исполняемый файл.%sПроверьте Environment -> Environment Options -> Files" - -#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits -msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "Текущий путь модуля для файла %s%s%s%s - %s%s%s%s.%s%sПуть к модулям LCL %s%s%s отсутствует.%s%sПодсказка для новичков:%sСоздайте приложение lazarus и поместите файл в каталог проекта." - -#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro -msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "Отладчик %s%s%s%sdoes не найден или не найден исполнимый файл.%s%sСм. Окружение -> Опции отладчика" - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg -msgid "The debugger file \"%s\" is not an executable." -msgstr "Файл отладчика \"%s\" не исполняемый." - -#: lazarusidestrconsts:lisprojaddthedependencywasnotfound -msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "Зависимость %s%s%s не найдена.%sВыберите существующий пакет." - -#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist -msgid "The destination directory%s%s%s%s does not exist." -msgstr "Каталог назначения%s%s%s%s не существует." - -#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit -msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "" - -#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit -msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" -msgstr "" - -#: lazarusidestrconsts:dlgthedirectory -msgid "The directory \"" -msgstr "Каталог \"" - -#: lazarusidestrconsts:listhefile -msgid "The file %s%s%s" -msgstr "Файл %s%s%s" - -#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage -msgid "The file %s%s%s is already in the package." -msgstr "Файл %s%s%s уже в пакете." - -#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr -msgid "The file %s%s%s is not a Delphi project (.dpr)" -msgstr "Файл %s%s%s не проект Delphi (.dpr)" - -#: lazarusidestrconsts:listhefileisnotadelphiunit -msgid "The file %s%s%s is not a Delphi unit." -msgstr "Файл %s%s%s - не модуль Delphi." - -#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage -msgid "The file %s%s%s is not a lazarus package." -msgstr "Файл %s%s%s - не пакет Lazarus." - -#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea -msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." -msgstr "Файл %s%s%s - часть текущего проекта.%sНе лучшая идея - делить файлы между проектами и пакетами." - -#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage -msgid "The file %s%s%s%sis already in the package %s." -msgstr "Файл %s%s%s%sуже в пакете %s." - -#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage -msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "Файл %s%s%s%sсейчас не находится в списке путей модулей пакета.%s%sДобавить его туда?" - -#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject -msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "Файл %s%s%s%sвыглядит как программа. Закрыть текущий проект и создать новый проект lazarus для этой программы?%s\"Нет\" откроет файл как обычный исходник." - -#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus -msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source." -msgstr "Файл %s%s%s%s похож на файл программы существующего Проекта1 lazarus.%sОткрыть проект?%sОтмена загрузит файл как обычный исходник." - -#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac -msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "Файл %s%s%s%sнайден в одном из каталогов исходника пакета %s, и он выглядит как откомпилированный модуль. Такие модули должны быть в специальном каталоге пакета, иначе другие пакеты не смогут правильно использовать пакте.%s%sУдалить такие файлы?" - -#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself -msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "Файл %s%s%s%sне найден.%sВы хотите поискать его самостоятельно?%s" - -#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject -msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "Файл %s%s%s%sне найден.%sПропуск продолжит загрузку проекта,%sПрервать - остановит загрузку." - -#: lazarusidestrconsts:uefilerotext1 -msgid "The file \"" -msgstr "Файл \"" - -#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject -msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." -msgstr "Имя файла %s%s%s - часть текущего проекта.%sПроекты и пакеты не должны бы делить файлы." - -#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile -msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." -msgstr "Имя файла %s%s%sиспользуется%sпакетом %s%s%s%sв файле %s%s%s." - -#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage -msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" -msgstr "Имя файла %s%s%s не соответствует имени пакета %s%s%s в файле.%sСменить имя пакета на %s%s%s?" - -#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename -msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." -msgstr "Этот файл %s%s%s не однозначный, потому что пакет не имеет директории по-умолчанию.%sПожалуйста определите имя файла и полный путь." - -#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload -msgid "The following package failed to load:" -msgstr "Этот пакет не загружется" - -#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload -msgid "The following packages failed to load:" -msgstr "Этот пакет не загружется" - -#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren -msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?" -msgstr "Не найдены следующие модули:%s%s%s%s1)Либо этих модулей нет в пути поиска модулей, тогда прервите операцию сейчас, исправьте пути модулей и попробуйте снова.%s2) Возможно, модули поступили из регистронезависимой системы (windows/Delphi), а сейчас на регистрозависимой системе (linux, bsd, macosx). В этом случае сейчас прервите операцию, переименуйте модули в нижний регистр и попробуйте снова.%s3) Можно игнорировать отсутствуюзие модули и продолжить.%s%sДолжны ли отсутствующие модули быть закомментированы?" - -#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable -msgid "The host application %s%s%s is not executable." -msgstr "Главное приложение %s%s%s - не исполняемый файл." - -#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta -msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "Запускаемое приложение %s%s%s%sотсутствует или это не исполняемый файл.%s%sСм. Запуск -> Параметры запуска -> Local" - -#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir -msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." -msgstr "Каталог lazarus \"%s\" выглядит некорректно. Обычно он содержит каталоги lcl, debugger, designer, components, ... ." - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg -msgid "The make file \"%s\" is not an executable." -msgstr "Файл make \"%s\" - не исполняемый файл." - -#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion -msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "Максимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)" - -#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion -msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "Минимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)" - -#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier -msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "Имя %s%s%s - неправильный идентификатор паскаля." - -#: lazarusidestrconsts:lisinvalidpascalidentifiertext -msgid "The name \"%s\" is not a valid pascal identifier." -msgstr "Слово \"%s\" - неправильный идентификатор языка паскаль." - -#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages -msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "Пакет %s - пакет только времени выполнения.%sТакие пакеты не могут встраиваться в IDE." - -#: lazarusidestrconsts:lisaf2pthepackageisreadonly -msgid "The package %s is read only." -msgstr "Пакет %s только для чтения." - -#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation -msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "Пакет %s требуется для %s, который помечен на установку.%sСмотри диаграмму пакетов." - -#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed -msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "Пакет %s имеет файл%s%s%s%s.%sДолжен ли файл быть переименован, как и пакет?" - -#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati -msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" -msgstr "" - -#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans -msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." -msgstr "Пакет %s%s%s имеет метку Автоинсталляция.%sЭто значит, что он автоматически встроится в IDE. Устанавливаемые пакеты%sдолжны быть для разработки." - -#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound -msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." -msgstr "" - -#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound -msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "Пакет %s%s%s отмечен на установку, но не найден.%sУдалить зависимость из списка установки пакетов?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus -msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "Пакет %s%s%s помечен на установку.%sСейчас lazarus поддерживает только статически связанные пакеты. Настоящая установка требует пересборки и перезапуска lazarus.%s%sВы хотите перебрать Lazarus сейчас?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus -msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "Пакет %s%s%s отмечен.%sСейчас lazarus поддерживает только статически связанные пакеты. Настоящее удаление требует пересборки и перезапуска lazarus.%s%sВы хотите перебрать Lazarus сейчас?" - -#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename -msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." -msgstr "Имя пакета %s%s%s в%s%s%s%s - неправильное имя пакета lazarus." - -#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe -msgid "The package has already a dependency for the package %s%s%s." -msgstr "Пакет уже имеет зависимость от пакета %s%s%s" - -#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag -msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет." - -#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting -msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." -msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет." - -#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean -msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "Имя пакета %s%s%s некорректно.%sВыберите другой пакет (напр., package1.lpk)." - -#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid -msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." -msgstr "Имя пакета %s%s%s %sфайла %s%s%s некорректно." - -#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars -msgid "The page name %s%s%s is too long (max 100 chars)." -msgstr "Имя пакета %s%s%s слишком длинное (надо до 100 симв.)." - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject -msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." -msgstr "" - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample -msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." -msgstr "Путь к компилятору FreePascal.%s Например, %s/usr/bin%s -n%s или %s/usr/local/bin/fpc @/etc/fpc.cfg%s." - -#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla -msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" -msgstr "Программа %smake%s не найдена.%sЭтот инструмент нужен, чтобы собрать lazarus.%s" - -#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency -msgid "The project has already a dependency for the package %s%s%s." -msgstr "Проект уже зависит от пакета %s%s%s." - -#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource -msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "Файл сведений проекта %s%s%s%sсовпадает с главным исходником!" - -#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest -msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "Проект надо сохранить до компиляции%sЕсли Вы установите каталог проб в настройках окружения,%sВы можете создавать новые проекты и собирать их сразу.%sСохранить прокет?" - -#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound -msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "Проект требует пакет %s%s%s.%sНо он не найден. См. Прокет -> Инспектор проекта." - -#: lazarusidestrconsts:lismakeresstrchooseanothername -msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "Строка ресурсов %s%s%s уже есть. %sВыберите другое имя. %s Используйте Пропуск, чтобы добавить как есть." - -#: lazarusidestrconsts:listherootcomponentcannotbedeleted -msgid "The root component can not be deleted." -msgstr "Компонент верхнего уровня не может быть удалён." - -#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming -msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "Модуль %s%s%s уже есть. Пропуск приведёт к переименованию,%sОтмена отменить сохранение этого файла, а%sПрервать - отменит сохранение вообще." - -#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds -msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" -msgstr "Модуль %s%s%s не в нижнем регистре.%sКомпилятор FreePascal 1.0.x требует имена в нижнем регистре. Если Вы не используете fpc 1.0.x для сборки этого модуля, можно игнорировать это сообщение.%s%sПереименовать файл?" - -#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus -msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "Модуль уже называется %s%s%s. Идентификаторы паскаля должны быть уникальны." - -#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject -msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." -msgstr "Имя модуля %s%s%s уже есть в проекте%sв файле: %s%s%s." - -#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection -msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." -msgstr "Имя модуля %s%s%s уже есть в выделении%sв файле: %s%s%s." - -#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename -msgid "The unit name %s%s%s does not correspond to the filename." -msgstr "Имя модуля %s%s%s не соответствует имени файла" - -#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier -msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "Имя модуля %s%s%s - недопустимый идентификатор паскаля." - -#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent -msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." -msgstr "Имя модуля совпадает с зарегистрированным компонентом.%sЭто может привести к странным сообщениям об ошибках." - -#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer -msgid "The unit name %s%s%s%sand filename %s%s%s differ." -msgstr "" - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage -msgid "The unitname %s%s%s already exists in the package:%s%s" -msgstr "Имя модуля %s%s%s уже занято в этом пакете:%s%s" - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage -msgid "The unitname %s%s%s already exists in this package." -msgstr "Имя модуля %s%s%s уже занято в этом пакете." - -#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu -msgid "There are more functions in the popupmenu" -msgstr "Во всплывающем меню больше функций" - -#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename -msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "В каталоге есть и другие файлы с таким же именем,%sотличающиеся только регистром:%s%s%sУдалить их?" - -#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from -msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" -msgstr "Есть два модуля с одинаковым именем:%s%s1. %s%s%s из %s%s2. %s%s%s из %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage -msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "Есть модуль FPC с таким же именем, как и пакет:%s%s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom -msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "Есть модуль FPC с таким же именем, как:%s%s%s%s%s из %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages -msgid "There is a circle in the required packages. See package graph." -msgstr "Обнаружен цикл зависимостей пакетов. Смотрите диаграмму пакетов." - -#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension -msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "На диске есть файл с таким же именем и похожим расширением%sФайл: %s%sПохожий файл: %s%s%sУдалить второй файл?" - -#: lazarusidestrconsts:lisexttoolthereisamaximumoftools -msgid "There is a maximum of %s tools." -msgstr "Допускается максимум %s инструментов." - -#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose -msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" -msgstr "В проекте есть модуль с именем %s%s%s.%sВыберите другое имя" - -#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 -msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" -msgstr "Есть модуль с тем же именем, что и пакет: %s%s1. %s%s%s из %s%s2. %s%s%s%s" - -#: lazarusidestrconsts:listhereisalreadyaformwiththename -msgid "There is already a form with the name %s%s%s" -msgstr "Уже есть форма с именем %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile -msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "Уже загружен пакет %s%s%s %sиз файла %s%s%s.%sСм. Компоненты -> Диаграмма пакетов.%sЗамена невозможна." - -#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus -msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "Уже есть модуль, называемый %s%s%s. Идентификаторы паскаля должны быть уникальны." - -#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename -msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" -msgstr "Уже есть другой пакет с именем %s%s%s.%sКонфликтующий пакет:%s%s%s%sФайл: %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages -msgid "There is an unsaved package in the required packages. See package graph." -msgstr "Среди требуемых пакетов есть несохранённый. См. диаграмму пакетов." - -#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno -msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." -msgstr "" - -#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent -msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "Произошла ошибка при записи выбранных компонентов %s:%s:%s%s" - -#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe -msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "Произошла ошибка при преобразовании бинарного потока выбранного компонента %s:%s:%s%s" - -#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli -msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "Произошла ошибка при копировании потока компонента в буфер:%s%s" - -#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage -msgid "This file is not in any loaded package." -msgstr "Этот файл отсутствует во всех загруженных пакетах." - -#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit -msgid "This file was automatically created by Lazarus. Do not edit!" -msgstr "" - -#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe -msgid "This is a virtual package. It has no source yet. Please save the package first." -msgstr "Это виртуальный пакет. Он не имеет исходных кодов. Пожалуйста сохраните сначала пакет." - -#: lazarusidestrconsts:lisresourcefilecomment -msgid "This is an automatically generated lazarus resource file" -msgstr "Это - файл ресурсов, автоматически созданный lazarus" - -#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents -msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "Это - пакет по умолчанию. Используется только для компонентов без пакета. Такие компоненты устарели." - -#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc -msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" -msgstr "" - -#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound -msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." -msgstr "" - -#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage -msgid "This source is only used to compile and install the package." -msgstr "Исходный код используется только для компиляции и установки пакета." - -#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode -msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "Это выражение не может быть извлечено.%sВыберите какой-то код, чтобы извлечь новую процедуру/метод." - -#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired -msgid "Title and Filename required" -msgstr "Требуются заголовок и имя файла" - -#: lazarusidestrconsts:dlgpotitle -msgid "Title:" -msgstr "Заголовок:" - -#: lazarusidestrconsts:listodolistcaption -msgid "ToDo List" -msgstr "Список ToDo" - -#: lazarusidestrconsts:listodolistoptions -msgid "ToDo options..." -msgstr "Настройки ToDo..." - -#: lazarusidestrconsts:lishinttoggleformunit -msgid "Toggle Form/Unit" -msgstr "Переключить форму/модуль" - -#: lazarusidestrconsts:srkmectogglemode -msgid "Toggle Mode" -msgstr "Переключить режим" - -#: lazarusidestrconsts:lismenuviewtoggleformunit -msgid "Toggle form/unit view" -msgstr "Переключить форму/модуль" - -#: lazarusidestrconsts:liscodetempltoken -msgid "Token:" -msgstr "Символ:" - -#: lazarusidestrconsts:lisctdefstools -msgid "Tools" -msgstr "Инструменты" - -#: lazarusidestrconsts:srkmcattoolmenu -msgid "Tools menu commands" -msgstr "Команды меню Инструменты" - -#: lazarusidestrconsts:dlgtooltipeval -msgid "Tooltip expression evaluation" -msgstr "" - -#: lazarusidestrconsts:dlgtooltiptools -msgid "Tooltip symbol Tools" -msgstr "" - -#: lazarusidestrconsts:listopspaceequally -msgid "Top space equally" -msgstr "" - -#: lazarusidestrconsts:dlgtoppos -msgid "Top:" -msgstr "Верх:" - -#: lazarusidestrconsts:listops -msgid "Tops" -msgstr "Верхушка" - -#: lazarusidestrconsts:dlgtrimtrailingspaces -msgid "Trim trailing spaces" -msgstr "Обрезать хвостовые пробелы" - -#: lazarusidestrconsts:lismenutemplatetutorial -msgid "Tutorial" -msgstr "Учебник" - -#: lazarusidestrconsts:dlgenvtype -msgid "Type" -msgstr "Тип" - -#: lazarusidestrconsts:lisuidtype -msgid "Type:" -msgstr "Тип:" - -#: lazarusidestrconsts:dlgcdtuppercase -msgid "UPPERCASE" -msgstr "ВЕРХНИЙ РЕГИСТР" - -#: lazarusidestrconsts:rslanguageukrainian -msgid "Ukrainian" -msgstr "" - -#: lazarusidestrconsts:lisunableconvertbinarystreamtotext -msgid "Unable convert binary stream to text" -msgstr "Не могу преобразовать бинарный поток в текст" - -#: lazarusidestrconsts:lisunablecopycomponentstoclipboard -msgid "Unable copy components to clipboard" -msgstr "Не могу скопировать компоненты в буфер" - -#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith -msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." -msgstr "Не могу добавить %s к проекту, т.к. в проекте уже есть модуль с таким именем." - -#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably -msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "Не могу добавить ресурс T%s:FORMDATA к файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса." - -#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile -msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "Не могу добавить комментарий заголовка ресурса к файлу ресурса %s%s%s%s.%sВозможно, ошибка синтаксиса." - -#: lazarusidestrconsts:lisunabletobackupfileto -msgid "Unable to backup file %s%s%s to %s%s%s!" -msgstr "Не могу сохранить резервный файл %s%s%s как %s%s%s!" - -#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist -msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." -msgstr "Не могу изменить список автосоздаваемых форм в исходнике программы.%sИсправьте сначала ошибки." - -#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions -msgid "Unable to clean up %s%s%s.%sPlease check permissions." -msgstr "Не могу очистить %s%s%s.%sПроверьте доступ." - -#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory -msgid "Unable to clean up destination directory" -msgstr "Не могу очистить каталог назначения" - -#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat -msgid "Unable to convert component text into binary format:%s%s" -msgstr "Не могу преобразовать компонент из текстового в бинарный формат:%s%s" - -#: lazarusidestrconsts:lisunabletoconvertfileerror -msgid "Unable to convert file %s%s%s%sError: %s" -msgstr "Не могу перевести файл %s%s%s%sОшибка: %s" - -#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile -msgid "Unable to convert lfm to lrs and write lrs file." -msgstr "Невозможно преобразовать lfm в lrs и записать lrs-файл." - -#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream -msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" -msgstr "Не могу превратить текстовые данные формы файла %s%s%s%s%sв двоичный поток. (%s)" - -#: lazarusidestrconsts:lisunabletocopyfile -msgid "Unable to copy file" -msgstr "Не могу скопировать файл" - -#: lazarusidestrconsts:lisunabletocopyfileto -msgid "Unable to copy file %s%s%s%sto %s%s%s" -msgstr "Не могу скопировать файл %s%s%s%sв %s%s%s" - -#: lazarusidestrconsts:lisunabletocopyfileto2 -msgid "Unable to copy file %s%s%s%sto %s%s%s." -msgstr "Не могу скопировать файл %s%s%s%sв %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatebackupdirectory -msgid "Unable to create backup directory %s%s%s." -msgstr "Не могу создать резервный каталог %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletocreatedirectory -msgid "Unable to create directory" -msgstr "Не могу создать каталог" - -#: lazarusidestrconsts:lisunabletocreatedirectory2 -msgid "Unable to create directory %s%s%s" -msgstr "Не могу создать каталог %s%s%s" - -#: lazarusidestrconsts:lisunabletocreatedirectory -msgid "Unable to create directory %s%s%s." -msgstr "Не могу создать каталог %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatefile -msgid "Unable to create file" -msgstr "Не могу создать файл" - -#: lazarusidestrconsts:lisunabletocreatefile2 -msgid "Unable to create file %s%s%s" -msgstr "Не могу создать файл %s%s%s" - -#: lazarusidestrconsts:lisunabletocreatefilename -msgid "Unable to create file %s%s%s." -msgstr "Не могу создать файл %s%s%s." - -#: lazarusidestrconsts:lisunabletocreatefile3 -msgid "Unable to create file%s%s%s%s" -msgstr "Не могу создать файл %s%s%s%s" - -#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin -msgid "Unable to create new method. Plz fix the error shown in the message window." -msgstr "Не могу создать новый метод. Исправьте ошибки, указанные в окне сообщений." - -#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage -msgid "Unable to create output directory %s%s%s%sfor package %s." -msgstr "Не могу создать каталог вывода %s%s%s%sиз пакета %s." - -#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage -msgid "Unable to create package source directory %s%s%s%sfor package %s." -msgstr "Не могу создать каталог исходника пакета %s%s%s%sдля пакета %s." - -#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus -msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." -msgstr "Не могу создать каталог цели для lazarus:%s%s%s%s.%sЭтот каталог нужен для вновь изменённой IDE lazarus с вашими пакетами." - -#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer -msgid "Unable to create temporary lfm buffer." -msgstr "Не возможно создать временный буфер для lfm" - -#: lazarusidestrconsts:lisunabletodeleteambiguousfile -msgid "Unable to delete ambiguous file %s%s%s" -msgstr "Не могу удалить двусмысленный файл %s%s%s" - -#: lazarusidestrconsts:lispkgmangunabletodeletefilename -msgid "Unable to delete file" -msgstr "Не могу удалить файл" - -#: lazarusidestrconsts:lispkgmangunabletodeletefile -msgid "Unable to delete file %s%s%s." -msgstr "Не могу удалить файл %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage -msgid "Unable to delete old state file %s%s%s%sfor package %s." -msgstr "Не могу удалить старый файл %s%s%s%s из пакета %s." - -#: lazarusidestrconsts:lisunabletofindinlfmstream -msgid "Unable to find %s in LFM Stream." -msgstr "" - -#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe -msgid "Unable to find a ResourceString section in this or any of the used units." -msgstr "Не могу найти секцию ResourceStribg в этом или любом используемом модуле." - -#: lazarusidestrconsts:lisunabletofindavalidclassnamein -msgid "Unable to find a valid classname in %s%s%s" -msgstr "Не могу найти правильное имя класса в %s%s%s" - -#: lazarusidestrconsts:lisunabletofindfile -msgid "Unable to find file %s%s%s." -msgstr "Не могу найти файл %s%s%s." - -#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption -msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" -msgstr "Не могу найти файл %s%s%s.%sПроверьте путь поиска в%sПроект->Параметры компилятора...->Пути->Другие файлы модулей" - -#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage -msgid "Unable to find method. Plz fix the error shown in the message window." -msgstr "Не могу найти метод. Исправьте ошибки в окне сообщений." - -#: lazarusidestrconsts:lisunabletogathereditorchanges -msgid "Unable to gather editor changes." -msgstr "" - -#: lazarusidestrconsts:lisunabletogetsourcefordesigner -msgid "Unable to get source for designer." -msgstr "Невозможно получить исходный код для дизайнера" - -#: lazarusidestrconsts:lisdebugunabletoloadfile -msgid "Unable to load file" -msgstr "Не могу загрузить файл" - -#: lazarusidestrconsts:lisdebugunabletoloadfile2 -msgid "Unable to load file %s%s%s." -msgstr "Не могу загрузить файл %s%s%s." - -#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis -msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "Не могу загрузить старый ресурсный файл.%sЭтот файл - первый включаемый файл в%s раздел инициализации.%sНапример, {$I %s.lrs}.%sВозможно, ошибка синтаксиса." - -#: lazarusidestrconsts:lispkgmangunabletoloadpackage -msgid "Unable to load package" -msgstr "Не могу загрузить пакет" - -#: lazarusidestrconsts:lispkgmangunabletoopenthepackage -msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." -msgstr "Не возможно открыть пакет%s%s%s.%sЭтот пакет помечен для установки" - -#: lazarusidestrconsts:lisunabletoreadfile -msgid "Unable to read file" -msgstr "Не могу прочитать файл" - -#: lazarusidestrconsts:lisunabletoreadfile2 -msgid "Unable to read file %s%s%s!" -msgstr "Не могу прочитать файл %s%s%s!" - -#: lazarusidestrconsts:lisunabletoreadfileerror -msgid "Unable to read file %s%s%s%sError: %s" -msgstr "Не могу прочитать файл %s%s%s%sОшибка: %s" - -#: lazarusidestrconsts:lisunabletoreadfilename -msgid "Unable to read file %s%s%s." -msgstr "Не могу прочитать файл %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletoreadpackagefile -msgid "Unable to read package file %s%s%s." -msgstr "Не могу прочитать файл пакета %s%s%s." - -#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror -msgid "Unable to read state file %s of project %s%sError: %s" -msgstr "" - -#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror -msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" -msgstr "Не могу прочитать файл состояния %s%s%s%sпакета %s.%sОшибка: %s" - -#: lazarusidestrconsts:lisunabletoremoveoldbackupfile -msgid "Unable to remove old backup file %s%s%s!" -msgstr "Не могу стереть старый резервный файл %s%s%s!" - -#: lazarusidestrconsts:lisunabletorenameambiguousfileto -msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" -msgstr "Не могу переименовать двусмысленный файо %s%s%s%sв %s%s%s" - -#: lazarusidestrconsts:lisunabletorenamefile -msgid "Unable to rename file" -msgstr "Не могу переименовать файл" - -#: lazarusidestrconsts:lisunabletorenamefileto -msgid "Unable to rename file %s%s%s to %s%s%s!" -msgstr "Не могу переименовать файл %s%s%s в %s%s%s!" - -#: lazarusidestrconsts:lisunabletorenamefileto2 -msgid "Unable to rename file %s%s%s%sto %s%s%s." -msgstr "Не могу переименовать файл %s%s%s%sв %s%s%s." - -#: lazarusidestrconsts:lisunabletorenameforminsource -msgid "Unable to rename form in source." -msgstr "Невозможно переименовать форму в исходнике" - -#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag -msgid "Unable to rename method. Plz fix the error shown in the message window." -msgstr "Не могу переименовать метод. Исправьте ошибку, см. окно сообщений." - -#: lazarusidestrconsts:lisunabletorenamevariableinsource -msgid "Unable to rename variable in source." -msgstr "Невозможно переименовать переменную в исходнике." - -#: lazarusidestrconsts:lisexttoolunabletorunthetool -msgid "Unable to run the tool %s%s%s:%s%s" -msgstr "Не могу запустить инструмент %s%s%s:%s%s" - -#: lazarusidestrconsts:lisunabletosavefile -msgid "Unable to save file %s%s%s" -msgstr "Не могу сохранить файл %s%s%s" - -#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage -msgid "Unable to show method. Plz fix the error shown in the message window." -msgstr "Не могу показать метод. Исправьте ошибку, см. окно сообщений." - -#: lazarusidestrconsts:lisunabletostreamt -msgid "Unable to stream %s:T%s." -msgstr "Не могу сделать поток %s:T%s." - -#: lazarusidestrconsts:lisunabletostreamselectedcomponents -msgid "Unable to stream selected components" -msgstr "Не могу скопировать выбранные компоненты в поток" - -#: lazarusidestrconsts:lisunabletostreamselectedcomponents2 -msgid "Unable to stream selected components." -msgstr "" - -#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext -msgid "Unable to transform binary component stream of %s:T%s into text." -msgstr "Не могу перевести двоичный компонент потока %s:T%s в текст." - -#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource -msgid "Unable to update CreateForm statement in project source" -msgstr "Невозможно обновить выражение CreateForm в исходнике проекта" - -#: lazarusidestrconsts:lisunabletowrite -msgid "Unable to write %s%s%s%s%s." -msgstr "Не могу записать %s%s%s%s%s." - -#: lazarusidestrconsts:lisunabletowritefile -msgid "Unable to write file" -msgstr "Не могу записать файл" - -#: lazarusidestrconsts:lisunabletowritefile2 -msgid "Unable to write file %s%s%s" -msgstr "Не могу записать файл %s%s%s" - -#: lazarusidestrconsts:lisunabletowritefileerror -msgid "Unable to write file %s%s%s%sError: %s" -msgstr "Не могу записать файл %s%s%s%sError: %s" - -#: lazarusidestrconsts:lisunabletowritefilename -msgid "Unable to write file %s%s%s." -msgstr "Не могу записать файл %s%s%s." - -#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror -msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" -msgstr "Не могу записать пакет %s%s%s%sв файл %s%s%s.%sОшибка: %s" - -#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror -msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" -msgstr "Не могу записать файл состояния %s%s%s%sпакета %s.%sОшибка: %s" - -#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror -msgid "Unable to write state file for project %s%sError: %s" -msgstr "" - -#: lazarusidestrconsts:lisunabletowritetofile2 -msgid "Unable to write to file %s%s%s" -msgstr "Не могу записать в файл %s%s%s" - -#: lazarusidestrconsts:lisunabletowritetofile -msgid "Unable to write to file %s%s%s!" -msgstr "Не могу записать в файл %s%s%s!" - -#: lazarusidestrconsts:dlguncertopt -msgid "Uncertain Optimizations" -msgstr "Нестандартная оптимизация" - -#: lazarusidestrconsts:lismenuuncommentselection -msgid "Uncomment selection" -msgstr "Раскомментировать" - -#: lazarusidestrconsts:liscodetoolsdefsundefine -msgid "Undefine" -msgstr "Снять определение" - -#: lazarusidestrconsts:liscodetoolsdefsundefineall -msgid "Undefine All" -msgstr "Снять определение со всех" - -#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse -msgid "Undefine Recurse" -msgstr "Рекурсивно снять определение" - -#: lazarusidestrconsts:dlgedunder -msgid "Underline" -msgstr "Подчеркнутый" - -#: lazarusidestrconsts:lismenuundo -msgid "Undo" -msgstr "Отменить" - -#: lazarusidestrconsts:dlgundoaftersave -msgid "Undo after save" -msgstr "Откат после сохранения" - -#: lazarusidestrconsts:dlgundolimit -msgid "Undo limit" -msgstr "" - -#: lazarusidestrconsts:srkmecblockunindent -msgid "Unindent block" -msgstr "Отменить отделение блока" - -#: lazarusidestrconsts:lismenuunindentselection -msgid "Unindent selection" -msgstr "Сдвинуть блок влево" - -#: lazarusidestrconsts:lispckedituninstall -msgid "Uninstall" -msgstr "Деинсталлировать" - -#: lazarusidestrconsts:lispckexpluninstallonnextstart -msgid "Uninstall on next start" -msgstr "Деинсталлировать при след. пуске" - -#: lazarusidestrconsts:lispkgmanguninstallpackage2 -msgid "Uninstall package %s?" -msgstr "Деинсталлировать пакет %s?" - -#: lazarusidestrconsts:lispkgmanguninstallpackage -msgid "Uninstall package?" -msgstr "Деинсталлировать пакет?" - -#: lazarusidestrconsts:lisuninstallselection -msgid "Uninstall selection" -msgstr "Деинсталлировать выделение" - -#: lazarusidestrconsts:lispkgfiletypeunit -msgid "Unit" -msgstr "Модуль" - -#: lazarusidestrconsts:lisunithaschangedsave -msgid "Unit %s%s%s has changed. Save?" -msgstr "Модуль %s%s%s изменён. Сохранить?" - -#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage -msgid "Unit %s%s%s was removed from package" -msgstr "Модуль %s%s%s был удалён из пакета" - -#: lazarusidestrconsts:lisa2punitfilename2 -msgid "Unit File Name:" -msgstr "Имя файла модуля:" - -#: lazarusidestrconsts:uemshowunitinfo -msgid "Unit Info" -msgstr "Сведения о модуле" - -#: lazarusidestrconsts:lisa2punitnameinvalid -msgid "Unit Name Invalid" -msgstr "Имя модуля недопустимо" - -#: lazarusidestrconsts:lisa2punitname -msgid "Unit Name:" -msgstr "Имя модуля:" - -#: lazarusidestrconsts:lisaf2punitname -msgid "Unit Name: " -msgstr "Имя модуля: " - -#: lazarusidestrconsts:lisunitoutputdirectory -msgid "Unit Output directory" -msgstr "Каталог для генерации модулей" - -#: lazarusidestrconsts:lispkgdefsunitpath -msgid "Unit Path" -msgstr "Путь модуля" - -#: lazarusidestrconsts:dlgcounitstyle -msgid "Unit Style:" -msgstr "Стиль модулей:" - -#: lazarusidestrconsts:dlgunitdepcaption -msgid "Unit dependencies" -msgstr "Зависимости модуля" - -#: lazarusidestrconsts:lisa2punitfilename -msgid "Unit file name:" -msgstr "Имя файла модуля:" - -#: lazarusidestrconsts:lisunitidentifierexists -msgid "Unit identifier exists" -msgstr "Идентификатор модуля существует" - -#: lazarusidestrconsts:lisprojaddunitnamealreadyexists -msgid "Unit name already exists" -msgstr "Имя модуля уже есть" - -#: lazarusidestrconsts:lisunitnotfound -msgid "Unit not found" -msgstr "Модуль не найден" - -#: lazarusidestrconsts:lispkgsysunitnotfound -msgid "Unit not found: %s%s%s" -msgstr "Модуль не найден: %s%s%s" - -#: lazarusidestrconsts:dlgunitoutp -msgid "Unit output directory (-FE):" -msgstr "Каталог для генерации модулей (-FE):" - -#: lazarusidestrconsts:lisunitlfmfile -msgid "Unit: %s%sLFM file: %s" -msgstr "Модуль: %s%sФайл LFM: %s" - -#: lazarusidestrconsts:lisa2punitnamealreadyexists -msgid "Unitname already exists" -msgstr "Имя модуля уже есть" - -#: lazarusidestrconsts:lisunitnamealreadyexistscap -msgid "Unitname already in project" -msgstr "Модуль с таким именем уже в проекте" - -#: lazarusidestrconsts:lisunitsnotfound2 -msgid "Units not found" -msgstr "Модули не найдены" - -#: lazarusidestrconsts:lismenuviewunits -msgid "Units..." -msgstr "Модули..." - -#: lazarusidestrconsts:srvk_unknown -msgid "Unknown" -msgstr "Неизвестный" - -#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug -msgid "Unknown Error, please report this bug" -msgstr "Неизвестная ошибка, сообщите о ней" - -#: lazarusidestrconsts:lispkgmangunsavedpackage -msgid "Unsaved package" -msgstr "Несохранённый пакет" - -#: lazarusidestrconsts:dlgupword -msgid "Up" -msgstr "Вверх" - -#: lazarusidestrconsts:lisceoupdate -msgid "Update" -msgstr "" - -#: lazarusidestrconsts:lispckoptsupdaterebuild -msgid "Update/Rebuild" -msgstr "Обновить/перебрать" - -#: lazarusidestrconsts:lismenuuppercaseselection -msgid "Uppercase selection" -msgstr "Верхний регистр выделения" - -#: lazarusidestrconsts:lispckoptsusage -msgid "Usage" -msgstr "Использование" - -#: lazarusidestrconsts:dlgcoansistr -msgid "Use Ansi Strings" -msgstr "Использовать строки Ansi" - -#: lazarusidestrconsts:lisuseexcludefilter -msgid "Use Exclude Filter" -msgstr "" - -#: lazarusidestrconsts:dlgcoheaptrc -msgid "Use Heaptrc Unit" -msgstr "Использовать модуль Heaprc" - -#: lazarusidestrconsts:lisuseincludefilter -msgid "Use Include Filter" -msgstr "" - -#: lazarusidestrconsts:dlgusecustomconfig -msgid "Use addional Compiler Config File" -msgstr "Использовать дополнительный файл настроек компилятора" - -#: lazarusidestrconsts:dlgedusedefcolor -msgid "Use default color" -msgstr "Цвет по умолчанию" - -#: lazarusidestrconsts:dlgrunousedisplay -msgid "Use display" -msgstr "Использовать дисплей" - -#: lazarusidestrconsts:dlguselaunchingapp -msgid "Use launching application" -msgstr "Использовать приложение для запуска" - -#: lazarusidestrconsts:dlgusefpccfg -msgid "Use standard Compiler Config File (fpc.cfg)" -msgstr "Использовать стандартный файл настроек (fpc.cfg)" - -#: lazarusidestrconsts:dlgusesyntaxhighlight -msgid "Use syntax highlight" -msgstr "Подсветка синтаксиса" - -#: lazarusidestrconsts:lispkgmanguseunit -msgid "Use unit" -msgstr "Использовать модуль" - -#: lazarusidestrconsts:rsiwpusewindowmanagersetting -msgid "Use windowmanager setting" -msgstr "Взять настройки дисп. окон" - -#: lazarusidestrconsts:srkmecuserfirst -msgid "User First" -msgstr "Первый пользователь" - -#: lazarusidestrconsts:dlgedcustomext -msgid "User defined extension" -msgstr "Пользовательское расширение" - -#: lazarusidestrconsts:dlgcustomext -msgid "User defined extension (.pp.xxx)" -msgstr "Расширение пользователя (.pp.xxx)" - -#: lazarusidestrconsts:dlgrunouseroverrides -msgid "User overrides" -msgstr "Пользовательские замены" - -#: lazarusidestrconsts:dlgvaluecolor -msgid "Value" -msgstr "Значение" - -#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths -msgid "Value as File Paths" -msgstr "Значение как путь к файлу" - -#: lazarusidestrconsts:liscodetoolsdefsvalueastext -msgid "Value as Text" -msgstr "Значение как текст" - -#: lazarusidestrconsts:dlgrunovariable -msgid "Variable" -msgstr "Переменная" - -#: lazarusidestrconsts:lisctdefvariablename -msgid "Variable Name" -msgstr "Имя переменной" - -#: lazarusidestrconsts:dlgcdtvariableprefix -msgid "Variable prefix" -msgstr "Префикс переменной" - -#: lazarusidestrconsts:liscodetoolsdefsvariable -msgid "Variable:" -msgstr "Переменная:" - -#: lazarusidestrconsts:lisctdefvariable -msgid "Variable: %s" -msgstr "Переменная: %s" - -#: lazarusidestrconsts:dlgverbosity -msgid "Verbosity during compilation:" -msgstr "Подробность при компиляции:" - -#: lazarusidestrconsts:lisversion -msgid "Version" -msgstr "Версия" - -#: lazarusidestrconsts:lisvertical -msgid "Vertical" -msgstr "Вертикально" - -#: lazarusidestrconsts:dlggridyhint -msgid "Vertical grid step size" -msgstr "Вертикальный шаг сетки" - -#: lazarusidestrconsts:lismenuviewanchoreditor -msgid "View Anchor Editor" -msgstr "Показать редактор привязок" - -#: lazarusidestrconsts:uemviewcallstack -msgid "View Call Stack" -msgstr "Показать стек вызовов" - -#: lazarusidestrconsts:srkmectogglecodeexpl -msgid "View Code Explorer" -msgstr "Показать обозреватель кода" - -#: lazarusidestrconsts:lismenuviewcomponentpalette -msgid "View Component Palette" -msgstr "" - -#: lazarusidestrconsts:lishintviewforms -msgid "View Forms" -msgstr "Показать формы" - -#: lazarusidestrconsts:lismenuviewidespeedbuttons -msgid "View IDE speed buttons" -msgstr "" - -#: lazarusidestrconsts:lismenuviewjumphistory -msgid "View Jump-History" -msgstr "Просмотр истории переходов" - -#: lazarusidestrconsts:srkmectoggleobjectinsp -msgid "View Object Inspector" -msgstr "Показать Инспектор Объектов" - -#: lazarusidestrconsts:lispckeditviewpackgesource -msgid "View Package Source" -msgstr "Посмотреть исходник пакета" - -#: lazarusidestrconsts:lisviewprojectunits -msgid "View Project Units" -msgstr "Показать модули проекта" - -#: lazarusidestrconsts:srkmectogglesearchresults -msgid "View Search Results" -msgstr "Показать результаты поиска" - -#: lazarusidestrconsts:lismenuviewsource -msgid "View Source" -msgstr "Просмотр исходника" - -#: lazarusidestrconsts:lisviewsourcelfm -msgid "View Source (.lfm)" -msgstr "" - -#: lazarusidestrconsts:srkmectogglesourceeditor -msgid "View Source Editor" -msgstr "Показать редактор исходников" - -#: lazarusidestrconsts:lismenuviewprojecttodos -msgid "View ToDo List" -msgstr "Показать список ToDo" - -#: lazarusidestrconsts:lismenuviewunitdependencies -msgid "View Unit Dependencies" -msgstr "Показать зависимости модулей" - -#: lazarusidestrconsts:lismenuviewunitinfo -msgid "View Unit Information" -msgstr "Посмотреть сведения о модуле" - -#: lazarusidestrconsts:lishintviewunits -msgid "View Units" -msgstr "Показать модули" - -#: lazarusidestrconsts:srkmecviewanchoreditor -msgid "View anchor editor" -msgstr "Показать редактор привязок" - -#: lazarusidestrconsts:srkmectogglebreakpoints -msgid "View breakpoints" -msgstr "Просмотр точек останова" - -#: lazarusidestrconsts:srkmectogglecallstack -msgid "View call stack" -msgstr "Просмотр стека вызовов" - -#: lazarusidestrconsts:srkmectogglecomppalette -msgid "View component palette" -msgstr "" - -#: lazarusidestrconsts:srkmectoggledebuggerout -msgid "View debugger output" -msgstr "Просмотр вывода отладчика" - -#: lazarusidestrconsts:srkmecviewforms -msgid "View forms" -msgstr "Показать формы" - -#: lazarusidestrconsts:srkmectogglelocals -msgid "View local variables" -msgstr "Просмотр локальных переменных" - -#: lazarusidestrconsts:srkmcatviewmenu -msgid "View menu commands" -msgstr "Команды меню Просмотр" - -#: lazarusidestrconsts:srkmectogglemessages -msgid "View messages" -msgstr "Просмотр сообщений" - -#: lazarusidestrconsts:dlgmainviewforms -msgid "View project forms" -msgstr "Показать формы проекта" - -#: lazarusidestrconsts:dlgmainviewunits -msgid "View project units" -msgstr "Показать модули проекта" - -#: lazarusidestrconsts:srkmecviewunitdependencies -msgid "View unit dependencies" -msgstr "Показать зависимости модулей" - -#: lazarusidestrconsts:srkmecviewunitinfo -msgid "View unit information" -msgstr "Показать сведения о модуле" - -#: lazarusidestrconsts:srkmecviewunits -msgid "View units" -msgstr "Показать модули" - -#: lazarusidestrconsts:srkmectogglewatches -msgid "View watches" -msgstr "Показать наблюдения" - -#: lazarusidestrconsts:lishlpoptsviewers -msgid "Viewers" -msgstr "Просмотрщики" - -#: lazarusidestrconsts:lispkgfiletypevirtualunit -msgid "Virtual Unit" -msgstr "Виртуальный модуль" - -#: lazarusidestrconsts:lisaf2pisvirtualunit -msgid "Virtual unit (source is not in package)" -msgstr "Виртуальный модуль (исходник не в пакете)" - -#: lazarusidestrconsts:dlgvisiblegutter -msgid "Visible gutter" -msgstr "Видимое поле (лев)" - -#: lazarusidestrconsts:dlgvisiblerightmargin -msgid "Visible right margin" -msgstr "Правая видимая граница" - -#: lazarusidestrconsts:dlgambigwarn -msgid "Warn on compile" -msgstr "Предупр. при компиляции" - -#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena -msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." -msgstr "Внимание: дополнительный файл настроек компилятора имеет такое же имя, как может называться один из стандартных файлов настроек компилятора FreePascal. Это приведёт к использованию дополнительного файла и пропуску стандартного." - -#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject -msgid "Warning: The file %s%s%s%sbelongs to the current project." -msgstr "Внимание: Файл %s%s%s%sпринадлежит текущему проекту." - -#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis -msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" -msgstr "Предупреждение: найден двусмысленный файл %s%s%s. Исходник: %s%s%s" - -#: lazarusidestrconsts:lismenuviewwatches -msgid "Watches" -msgstr "Окно наблюдений" - -#: lazarusidestrconsts:dlgautocreatenewforms -msgid "When creating new forms, add them to auto-created forms" -msgstr "При создании новых форм добавить их к автосоздаваемым" - -#: lazarusidestrconsts:lisceowhenswitchingfile -msgid "When switching file in source editor" -msgstr "" - -#: lazarusidestrconsts:lisfindfilewhere -msgid "Where" -msgstr "Где" - -#: lazarusidestrconsts:dlgwholewordsonly -msgid "Whole Words Only" -msgstr "Только целые слова" - -#: lazarusidestrconsts:lisfindfilewholewordsonly -msgid "Whole words only" -msgstr "Только целые слова" - -#: lazarusidestrconsts:dlgwidthpos -msgid "Width:" -msgstr "Ширина:" - -#: lazarusidestrconsts:dlgwinpos -msgid "Window Positions" -msgstr "Позиции окна" - -#: lazarusidestrconsts:dlgwindows -msgid "Windows" -msgstr "Окна" - -#: lazarusidestrconsts:lislazbuildwithstaticpackages -msgid "With Packages" -msgstr "С пакетами" - -#: lazarusidestrconsts:liswordatcursorincurrenteditor -msgid "Word at cursor in current editor" -msgstr "Слово под курсором в этом редакторе" - -#: lazarusidestrconsts:srkmecwordcompletion -msgid "Word completion" -msgstr "Завершение слов" - -#: lazarusidestrconsts:dlgwordspolicies -msgid "Words" -msgstr "Слова" - -#: lazarusidestrconsts:lisedtexttoolworkingdirectory -msgid "Working Directory:" -msgstr "Рабочий каталог:" - -#: lazarusidestrconsts:dlgroworkingdirectory -msgid "Working directory" -msgstr "Рабочий каталог" - -#: lazarusidestrconsts:liswriteerror -msgid "Write Error" -msgstr "Ошибка записи" - -#: lazarusidestrconsts:dlgwritefpclogo -msgid "Write an FPC logo" -msgstr "Вывести логотип FPC" - -#: lazarusidestrconsts:liscodetoolsdefswriteerror -msgid "Write error" -msgstr "Ошибка записи" - -#: lazarusidestrconsts:dlgcdtwriteprefix -msgid "Write prefix" -msgstr "Префикс WRITE" - -#: lazarusidestrconsts:lisxmlfiles -msgid "XML files" -msgstr "XML файлы" - -#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling -msgid "You can not build lazarus while debugging or compiling." -msgstr "Вы не можете перебрать lazarus при отладке или компиляции." - -#: lazarusidestrconsts:dlgdoesnotexist -msgid "\" does not exist." -msgstr "\" не существует." - -#: lazarusidestrconsts:uefilerotext2 -msgid "\" is not writable." -msgstr "\" не для записи." - -#: lazarusidestrconsts:srkmecabortbuild -msgid "abort build" -msgstr "прервать сборку" - -#: lazarusidestrconsts:srkmecaddbreakpoint -msgid "add break point" -msgstr "добавить точку останова" - -#: lazarusidestrconsts:srkmecaddwatch -msgid "add watch" -msgstr "добавить наблюдение" - -#: lazarusidestrconsts:srvk_apps -msgid "application key" -msgstr "клавиша приложения" - -#: lazarusidestrconsts:lisoipautoinstalldynamic -msgid "auto install dynamic" -msgstr "автоустановить динамически" - -#: lazarusidestrconsts:lisoipautoinstallstatic -msgid "auto install static" -msgstr "автоустановить статически" - -#: lazarusidestrconsts:srkmecbuildall -msgid "build all files of program/project" -msgstr "собрать все файлы программы/проекта" - -#: lazarusidestrconsts:srkmecbuildfile -msgid "build file" -msgstr "собрать файл" - -#: lazarusidestrconsts:srkmecbuild -msgid "build program/project" -msgstr "собрать программу/проект" - -#: lazarusidestrconsts:dlglefttopclr -msgid "color for left, top" -msgstr "цвет слева сверху" - -#: lazarusidestrconsts:dlgrightbottomclr -msgid "color for right, bottom" -msgstr "цвет справа снизу" - -#: lazarusidestrconsts:srkmeccompileroptions -msgid "compiler options" -msgstr "параметры компилятора" - -#: lazarusidestrconsts:liscodetoolsdefscompilerpath -msgid "compiler path" -msgstr "путь к компилятору" - -#: lazarusidestrconsts:srkmecconfigbuildfile -msgid "config build file" -msgstr "файл настроек сборки" - -#: lazarusidestrconsts:liscustomoptions -msgid "custom options" -msgstr "опции пользователя" - -#: lazarusidestrconsts:liscodefault -msgid "default (%s)" -msgstr "по умолчанию (%s)" - -#: lazarusidestrconsts:srkmecevaluate -msgid "evaluate/modify" -msgstr "рассчитать/изменить" - -#: lazarusidestrconsts:lisfilewheredebugoutputiswritten -msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr "файл в который записывается отладочная инф-ция. Если он не определён, то отладочная инф-ция записывается в консоль." - -#: lazarusidestrconsts:lisuidinproject -msgid "in Project:" -msgstr "в проекте:" - -#: lazarusidestrconsts:lisfriinallopenpackagesandprojects -msgid "in all open packages and projects" -msgstr "во всех открытых пакетах и проектах" - -#: lazarusidestrconsts:lisfriincurrentunit -msgid "in current unit" -msgstr "в текущем модуле" - -#: lazarusidestrconsts:lisfriinmainproject -msgid "in main project" -msgstr "в главном проекте" - -#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit -msgid "in project/package owning current unit" -msgstr "в проекте/пакете, содержащем этот модуль" - -#: lazarusidestrconsts:lisincludepath -msgid "include path" -msgstr "путь включаемых" - -#: lazarusidestrconsts:srkmecinspect -msgid "inspect" -msgstr "проверить" - -#: lazarusidestrconsts:lisoipinstalleddynamic -msgid "installed dynamic" -msgstr "установлен динамически" - -#: lazarusidestrconsts:lisoipinstalledstatic -msgid "installed static" -msgstr "установлен статически" - -#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename -msgid "invalid Compiler filename" -msgstr "неправильное имя Компилятора" - -#: lazarusidestrconsts:lislazarusoptionsprojectfilename -msgid "lazarus [options] " -msgstr "lazarus [опции] <имя файла проекта>" - -#: lazarusidestrconsts:srvk_lwin -msgid "left windows key" -msgstr "Левая клавиша Windows" - -#: lazarusidestrconsts:lislibrarypath -msgid "library path" -msgstr "путь к библиотекам" - -#: lazarusidestrconsts:lislinkeroptions -msgid "linker options" -msgstr "параметры линкера" - -#: lazarusidestrconsts:dlgcdtlower -msgid "lowercase" -msgstr "нижний регистр" - -#: lazarusidestrconsts:lisprojectmakrounitpath -msgid "makro ProjectUnitPath" -msgstr "" - -#: lazarusidestrconsts:lisoipmissing -msgid "missing" -msgstr "отсутствует" - -#: lazarusidestrconsts:lisoipmodified -msgid "modified" -msgstr "изменён" - -#: lazarusidestrconsts:lisuidno -msgid "no" -msgstr "нет" - -#: lazarusidestrconsts:dlgnoautomaticrenaming -msgid "no automatic renaming" -msgstr "без автопереименования" - -#: lazarusidestrconsts:lisnoname -msgid "noname" -msgstr "без имени" - -#: lazarusidestrconsts:liscodetoolsdefsnoneselected -msgid "none selected" -msgstr "Ничего не выбрано" - -#: lazarusidestrconsts:lisobjectpath -msgid "object path" -msgstr "путь объекта" - -#: lazarusidestrconsts:lispckeditpackagenotsaved -msgid "package %s not saved" -msgstr "пакет %s не сохранён" - -#: lazarusidestrconsts:lispkgmangpackagemainsourcefile -msgid "package main source file" -msgstr "главный файл-исходник пакета" - -#: lazarusidestrconsts:srkmecpause -msgid "pause program" -msgstr "приостановить программу" - -#: lazarusidestrconsts:lisctpleaseselectamacro -msgid "please select a macro" -msgstr "" - -#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig -msgid "primary config directory, where Lazarus stores its config files. Default is " -msgstr "первая директория конфигураций, где Lazarus хранит свой конфигурационные файлы. По-умолчанию это " - -#: lazarusidestrconsts:lisoipreadonly -msgid "readonly" -msgstr "только чтение" - -#: lazarusidestrconsts:srkmecremovebreakpoint -msgid "remove break point" -msgstr "удалить точку останова" - -#: lazarusidestrconsts:srkmecresetdebugger -msgid "reset debugger" -msgstr "сброс отладчика" - -#: lazarusidestrconsts:srvk_rwin -msgid "right windows key" -msgstr "правая клавиша Windows" - -#: lazarusidestrconsts:srkmecrunfile -msgid "run file" -msgstr "запуск файла" - -#: lazarusidestrconsts:srkmecrunparameters -msgid "run parameters" -msgstr "параметры запуска" - -#: lazarusidestrconsts:srkmecrun -msgid "run program" -msgstr "запустить программу" - -#: lazarusidestrconsts:lissaveallmodified -msgid "save all modified files" -msgstr "Сохранить все измененные файлы" - -#: lazarusidestrconsts:lissavecurrenteditorfile -msgid "save current editor file" -msgstr "Сохранить текущий файл редактора" - -#: lazarusidestrconsts:lisfindfilesearchallfilesinproject -msgid "search all files in project" -msgstr "поиск во всех файлах проекта" - -#: lazarusidestrconsts:lisfindfilesearchallopenfiles -msgid "search all open files" -msgstr "поиск во всех открытых файлах" - -#: lazarusidestrconsts:lisfindfilesearchindirectories -msgid "search in directories" -msgstr "поиск в каталогах" - -#: lazarusidestrconsts:dlgtimesecondunit -msgid "sec" -msgstr "сек" - -#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor -msgid "secondary config directory, where Lazarus searches for config template files. Default is " -msgstr "" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi -msgid "set FPC mode to DELPHI" -msgstr "установить режим FPC в DELPHI" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc -msgid "set FPC mode to GPC" -msgstr "установить режим FPC в GPC" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetotp -msgid "set FPC mode to TP" -msgstr "установить режим FPC в TP" - -#: lazarusidestrconsts:lisedtdefsetiocheckson -msgid "set IOCHECKS on" -msgstr "Включить IOCHECKS" - -#: lazarusidestrconsts:lisedtdefsetoverflowcheckson -msgid "set OVERFLOWCHECKS on" -msgstr "Включить OVERFLOWCHECKS" - -#: lazarusidestrconsts:lisedtdefsetrangecheckson -msgid "set RANGECHECKS on" -msgstr "Включить RANGECHECKS" - -#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile -msgid "static packages config file" -msgstr "статический файл настроек пакета" - -#: lazarusidestrconsts:srkmecstopprogram -msgid "stop program" -msgstr "остановить программу" - -#: lazarusidestrconsts:listhishelpmessage -msgid "this help message" -msgstr "это справочное сообщение" - -#: lazarusidestrconsts:lisunitpath -msgid "unit path" -msgstr "путь модуля" - -#: lazarusidestrconsts:srkmecunknown -msgid "unknown editor command" -msgstr "Неизвестная команда редактора" - -#: lazarusidestrconsts:lisedtdefuseheaptrcunit -msgid "use HeapTrc unit" -msgstr "использовать модуль HeapTrc" - -#: lazarusidestrconsts:lisedtdefuselineinfounit -msgid "use LineInfo unit" -msgstr "использовать LineInfo" - -#: lazarusidestrconsts:lisuidyes -msgid "yes" -msgstr "да" - diff --git a/languages/objinspstrconsts.ru.po b/languages/objinspstrconsts.ru.po index d4e14c8d55..dbe59827dc 100644 --- a/languages/objinspstrconsts.ru.po +++ b/languages/objinspstrconsts.ru.po @@ -1,19 +1,21 @@ msgid "" msgstr "" -"Last-Translator: Vasily \n" -"PO-Revision-Date: 2003-01-15 22:38+0300\n" -"Language-Team: ru_RU.cp1251 \n" -"Content-Type: text/plain; charset=CP1251\n" +"Last-Translator: Maxim Ganetsky \n" +"PO-Revision-Date: 2006-02-11 20:11+0300\n" +"Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 0.9.6\n" +"POT-Creation-Date: \n" +"MIME-Version: 1.0\n" +"Project-Id-Version: \n" +"Language-Team: \n" #: objinspstrconsts:oisdlinesdchars msgid "%d lines, %d chars" -msgstr "" +msgstr "%d строк, %d символов" #: objinspstrconsts:oishelpalreadyregistered msgid "%s: Already registered" -msgstr "%s: Уже зарешистрирован" +msgstr "%s: Уже зарегистрирован" #: objinspstrconsts:oishelpnotregistered msgid "%s: Not registered" @@ -111,21 +113,21 @@ msgstr "" msgid "(All)" msgstr "(Р’СЃРµ)" +#: objinspstrconsts:oisnone +msgid "(none)" +msgstr "(нет)" + #: objinspstrconsts:cactionlisteditorunknowncategory msgid "(Unknown)" msgstr "(Неизвестно)" -#: objinspstrconsts:oisnone -msgid "(none)" -msgstr "" - #: objinspstrconsts:ois0lines0chars msgid "0 lines, 0 chars" -msgstr "" +msgstr "0 строк, 0 символов" #: objinspstrconsts:ois1linedchars msgid "1 line, %d chars" -msgstr "" +msgstr "1 строка, %d символов" #: objinspstrconsts:oisaction msgid "Action" @@ -137,11 +139,11 @@ msgstr "Редактор СЃРїРёСЃРєР° действий" #: objinspstrconsts:oicoleditadd msgid "Add" -msgstr "" +msgstr "Добавить" #: objinspstrconsts:sccsiledtopendialog msgid "Add Images" -msgstr "" +msgstr "Добавить изображения" #: objinspstrconsts:clbadd msgid "Add new Item" @@ -149,19 +151,19 @@ msgstr "" #: objinspstrconsts:nbcesaddpage msgid "Add page" -msgstr "" +msgstr "Добавить страницу" #: objinspstrconsts:oisaddtofavorites msgid "Add to Favorites" -msgstr "" +msgstr "Добавить РІ Рзбранное" #: objinspstrconsts:sccsiledtadd msgid "Add..." -msgstr "" +msgstr "Добавить..." #: objinspstrconsts:sccsiledtadjustment msgid "Adjustment" -msgstr "" +msgstr "Выравнивание" #: objinspstrconsts:oisall msgid "All" @@ -169,15 +171,15 @@ msgstr "Р’СЃРµ" #: objinspstrconsts:oisallfiles msgid "All files" -msgstr "" +msgstr "Р’СЃРµ файлы" #: objinspstrconsts:sccstredtapply msgid "Apply" -msgstr "" +msgstr "Применить" #: objinspstrconsts:oisarray msgid "Array" -msgstr "" +msgstr "Массив" #: objinspstrconsts:oisstdactionlisteditorclass msgid "Available Action Classes:" @@ -185,7 +187,7 @@ msgstr "" #: objinspstrconsts:oisboolean msgid "Boolean" -msgstr "" +msgstr "Boolean" #: objinspstrconsts:oishelpbrowsernotexecutable msgid "Browser %s%s%s not executable." @@ -201,11 +203,11 @@ msgstr "Рћ&чистить" #: objinspstrconsts:oistdactdatasetcancel1hint msgid "Cancel" -msgstr "" +msgstr "Отменить" #: objinspstrconsts:sccslvedtlabelcaption msgid "Caption:" -msgstr "" +msgstr "Заголовок:" #: objinspstrconsts:oiscategory msgid "Category" @@ -217,11 +219,11 @@ msgstr "" #: objinspstrconsts:oischar msgid "Char" -msgstr "" +msgstr "Char" #: objinspstrconsts:oischaractersforblanks msgid "Characters for Blanks" -msgstr "" +msgstr "Символы для пробелов" #: objinspstrconsts:clbcheckgroupeditor msgid "CheckGroup Editor" @@ -233,7 +235,7 @@ msgstr "" #: objinspstrconsts:oisclass msgid "Class" -msgstr "" +msgstr "Class" #: objinspstrconsts:sccsiledtclear msgid "Clear" @@ -241,19 +243,19 @@ msgstr "Очистить" #: objinspstrconsts:oisclearpicture msgid "Clear picture" -msgstr "" +msgstr "Очистить картинку" #: objinspstrconsts:oistdactcolorselecthint msgid "Color Select" -msgstr "" +msgstr "Выбор цвета" #: objinspstrconsts:oiscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" -msgstr "" +msgstr "РРјСЏ компонента %s%s%s РЅРµ является корректным идентификатором" #: objinspstrconsts:oiscomponents msgid "Components" -msgstr "" +msgstr "Компоненты" #: objinspstrconsts:oisconfirmdelete msgid "Confirm delete" @@ -261,15 +263,15 @@ msgstr "Подтвердить удаление" #: objinspstrconsts:oiscopy msgid "Copy" -msgstr "" +msgstr "Копировать" #: objinspstrconsts:oiscreateanewpascalunit msgid "Create a new pascal unit." -msgstr "" +msgstr "Создать новый модуль Паскаля." #: objinspstrconsts:oiscreatedefaultevent msgid "Create default event" -msgstr "" +msgstr "Создать событие РїРѕ умолчанию" #: objinspstrconsts:sccsiledtcrop msgid "Crop" @@ -277,27 +279,27 @@ msgstr "" #: objinspstrconsts:oistdacteditselectallshortcut msgid "Ctrl+A" -msgstr "" +msgstr "Ctrl+A" #: objinspstrconsts:oistdacteditcopyshortcut msgid "Ctrl+C" -msgstr "" +msgstr "Ctrl+C" #: objinspstrconsts:oistdactfileopenshortcut msgid "Ctrl+O" -msgstr "" +msgstr "Ctrl+O" #: objinspstrconsts:oistdacteditpasteshortcut msgid "Ctrl+V" -msgstr "" +msgstr "Ctrl+V" #: objinspstrconsts:oistdacteditcutshortcut msgid "Ctrl+X" -msgstr "" +msgstr "Ctrl+X" #: objinspstrconsts:oistdacteditundoshortcut msgid "Ctrl+Z" -msgstr "" +msgstr "Ctrl+Z" #: objinspstrconsts:oistdacteditcutheadline msgid "Cu&t" @@ -305,11 +307,11 @@ msgstr "" #: objinspstrconsts:oiscut msgid "Cut" -msgstr "" +msgstr "Вырезать" #: objinspstrconsts:cactionlisteditordatabasecategory msgid "Database" -msgstr "" +msgstr "База данных" #: objinspstrconsts:oistdacteditdeleteshortcut msgid "Del" @@ -329,7 +331,7 @@ msgstr "Удалить элемент %s%s%s?" #: objinspstrconsts:nbcesdeletepage msgid "Delete page" -msgstr "" +msgstr "Удалить страницу" #: objinspstrconsts:clbdelete msgid "Delete the Item %d \"%s\"?" @@ -337,7 +339,7 @@ msgstr "" #: objinspstrconsts:cactionlisteditordialogcategory msgid "Dialog" -msgstr "" +msgstr "Диалог" #: objinspstrconsts:clbdown msgid "Do&wn" @@ -345,7 +347,7 @@ msgstr "" #: objinspstrconsts:oicoleditdown msgid "Down" -msgstr "" +msgstr "Р’РЅРёР·" #: objinspstrconsts:oistdactfileexitheadline msgid "E&xit" @@ -353,7 +355,11 @@ msgstr "" #: objinspstrconsts:cactionlisteditoreditcategory msgid "Edit" -msgstr "" +msgstr "Редактировать" + +#: objinspstrconsts:oiseditactionlist +msgid "Edit action list..." +msgstr "Правка СЃРїРёСЃРєР° действий..." #: objinspstrconsts:sccslvedt msgid "Edit ListView Items..." @@ -363,13 +369,9 @@ msgstr "" msgid "Edit TreeView Items..." msgstr "" -#: objinspstrconsts:oiseditactionlist -msgid "Edit action list..." -msgstr "Правка СЃРїРёСЃРєР° действий..." - #: objinspstrconsts:oicoleditediting msgid "Editing" -msgstr "" +msgstr "Редактирование" #: objinspstrconsts:oisenumeration msgid "Enumeration" @@ -397,43 +399,35 @@ msgstr "События" #: objinspstrconsts:oistdactfileexithint msgid "Exit" -msgstr "" +msgstr "Выход" #: objinspstrconsts:oisfavorites msgid "Favorites" -msgstr "" +msgstr "Рзбранное" #: objinspstrconsts:cactionlisteditorfilecategory msgid "File" -msgstr "" +msgstr "Файл" #: objinspstrconsts:oistdactdatasetfirsthint msgid "First" -msgstr "" +msgstr "Первый" #: objinspstrconsts:oisfloat msgid "Float" -msgstr "" +msgstr "Float" #: objinspstrconsts:oistdactfontedithint msgid "Font Select" -msgstr "" +msgstr "Выбор шрифта" #: objinspstrconsts:cactionlisteditorhelpcategory msgid "Help" -msgstr "" +msgstr "Помощь" #: objinspstrconsts:oistdacthelpcontentshint msgid "Help Contents" -msgstr "" - -#: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype -msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" -msgstr "Справочная база %s%s%s РЅРµ нашла просмотрщика для страницы справки типа %s" - -#: objinspstrconsts:oishelphelpdatabasenotfound -msgid "Help Database %s%s%s not found" -msgstr "Справочная база %s%s%s РЅРµ найдена" +msgstr "Содержание помощи" #: objinspstrconsts:oishelphelpcontextnotfoundindatabase msgid "Help context %s not found in Database %s%s%s." @@ -443,6 +437,14 @@ msgstr "Контекст справки %s РЅРµ найден РІ Базе дан msgid "Help context %s not found." msgstr "Контекст справки %s РЅРµ найден." +#: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype +msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" +msgstr "Справочная база %s%s%s РЅРµ нашла просмотрщика для страницы справки типа %s" + +#: objinspstrconsts:oishelphelpdatabasenotfound +msgid "Help Database %s%s%s not found" +msgstr "Справочная база %s%s%s РЅРµ найдена" + #: objinspstrconsts:oishelphelpkeywordnotfoundindatabase msgid "Help keyword %s%s%s not found in Database %s%s%s." msgstr "Справочный ключ %s%s%s РЅРµ найден РІ базе данных %s%s%s" @@ -457,7 +459,7 @@ msgstr "Справочный элемент %s%s%s РЅРµ имеет справо #: objinspstrconsts:oistdacthelphelphelphint msgid "Help on help" -msgstr "" +msgstr "Помощь Рє помощи" #: objinspstrconsts:sccstredtlabelimageindex msgid "Image Index:" @@ -469,7 +471,7 @@ msgstr "" #: objinspstrconsts:sccsiledtgrplcaption msgid "Images" -msgstr "" +msgstr "Рзображения" #: objinspstrconsts:oisinputmask msgid "Input Mask:" @@ -477,27 +479,27 @@ msgstr "" #: objinspstrconsts:oistdactdatasetinserthint msgid "Insert" -msgstr "" +msgstr "Вставить" #: objinspstrconsts:nbcesinsertpage msgid "Insert page" -msgstr "" +msgstr "Вставить страницу" #: objinspstrconsts:oisint64 msgid "Int64" -msgstr "" +msgstr "Int64" #: objinspstrconsts:oisinteger msgid "Integer" -msgstr "" +msgstr "Integer" #: objinspstrconsts:oisinterface msgid "Interface" -msgstr "интерфейс" +msgstr "Interface" #: objinspstrconsts:oisinvalidpropertyvalue msgid "Invalid property value" -msgstr "" +msgstr "Неверное значение свойства" #: objinspstrconsts:sccstredtitem msgid "Item" @@ -513,7 +515,7 @@ msgstr "" #: objinspstrconsts:oistdactdatasetlasthint msgid "Last" -msgstr "" +msgstr "Последний" #: objinspstrconsts:sccslvedtcaption msgid "ListView Items Editor" @@ -521,7 +523,7 @@ msgstr "" #: objinspstrconsts:sccstredtload msgid "Load" -msgstr "" +msgstr "Загрузить" #: objinspstrconsts:oisloadimagedialog msgid "Load Image Dialog" @@ -529,11 +531,11 @@ msgstr "Диалог загрузки изображения" #: objinspstrconsts:oisloadpicture msgid "Load picture" -msgstr "" +msgstr "Загрузить картинку" #: objinspstrconsts:oismasks msgid "Masks..." -msgstr "" +msgstr "Маски..." #: objinspstrconsts:oismethod msgid "Method" @@ -547,10 +549,6 @@ msgstr "" msgid "Move Down" msgstr "" -#: objinspstrconsts:sccsiledtmoveup -msgid "Move Up" -msgstr "" - #: objinspstrconsts:nbcesmovepageleft msgid "Move page left" msgstr "" @@ -559,6 +557,10 @@ msgstr "" msgid "Move page right" msgstr "" +#: objinspstrconsts:sccsiledtmoveup +msgid "Move Up" +msgstr "" + #: objinspstrconsts:cactionlisteditornewaction msgid "New Action" msgstr "" @@ -577,16 +579,16 @@ msgstr "" #: objinspstrconsts:oistdactdatasetnexthint msgid "Next" -msgstr "" +msgstr "Следующий" + +#: objinspstrconsts:oishelpnohelpfoundforsource +msgid "No help found for line %d, column %d of %s." +msgstr "РќРµ найдена помощь для строки %d, столбца %d файла %s." #: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" msgstr "РќРµ найдено браузера HTML.%sОпределите его РІ Справка->Настроить справку->Просмотрщики" -#: objinspstrconsts:oishelpnohelpfoundforsource -msgid "No help found for line %d, column %d of %s." -msgstr "" - #: objinspstrconsts:sccsiledtnone msgid "None" msgstr "" @@ -597,23 +599,23 @@ msgstr "" #: objinspstrconsts:oisobjectinspector msgid "Object Inspector" -msgstr "инспектор объектов" +msgstr "Рнспектор объектов" #: objinspstrconsts:oisok2 msgid "Ok" -msgstr "" +msgstr "Ok" #: objinspstrconsts:sccstredtopendialog msgid "Open" -msgstr "" +msgstr "Открыть" #: objinspstrconsts:oisopenmaskfile msgid "Open masks file (*.dem)" -msgstr "" +msgstr "Открыть файл масок (*.dem)" #: objinspstrconsts:oisoptions msgid "Options" -msgstr "" +msgstr "Настройки" #: objinspstrconsts:oistdactdatasetpostheadline msgid "P&ost" @@ -625,7 +627,7 @@ msgstr "" #: objinspstrconsts:oispaste msgid "Paste" -msgstr "" +msgstr "Вставить" #: objinspstrconsts:clbdisable msgid "Popup to disable/enable items" @@ -637,7 +639,7 @@ msgstr "" #: objinspstrconsts:oistdactdatasetpriorhint msgid "Prior" -msgstr "" +msgstr "Предыдущий" #: objinspstrconsts:oisproperties msgid "Properties" @@ -645,27 +647,27 @@ msgstr "Свойства" #: objinspstrconsts:oispropertiesof msgid "Properties of %s" -msgstr "" +msgstr "Свойства %s" #: objinspstrconsts:oisrecord msgid "Record" -msgstr "" +msgstr "Запись" #: objinspstrconsts:oistdactdatasetrefreshhint msgid "Refresh" -msgstr "" +msgstr "Обновить" #: objinspstrconsts:oisremovefromfavorites msgid "Remove from Favorites" -msgstr "" +msgstr "Удалить РёР· Рзбранного" #: objinspstrconsts:oissamplemasks msgid "Sample Masks:" -msgstr "" +msgstr "Образцы Масок:" #: objinspstrconsts:sccstredtsave msgid "Save" -msgstr "" +msgstr "Сохранить" #: objinspstrconsts:oistdactfilesaveasheadline msgid "Save &As..." @@ -673,11 +675,11 @@ msgstr "" #: objinspstrconsts:oistdactfilesaveashint msgid "Save As" -msgstr "" +msgstr "Сохранить как..." #: objinspstrconsts:sccsiledtsavedialog msgid "Save Image" -msgstr "" +msgstr "Сохранить изображение" #: objinspstrconsts:oissaveliteralcharacters msgid "Save Literal Characters" @@ -685,11 +687,11 @@ msgstr "" #: objinspstrconsts:oissavepicture msgid "Save picture" -msgstr "" +msgstr "Сохранить картинку" #: objinspstrconsts:sccsiledtsave msgid "Save..." -msgstr "" +msgstr "Сохранить..." #: objinspstrconsts:oistdacteditselectallheadline msgid "Select &All" @@ -703,21 +705,21 @@ msgstr "" msgid "Select &Font..." msgstr "" -#: objinspstrconsts:oistdacteditselectallshorthint -msgid "Select All" -msgstr "" - #: objinspstrconsts:oisselectafile msgid "Select a file" msgstr "Выберите файл" +#: objinspstrconsts:oistdacteditselectallshorthint +msgid "Select All" +msgstr "Выделить РІСЃС‘" + #: objinspstrconsts:sccsiledtgrprcaption msgid "Selected Image" -msgstr "" +msgstr "Выбранное изображение" #: objinspstrconsts:sccstredtlabelselindex msgid "Selected Index:" -msgstr "" +msgstr "Выбранный индекс:" #: objinspstrconsts:oisset msgid "Set" @@ -733,15 +735,15 @@ msgstr "Установить РїРѕ умолчанию: %s" #: objinspstrconsts:oisshowcomponenttree msgid "Show Component Tree" -msgstr "" +msgstr "Показывать Дерево компонентов" #: objinspstrconsts:oisshowhints msgid "Show Hints" -msgstr "" +msgstr "Показывать подсказки" #: objinspstrconsts:nbcesshowpage msgid "Show page ..." -msgstr "" +msgstr "Показать страницу ..." #: objinspstrconsts:oissort msgid "Sort" @@ -757,19 +759,19 @@ msgstr "" #: objinspstrconsts:sccsiledtstretch msgid "Stretch" -msgstr "" +msgstr "Растянуть" #: objinspstrconsts:oisstring msgid "String" -msgstr "" +msgstr "String" #: objinspstrconsts:cesstringgrideditor2 msgid "StringGrid Editor" -msgstr "Редактор Сетки строк" +msgstr "Редактор StringGrid" #: objinspstrconsts:cesstringgrideditor msgid "StringGrid Editor ..." -msgstr "Редактор Сетки строк ..." +msgstr "Редактор StringGrid ..." #: objinspstrconsts:oisstringseditordialog msgid "Strings Editor Dialog" @@ -777,11 +779,11 @@ msgstr "Диалог РІРІРѕРґР° строк" #: objinspstrconsts:oistestinput msgid "Test Input" -msgstr "" +msgstr "Тестовый РІРІРѕРґ" #: objinspstrconsts:sccstredtlabeltext msgid "Text:" -msgstr "" +msgstr "Текст:" #: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile msgid "The help database %s%s%s was unable to find file %s%s%s." @@ -793,15 +795,15 @@ msgstr "Макрос %s РІ параметрах РѕР±Р·РѕСЂР° будер заме #: objinspstrconsts:cactionlisteditorpaneltoolbar msgid "Toolbar" -msgstr "" +msgstr "Панель инструментов" #: objinspstrconsts:oistdacthelptopicsearchhint msgid "Topic Search" -msgstr "" +msgstr "РџРѕРёСЃРє темы" #: objinspstrconsts:sccsiledtransparentcolor msgid "Transparent Color:" -msgstr "" +msgstr "Прозрачный цвет:" #: objinspstrconsts:sccstredtcaption msgid "TreeView Items Editor" @@ -809,7 +811,7 @@ msgstr "" #: objinspstrconsts:oisundo msgid "Undo" -msgstr "" +msgstr "Отменить" #: objinspstrconsts:oisunknown msgid "Unknown" @@ -817,7 +819,7 @@ msgstr "Неизвестный" #: objinspstrconsts:oicoleditup msgid "Up" -msgstr "" +msgstr "Вверх" #: objinspstrconsts:oisvalue msgid "Value:" @@ -825,9 +827,9 @@ msgstr "Значение:" #: objinspstrconsts:oisvariant msgid "Variant" -msgstr "" +msgstr "Variant" #: objinspstrconsts:oisword msgid "Word" -msgstr "" +msgstr "Word" diff --git a/languages/objinspstrconsts.ruold.po b/languages/objinspstrconsts.ruold.po deleted file mode 100644 index 9787e7acfd..0000000000 --- a/languages/objinspstrconsts.ruold.po +++ /dev/null @@ -1,833 +0,0 @@ -msgid "" -msgstr "" -"Last-Translator: Vasily \n" -"PO-Revision-Date: 2003-01-15 22:38+0300\n" -"Language-Team: ru_RU.cp1251 \n" -"Content-Type: text/plain; charset=CP1251\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 0.9.6\n" - -#: objinspstrconsts:oisdlinesdchars -msgid "%d lines, %d chars" -msgstr "" - -#: objinspstrconsts:oishelpalreadyregistered -msgid "%s: Already registered" -msgstr "%s: хЦЕ ЪБТЕЫЙУФТЙТПЧБО" - -#: objinspstrconsts:oishelpnotregistered -msgid "%s: Not registered" -msgstr "%s: оЕ ЪБТЕЗЙУФТЙТПЧБО" - -#: objinspstrconsts:oisitemsselected -msgid "%u items selected" -msgstr "%u ЬМЕНЕОФПЧ ЧЩВТБОП" - -#: objinspstrconsts:oiscadd -msgid "&Add" -msgstr "&дПВБЧЙФШ" - -#: objinspstrconsts:oistdactdatasetcancelheadline -msgid "&Cancel" -msgstr "&пФНЕОБ" - -#: objinspstrconsts:oistdacthelpcontentsheadline -msgid "&Contents" -msgstr "" - -#: objinspstrconsts:oistdacteditcopyheadline -msgid "&Copy" -msgstr "" - -#: objinspstrconsts:oiscdelete -msgid "&Delete" -msgstr "&хДБМЙФШ" - -#: objinspstrconsts:oistdactdataseteditheadline -msgid "&Edit" -msgstr "" - -#: objinspstrconsts:oistdactdatasetfirstheadline -msgid "&First" -msgstr "" - -#: objinspstrconsts:oistdacthelphelphelpheadline -msgid "&Help on Help" -msgstr "" - -#: objinspstrconsts:oistdactdatasetinsertheadline -msgid "&Insert" -msgstr "" - -#: objinspstrconsts:oistdactdatasetlastheadline -msgid "&Last" -msgstr "" - -#: objinspstrconsts:oisload -msgid "&Load" -msgstr "&ъБЗТХЪЙФШ" - -#: objinspstrconsts:oistdactdatasetnextheadline -msgid "&Next" -msgstr "" - -#: objinspstrconsts:oisok -msgid "&OK" -msgstr "" - -#: objinspstrconsts:oistdactfileopenheadline -msgid "&Open..." -msgstr "" - -#: objinspstrconsts:oistdacteditpasteheadline -msgid "&Paste" -msgstr "" - -#: objinspstrconsts:oistdactdatasetpriorheadline -msgid "&Prior" -msgstr "" - -#: objinspstrconsts:oistdactdatasetrefreshheadline -msgid "&Refresh" -msgstr "" - -#: objinspstrconsts:oissave -msgid "&Save" -msgstr "&уПИТБОЙФШ" - -#: objinspstrconsts:oistdacthelptopicsearchheadline -msgid "&Topic Search" -msgstr "" - -#: objinspstrconsts:oistdacteditundoheadline -msgid "&Undo" -msgstr "" - -#: objinspstrconsts:clbup -msgid "&Up" -msgstr "" - -#: objinspstrconsts:cactionlisteditorallcategory -msgid "(All)" -msgstr "(чУЕ)" - -#: objinspstrconsts:cactionlisteditorunknowncategory -msgid "(Unknown)" -msgstr "(оЕЙЪЧЕУФОП)" - -#: objinspstrconsts:oisnone -msgid "(none)" -msgstr "" - -#: objinspstrconsts:ois0lines0chars -msgid "0 lines, 0 chars" -msgstr "" - -#: objinspstrconsts:ois1linedchars -msgid "1 line, %d chars" -msgstr "" - -#: objinspstrconsts:oisaction -msgid "Action" -msgstr "дЕКУФЧЙЕ" - -#: objinspstrconsts:oisactionlisteditor -msgid "Action List Editor" -msgstr "тЕДБЛФПТ УРЙУЛБ ДЕКУФЧЙК" - -#: objinspstrconsts:oicoleditadd -msgid "Add" -msgstr "" - -#: objinspstrconsts:sccsiledtopendialog -msgid "Add Images" -msgstr "" - -#: objinspstrconsts:clbadd -msgid "Add new Item" -msgstr "" - -#: objinspstrconsts:nbcesaddpage -msgid "Add page" -msgstr "" - -#: objinspstrconsts:oisaddtofavorites -msgid "Add to Favorites" -msgstr "" - -#: objinspstrconsts:sccsiledtadd -msgid "Add..." -msgstr "" - -#: objinspstrconsts:sccsiledtadjustment -msgid "Adjustment" -msgstr "" - -#: objinspstrconsts:oisall -msgid "All" -msgstr "чУЕ" - -#: objinspstrconsts:oisallfiles -msgid "All files" -msgstr "" - -#: objinspstrconsts:sccstredtapply -msgid "Apply" -msgstr "" - -#: objinspstrconsts:oisarray -msgid "Array" -msgstr "" - -#: objinspstrconsts:oisstdactionlisteditorclass -msgid "Available Action Classes:" -msgstr "" - -#: objinspstrconsts:oisboolean -msgid "Boolean" -msgstr "" - -#: objinspstrconsts:oishelpbrowsernotexecutable -msgid "Browser %s%s%s not executable." -msgstr "рТПУНПФТЭЙЛ %s%s%s ОЕ ЙУРПМОСЕНЩК." - -#: objinspstrconsts:oishelpbrowsernotfound -msgid "Browser %s%s%s not found." -msgstr "рТПУНПФТЭЙЛ %s%s%s ОЕ ОБКДЕО." - -#: objinspstrconsts:oisclear -msgid "C&lear" -msgstr "п&ЮЙУФЙФШ" - -#: objinspstrconsts:oistdactdatasetcancel1hint -msgid "Cancel" -msgstr "" - -#: objinspstrconsts:sccslvedtlabelcaption -msgid "Caption:" -msgstr "" - -#: objinspstrconsts:oiscategory -msgid "Category" -msgstr "лБФЕЗПТЙС" - -#: objinspstrconsts:sccsiledtcenter -msgid "Center" -msgstr "" - -#: objinspstrconsts:oischar -msgid "Char" -msgstr "" - -#: objinspstrconsts:oischaractersforblanks -msgid "Characters for Blanks" -msgstr "" - -#: objinspstrconsts:clbcheckgroupeditor -msgid "CheckGroup Editor" -msgstr "" - -#: objinspstrconsts:clbchecklistboxeditor -msgid "CheckListBox Editor" -msgstr "" - -#: objinspstrconsts:oisclass -msgid "Class" -msgstr "" - -#: objinspstrconsts:sccsiledtclear -msgid "Clear" -msgstr "пЮЙУФЙФШ" - -#: objinspstrconsts:oisclearpicture -msgid "Clear picture" -msgstr "" - -#: objinspstrconsts:oistdactcolorselecthint -msgid "Color Select" -msgstr "" - -#: objinspstrconsts:oiscomponentnameisnotavalididentifier -msgid "Component name %s%s%s is not a valid identifier" -msgstr "" - -#: objinspstrconsts:oiscomponents -msgid "Components" -msgstr "" - -#: objinspstrconsts:oisconfirmdelete -msgid "Confirm delete" -msgstr "рПДФЧЕТДЙФШ ХДБМЕОЙЕ" - -#: objinspstrconsts:oiscopy -msgid "Copy" -msgstr "" - -#: objinspstrconsts:oiscreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "" - -#: objinspstrconsts:oiscreatedefaultevent -msgid "Create default event" -msgstr "" - -#: objinspstrconsts:sccsiledtcrop -msgid "Crop" -msgstr "" - -#: objinspstrconsts:oistdacteditselectallshortcut -msgid "Ctrl+A" -msgstr "" - -#: objinspstrconsts:oistdacteditcopyshortcut -msgid "Ctrl+C" -msgstr "" - -#: objinspstrconsts:oistdactfileopenshortcut -msgid "Ctrl+O" -msgstr "" - -#: objinspstrconsts:oistdacteditpasteshortcut -msgid "Ctrl+V" -msgstr "" - -#: objinspstrconsts:oistdacteditcutshortcut -msgid "Ctrl+X" -msgstr "" - -#: objinspstrconsts:oistdacteditundoshortcut -msgid "Ctrl+Z" -msgstr "" - -#: objinspstrconsts:oistdacteditcutheadline -msgid "Cu&t" -msgstr "" - -#: objinspstrconsts:oiscut -msgid "Cut" -msgstr "" - -#: objinspstrconsts:cactionlisteditordatabasecategory -msgid "Database" -msgstr "" - -#: objinspstrconsts:oistdacteditdeleteshortcut -msgid "Del" -msgstr "" - -#: objinspstrconsts:oisdelete -msgid "Delete" -msgstr "хДБМЙФШ" - -#: objinspstrconsts:cactionlisteditordeleteactionhint -msgid "Delete Action" -msgstr "" - -#: objinspstrconsts:oisdeleteitem -msgid "Delete item %s%s%s?" -msgstr "хДБМЙФШ ЬМЕНЕОФ %s%s%s?" - -#: objinspstrconsts:nbcesdeletepage -msgid "Delete page" -msgstr "" - -#: objinspstrconsts:clbdelete -msgid "Delete the Item %d \"%s\"?" -msgstr "" - -#: objinspstrconsts:cactionlisteditordialogcategory -msgid "Dialog" -msgstr "" - -#: objinspstrconsts:clbdown -msgid "Do&wn" -msgstr "" - -#: objinspstrconsts:oicoleditdown -msgid "Down" -msgstr "" - -#: objinspstrconsts:oistdactfileexitheadline -msgid "E&xit" -msgstr "" - -#: objinspstrconsts:cactionlisteditoreditcategory -msgid "Edit" -msgstr "" - -#: objinspstrconsts:sccslvedt -msgid "Edit ListView Items..." -msgstr "" - -#: objinspstrconsts:sccstredt -msgid "Edit TreeView Items..." -msgstr "" - -#: objinspstrconsts:oiseditactionlist -msgid "Edit action list..." -msgstr "рТБЧЛБ УРЙУЛБ ДЕКУФЧЙК..." - -#: objinspstrconsts:oicoleditediting -msgid "Editing" -msgstr "" - -#: objinspstrconsts:oisenumeration -msgid "Enumeration" -msgstr "рЕТЕЮЙУМЕОЙЕ" - -#: objinspstrconsts:oiserror -msgid "Error" -msgstr "пЫЙВЛБ" - -#: objinspstrconsts:oiserrorloadingimage -msgid "Error loading image" -msgstr "пЫЙВЛБ ЪБЗТХЪЛЙ ЙЪПВТБЦЕОЙС" - -#: objinspstrconsts:oiserrorloadingimage2 -msgid "Error loading image %s%s%s:%s%s" -msgstr "пЫЙВЛБ ЪБЗТХЪЛЙ ЙЪПВТБЦЕОЙС %s%s%s:%s%s" - -#: objinspstrconsts:oishelperrorwhileexecuting -msgid "Error while executing %s%s%s:%s%s" -msgstr "пЫЙВЛБ РТЙ ЧЩРПМОЕОЙЙ %s%s%s:%s%s" - -#: objinspstrconsts:oisevents -msgid "Events" -msgstr "уПВЩФЙС" - -#: objinspstrconsts:oistdactfileexithint -msgid "Exit" -msgstr "" - -#: objinspstrconsts:oisfavorites -msgid "Favorites" -msgstr "" - -#: objinspstrconsts:cactionlisteditorfilecategory -msgid "File" -msgstr "" - -#: objinspstrconsts:oistdactdatasetfirsthint -msgid "First" -msgstr "" - -#: objinspstrconsts:oisfloat -msgid "Float" -msgstr "" - -#: objinspstrconsts:oistdactfontedithint -msgid "Font Select" -msgstr "" - -#: objinspstrconsts:cactionlisteditorhelpcategory -msgid "Help" -msgstr "" - -#: objinspstrconsts:oistdacthelpcontentshint -msgid "Help Contents" -msgstr "" - -#: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype -msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" -msgstr "уРТБЧПЮОБС ВБЪБ %s%s%s ОЕ ОБЫМБ РТПУНПФТЭЙЛБ ДМС УФТБОЙГЩ УРТБЧЛЙ ФЙРБ %s" - -#: objinspstrconsts:oishelphelpdatabasenotfound -msgid "Help Database %s%s%s not found" -msgstr "уРТБЧПЮОБС ВБЪБ %s%s%s ОЕ ОБКДЕОБ" - -#: objinspstrconsts:oishelphelpcontextnotfoundindatabase -msgid "Help context %s not found in Database %s%s%s." -msgstr "лПОФЕЛУФ УРТБЧЛЙ %s ОЕ ОБКДЕО Ч вБЪЕ ДБООЩИ %s%s%s." - -#: objinspstrconsts:oishelphelpcontextnotfound -msgid "Help context %s not found." -msgstr "лПОФЕЛУФ УРТБЧЛЙ %s ОЕ ОБКДЕО." - -#: objinspstrconsts:oishelphelpkeywordnotfoundindatabase -msgid "Help keyword %s%s%s not found in Database %s%s%s." -msgstr "уРТБЧПЮОЩК ЛМАЮ %s%s%s ОЕ ОБКДЕО Ч ВБЪЕ ДБООЩИ %s%s%s" - -#: objinspstrconsts:oishelphelpkeywordnotfound -msgid "Help keyword %s%s%s not found." -msgstr "уРТБЧПЮОЩК ЛМАЮ %s%s%s ОЕ ОБКДЕО" - -#: objinspstrconsts:oishelphelpnodehasnohelpdatabase -msgid "Help node %s%s%s has no Help Database" -msgstr "уРТБЧПЮОЩК ЬМЕНЕОФ %s%s%s ОЕ ЙНЕЕФ УРТБЧПЮОПК ВБЪЩ" - -#: objinspstrconsts:oistdacthelphelphelphint -msgid "Help on help" -msgstr "" - -#: objinspstrconsts:sccstredtlabelimageindex -msgid "Image Index:" -msgstr "" - -#: objinspstrconsts:sccsiledtcaption -msgid "ImageList Editor" -msgstr "" - -#: objinspstrconsts:sccsiledtgrplcaption -msgid "Images" -msgstr "" - -#: objinspstrconsts:oisinputmask -msgid "Input Mask:" -msgstr "" - -#: objinspstrconsts:oistdactdatasetinserthint -msgid "Insert" -msgstr "" - -#: objinspstrconsts:nbcesinsertpage -msgid "Insert page" -msgstr "" - -#: objinspstrconsts:oisint64 -msgid "Int64" -msgstr "" - -#: objinspstrconsts:oisinteger -msgid "Integer" -msgstr "" - -#: objinspstrconsts:oisinterface -msgid "Interface" -msgstr "йОФЕТЖЕКУ" - -#: objinspstrconsts:oisinvalidpropertyvalue -msgid "Invalid property value" -msgstr "" - -#: objinspstrconsts:sccstredtitem -msgid "Item" -msgstr "" - -#: objinspstrconsts:sccstredtgrprcaption -msgid "Item Properties" -msgstr "" - -#: objinspstrconsts:sccstredtgrplcaption -msgid "Items" -msgstr "" - -#: objinspstrconsts:oistdactdatasetlasthint -msgid "Last" -msgstr "" - -#: objinspstrconsts:sccslvedtcaption -msgid "ListView Items Editor" -msgstr "" - -#: objinspstrconsts:sccstredtload -msgid "Load" -msgstr "" - -#: objinspstrconsts:oisloadimagedialog -msgid "Load Image Dialog" -msgstr "дЙБМПЗ ЪБЗТХЪЛЙ ЙЪПВТБЦЕОЙС" - -#: objinspstrconsts:oisloadpicture -msgid "Load picture" -msgstr "" - -#: objinspstrconsts:oismasks -msgid "Masks..." -msgstr "" - -#: objinspstrconsts:oismethod -msgid "Method" -msgstr "нЕФПД" - -#: objinspstrconsts:clbmodify -msgid "Modify the Item" -msgstr "" - -#: objinspstrconsts:sccsiledtmovedown -msgid "Move Down" -msgstr "" - -#: objinspstrconsts:sccsiledtmoveup -msgid "Move Up" -msgstr "" - -#: objinspstrconsts:nbcesmovepageleft -msgid "Move page left" -msgstr "" - -#: objinspstrconsts:nbcesmovepageright -msgid "Move page right" -msgstr "" - -#: objinspstrconsts:cactionlisteditornewaction -msgid "New Action" -msgstr "" - -#: objinspstrconsts:sccstredtnewitem -msgid "New Item" -msgstr "" - -#: objinspstrconsts:cactionlisteditornewstdaction -msgid "New Standard Action" -msgstr "" - -#: objinspstrconsts:sccstredtnewsubitem -msgid "New SubItem" -msgstr "" - -#: objinspstrconsts:oistdactdatasetnexthint -msgid "Next" -msgstr "" - -#: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe -msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" -msgstr "оЕ ОБКДЕОП ВТБХЪЕТБ HTML.%sпРТЕДЕМЙФЕ ЕЗП Ч уРТБЧЛБ->оБУФТПЙФШ УРТБЧЛХ->рТПУНПФТЭЙЛЙ" - -#: objinspstrconsts:oishelpnohelpfoundforsource -msgid "No help found for line %d, column %d of %s." -msgstr "" - -#: objinspstrconsts:sccsiledtnone -msgid "None" -msgstr "" - -#: objinspstrconsts:oisobject -msgid "Object" -msgstr "" - -#: objinspstrconsts:oisobjectinspector -msgid "Object Inspector" -msgstr "йОУРЕЛФПТ ПВЯЕЛФПЧ" - -#: objinspstrconsts:oisok2 -msgid "Ok" -msgstr "" - -#: objinspstrconsts:sccstredtopendialog -msgid "Open" -msgstr "" - -#: objinspstrconsts:oisopenmaskfile -msgid "Open masks file (*.dem)" -msgstr "" - -#: objinspstrconsts:oisoptions -msgid "Options" -msgstr "" - -#: objinspstrconsts:oistdactdatasetpostheadline -msgid "P&ost" -msgstr "" - -#: objinspstrconsts:cactionlisteditorpaneldescrriptions -msgid "Panel Descriptions" -msgstr "" - -#: objinspstrconsts:oispaste -msgid "Paste" -msgstr "" - -#: objinspstrconsts:clbdisable -msgid "Popup to disable/enable items" -msgstr "" - -#: objinspstrconsts:oistdactdatasetposthint -msgid "Post" -msgstr "" - -#: objinspstrconsts:oistdactdatasetpriorhint -msgid "Prior" -msgstr "" - -#: objinspstrconsts:oisproperties -msgid "Properties" -msgstr "уЧПКУФЧБ" - -#: objinspstrconsts:oispropertiesof -msgid "Properties of %s" -msgstr "" - -#: objinspstrconsts:oisrecord -msgid "Record" -msgstr "" - -#: objinspstrconsts:oistdactdatasetrefreshhint -msgid "Refresh" -msgstr "" - -#: objinspstrconsts:oisremovefromfavorites -msgid "Remove from Favorites" -msgstr "" - -#: objinspstrconsts:oissamplemasks -msgid "Sample Masks:" -msgstr "" - -#: objinspstrconsts:sccstredtsave -msgid "Save" -msgstr "" - -#: objinspstrconsts:oistdactfilesaveasheadline -msgid "Save &As..." -msgstr "" - -#: objinspstrconsts:oistdactfilesaveashint -msgid "Save As" -msgstr "" - -#: objinspstrconsts:sccsiledtsavedialog -msgid "Save Image" -msgstr "" - -#: objinspstrconsts:oissaveliteralcharacters -msgid "Save Literal Characters" -msgstr "" - -#: objinspstrconsts:oissavepicture -msgid "Save picture" -msgstr "" - -#: objinspstrconsts:sccsiledtsave -msgid "Save..." -msgstr "" - -#: objinspstrconsts:oistdacteditselectallheadline -msgid "Select &All" -msgstr "" - -#: objinspstrconsts:oistdactcolorselect1headline -msgid "Select &Color..." -msgstr "" - -#: objinspstrconsts:oistdactfonteditheadline -msgid "Select &Font..." -msgstr "" - -#: objinspstrconsts:oistdacteditselectallshorthint -msgid "Select All" -msgstr "" - -#: objinspstrconsts:oisselectafile -msgid "Select a file" -msgstr "чЩВЕТЙФЕ ЖБКМ" - -#: objinspstrconsts:sccsiledtgrprcaption -msgid "Selected Image" -msgstr "" - -#: objinspstrconsts:sccstredtlabelselindex -msgid "Selected Index:" -msgstr "" - -#: objinspstrconsts:oisset -msgid "Set" -msgstr "" - -#: objinspstrconsts:oissettodefaultvalue -msgid "Set to default value" -msgstr "хУФБОПЧЙФШ Ч ЪОБЮЕОЙЕ РП ХНПМЮБОЙА" - -#: objinspstrconsts:oissettodefault -msgid "Set to default: %s" -msgstr "хУФБОПЧЙФШ РП ХНПМЮБОЙА: %s" - -#: objinspstrconsts:oisshowcomponenttree -msgid "Show Component Tree" -msgstr "" - -#: objinspstrconsts:oisshowhints -msgid "Show Hints" -msgstr "" - -#: objinspstrconsts:nbcesshowpage -msgid "Show page ..." -msgstr "" - -#: objinspstrconsts:oissort -msgid "Sort" -msgstr "уПТФЙТПЧЛБ" - -#: objinspstrconsts:oisstdactionlisteditor -msgid "Standard Action Classes" -msgstr "" - -#: objinspstrconsts:sccstredtlabelstateindex -msgid "State Index:" -msgstr "" - -#: objinspstrconsts:sccsiledtstretch -msgid "Stretch" -msgstr "" - -#: objinspstrconsts:oisstring -msgid "String" -msgstr "" - -#: objinspstrconsts:cesstringgrideditor2 -msgid "StringGrid Editor" -msgstr "тЕДБЛФПТ уЕФЛЙ УФТПЛ" - -#: objinspstrconsts:cesstringgrideditor -msgid "StringGrid Editor ..." -msgstr "тЕДБЛФПТ уЕФЛЙ УФТПЛ ..." - -#: objinspstrconsts:oisstringseditordialog -msgid "Strings Editor Dialog" -msgstr "дЙБМПЗ ЧЧПДБ УФТПЛ" - -#: objinspstrconsts:oistestinput -msgid "Test Input" -msgstr "" - -#: objinspstrconsts:sccstredtlabeltext -msgid "Text:" -msgstr "" - -#: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile -msgid "The help database %s%s%s was unable to find file %s%s%s." -msgstr "уРТБЧПЮОБС ВБЪБ %s%s%s ОЕ УНПЗМБ ОБКФЙ ЖБКМ %s%s%s." - -#: objinspstrconsts:oishelpthemacrosinbrowserparamswillbereplacedbytheurl -msgid "The macro %s in BrowserParams will be replaced by the URL." -msgstr "нБЛТПУ %s Ч РБТБНЕФТБИ ПВЪПТБ ВХДЕТ ЪБНЕОЈО ОБ URL." - -#: objinspstrconsts:cactionlisteditorpaneltoolbar -msgid "Toolbar" -msgstr "" - -#: objinspstrconsts:oistdacthelptopicsearchhint -msgid "Topic Search" -msgstr "" - -#: objinspstrconsts:sccsiledtransparentcolor -msgid "Transparent Color:" -msgstr "" - -#: objinspstrconsts:sccstredtcaption -msgid "TreeView Items Editor" -msgstr "" - -#: objinspstrconsts:oisundo -msgid "Undo" -msgstr "" - -#: objinspstrconsts:oisunknown -msgid "Unknown" -msgstr "оЕЙЪЧЕУФОЩК" - -#: objinspstrconsts:oicoleditup -msgid "Up" -msgstr "" - -#: objinspstrconsts:oisvalue -msgid "Value:" -msgstr "ъОБЮЕОЙЕ:" - -#: objinspstrconsts:oisvariant -msgid "Variant" -msgstr "" - -#: objinspstrconsts:oisword -msgid "Word" -msgstr "" - diff --git a/languages/objinspstrconsts.ruwin.po b/languages/objinspstrconsts.ruwin.po deleted file mode 100644 index 0a07df8895..0000000000 --- a/languages/objinspstrconsts.ruwin.po +++ /dev/null @@ -1,824 +0,0 @@ -#: objinspstrconsts:oisdlinesdchars -msgid "%d lines, %d chars" -msgstr "" - -#: objinspstrconsts:oishelpalreadyregistered -msgid "%s: Already registered" -msgstr "%s: уже зарегистрирован" - -#: objinspstrconsts:oishelpnotregistered -msgid "%s: Not registered" -msgstr "%s: не зарегистрирован" - -#: objinspstrconsts:oisitemsselected -msgid "%u items selected" -msgstr "%u элементов выбрано" - -#: objinspstrconsts:oiscadd -msgid "&Add" -msgstr "Добавить" - -#: objinspstrconsts:oistdactdatasetcancelheadline -msgid "&Cancel" -msgstr "Отмена" - -#: objinspstrconsts:oistdacthelpcontentsheadline -msgid "&Contents" -msgstr "Содержание" - -#: objinspstrconsts:oistdacteditcopyheadline -msgid "&Copy" -msgstr "Копировать" - -#: objinspstrconsts:oiscdelete -msgid "&Delete" -msgstr "удалить" - -#: objinspstrconsts:oistdactdataseteditheadline -msgid "&Edit" -msgstr "Правка" - -#: objinspstrconsts:oistdactdatasetfirstheadline -msgid "&First" -msgstr "первый" - -#: objinspstrconsts:oistdacthelphelphelpheadline -msgid "&Help on Help" -msgstr "Справка о справке" - -#: objinspstrconsts:oistdactdatasetinsertheadline -msgid "&Insert" -msgstr "Вставить" - -#: objinspstrconsts:oistdactdatasetlastheadline -msgid "&Last" -msgstr "Последний" - -#: objinspstrconsts:oisload -msgid "&Load" -msgstr "Загрузка" - -#: objinspstrconsts:oistdactdatasetnextheadline -msgid "&Next" -msgstr "Следующий" - -#: objinspstrconsts:oisok -msgid "&OK" -msgstr "OK" - -#: objinspstrconsts:oistdactfileopenheadline -msgid "&Open..." -msgstr "Открыть..." - -#: objinspstrconsts:oistdacteditpasteheadline -msgid "&Paste" -msgstr "Вставить" - -#: objinspstrconsts:oistdactdatasetpriorheadline -msgid "&Prior" -msgstr "Перед" - -#: objinspstrconsts:oistdactdatasetrefreshheadline -msgid "&Refresh" -msgstr "Обновить" - -#: objinspstrconsts:oissave -msgid "&Save" -msgstr "Сохранить" - -#: objinspstrconsts:oistdacthelptopicsearchheadline -msgid "&Topic Search" -msgstr "Поск по топикам" - -#: objinspstrconsts:oistdacteditundoheadline -msgid "&Undo" -msgstr "Отменить" - -#: objinspstrconsts:clbup -msgid "&Up" -msgstr "Вверх" - -#: objinspstrconsts:cactionlisteditorallcategory -msgid "(All)" -msgstr "(Все)" - -#: objinspstrconsts:cactionlisteditorunknowncategory -msgid "(Unknown)" -msgstr "(Неизвестный)" - -#: objinspstrconsts:oisnone -msgid "(none)" -msgstr "" - -#: objinspstrconsts:ois0lines0chars -msgid "0 lines, 0 chars" -msgstr "" - -#: objinspstrconsts:ois1linedchars -msgid "1 line, %d chars" -msgstr "" - -#: objinspstrconsts:oisaction -msgid "Action" -msgstr "Действие" - -#: objinspstrconsts:oisactionlisteditor -msgid "Action List Editor" -msgstr "Редактор списка действий" - -#: objinspstrconsts:oicoleditadd -msgid "Add" -msgstr "Добавить" - -#: objinspstrconsts:sccsiledtopendialog -msgid "Add Images" -msgstr "" - -#: objinspstrconsts:clbadd -msgid "Add new Item" -msgstr "Добавить новый элемент" - -#: objinspstrconsts:nbcesaddpage -msgid "Add page" -msgstr "Добавить страницу" - -#: objinspstrconsts:oisaddtofavorites -msgid "Add to Favorites" -msgstr "Добавить в избранное" - -#: objinspstrconsts:sccsiledtadd -msgid "Add..." -msgstr "" - -#: objinspstrconsts:sccsiledtadjustment -msgid "Adjustment" -msgstr "" - -#: objinspstrconsts:oisall -msgid "All" -msgstr "Все" - -#: objinspstrconsts:oisallfiles -msgid "All files" -msgstr "" - -#: objinspstrconsts:sccstredtapply -msgid "Apply" -msgstr "" - -#: objinspstrconsts:oisarray -msgid "Array" -msgstr "Массив" - -#: objinspstrconsts:oisstdactionlisteditorclass -msgid "Available Action Classes:" -msgstr "Доступные классы действий" - -#: objinspstrconsts:oisboolean -msgid "Boolean" -msgstr "" - -#: objinspstrconsts:oishelpbrowsernotexecutable -msgid "Browser %s%s%s not executable." -msgstr "Обозреватель %s%s%s не исполняемый файл" - -#: objinspstrconsts:oishelpbrowsernotfound -msgid "Browser %s%s%s not found." -msgstr "Обозреватель %s%s%s не найден" - -#: objinspstrconsts:oisclear -msgid "C&lear" -msgstr "Очистить" - -#: objinspstrconsts:oistdactdatasetcancel1hint -msgid "Cancel" -msgstr "Отмена" - -#: objinspstrconsts:sccslvedtlabelcaption -msgid "Caption:" -msgstr "" - -#: objinspstrconsts:oiscategory -msgid "Category" -msgstr "Категория" - -#: objinspstrconsts:sccsiledtcenter -msgid "Center" -msgstr "" - -#: objinspstrconsts:oischar -msgid "Char" -msgstr "Символ" - -#: objinspstrconsts:oischaractersforblanks -msgid "Characters for Blanks" -msgstr "" - -#: objinspstrconsts:clbcheckgroupeditor -msgid "CheckGroup Editor" -msgstr "Редактор CheckGroup" - -#: objinspstrconsts:clbchecklistboxeditor -msgid "CheckListBox Editor" -msgstr "Редактор CheckListBox" - -#: objinspstrconsts:oisclass -msgid "Class" -msgstr "Класс" - -#: objinspstrconsts:sccsiledtclear -msgid "Clear" -msgstr "Очистить" - -#: objinspstrconsts:oisclearpicture -msgid "Clear picture" -msgstr "Очистить картинку" - -#: objinspstrconsts:oistdactcolorselecthint -msgid "Color Select" -msgstr "Выбор цвета" - -#: objinspstrconsts:oiscomponentnameisnotavalididentifier -msgid "Component name %s%s%s is not a valid identifier" -msgstr "" - -#: objinspstrconsts:oiscomponents -msgid "Components" -msgstr "" - -#: objinspstrconsts:oisconfirmdelete -msgid "Confirm delete" -msgstr "Подтвердить удаление" - -#: objinspstrconsts:oiscopy -msgid "Copy" -msgstr "Копировать" - -#: objinspstrconsts:oiscreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "" - -#: objinspstrconsts:oiscreatedefaultevent -msgid "Create default event" -msgstr "Создать событие по умолчанию" - -#: objinspstrconsts:sccsiledtcrop -msgid "Crop" -msgstr "" - -#: objinspstrconsts:oistdacteditselectallshortcut -msgid "Ctrl+A" -msgstr "" - -#: objinspstrconsts:oistdacteditcopyshortcut -msgid "Ctrl+C" -msgstr "" - -#: objinspstrconsts:oistdactfileopenshortcut -msgid "Ctrl+O" -msgstr "" - -#: objinspstrconsts:oistdacteditpasteshortcut -msgid "Ctrl+V" -msgstr "" - -#: objinspstrconsts:oistdacteditcutshortcut -msgid "Ctrl+X" -msgstr "" - -#: objinspstrconsts:oistdacteditundoshortcut -msgid "Ctrl+Z" -msgstr "" - -#: objinspstrconsts:oistdacteditcutheadline -msgid "Cu&t" -msgstr "Вырезать" - -#: objinspstrconsts:oiscut -msgid "Cut" -msgstr "Вырезать" - -#: objinspstrconsts:cactionlisteditordatabasecategory -msgid "Database" -msgstr "База данных" - -#: objinspstrconsts:oistdacteditdeleteshortcut -msgid "Del" -msgstr "Удалить" - -#: objinspstrconsts:oisdelete -msgid "Delete" -msgstr "Удалить" - -#: objinspstrconsts:cactionlisteditordeleteactionhint -msgid "Delete Action" -msgstr "Удалить действие" - -#: objinspstrconsts:oisdeleteitem -msgid "Delete item %s%s%s?" -msgstr "Удалить элемент %s%s%s?" - -#: objinspstrconsts:nbcesdeletepage -msgid "Delete page" -msgstr "Удалить страницу" - -#: objinspstrconsts:clbdelete -msgid "Delete the Item %d \"%s\"?" -msgstr "Удалить элемент %d \"%s\"?" - -#: objinspstrconsts:cactionlisteditordialogcategory -msgid "Dialog" -msgstr "Диалог" - -#: objinspstrconsts:clbdown -msgid "Do&wn" -msgstr "Вниз" - -#: objinspstrconsts:oicoleditdown -msgid "Down" -msgstr "" - -#: objinspstrconsts:oistdactfileexitheadline -msgid "E&xit" -msgstr "Выход" - -#: objinspstrconsts:cactionlisteditoreditcategory -msgid "Edit" -msgstr "Правка" - -#: objinspstrconsts:sccslvedt -msgid "Edit ListView Items..." -msgstr "" - -#: objinspstrconsts:sccstredt -msgid "Edit TreeView Items..." -msgstr "" - -#: objinspstrconsts:oiseditactionlist -msgid "Edit action list..." -msgstr "Правка списка действий..." - -#: objinspstrconsts:oicoleditediting -msgid "Editing" -msgstr "" - -#: objinspstrconsts:oisenumeration -msgid "Enumeration" -msgstr "Порядковый" - -#: objinspstrconsts:oiserror -msgid "Error" -msgstr "Ошибка" - -#: objinspstrconsts:oiserrorloadingimage -msgid "Error loading image" -msgstr "Ошибка загрузки картинки" - -#: objinspstrconsts:oiserrorloadingimage2 -msgid "Error loading image %s%s%s:%s%s" -msgstr "Ошибка загрузки картинки %s%s%s:%s%s" - -#: objinspstrconsts:oishelperrorwhileexecuting -msgid "Error while executing %s%s%s:%s%s" -msgstr "Ошибка загрузки %s%s%s:%s%s" - -#: objinspstrconsts:oisevents -msgid "Events" -msgstr "События" - -#: objinspstrconsts:oistdactfileexithint -msgid "Exit" -msgstr "Выход" - -#: objinspstrconsts:oisfavorites -msgid "Favorites" -msgstr "Избранное" - -#: objinspstrconsts:cactionlisteditorfilecategory -msgid "File" -msgstr "Файл" - -#: objinspstrconsts:oistdactdatasetfirsthint -msgid "First" -msgstr "Первый" - -#: objinspstrconsts:oisfloat -msgid "Float" -msgstr "" - -#: objinspstrconsts:oistdactfontedithint -msgid "Font Select" -msgstr "Выбор шрифта" - -#: objinspstrconsts:cactionlisteditorhelpcategory -msgid "Help" -msgstr "Помощь" - -#: objinspstrconsts:oistdacthelpcontentshint -msgid "Help Contents" -msgstr "Содержание справки" - -#: objinspstrconsts:oishelphelpdatabasedidnotfoundaviewerforahelppageoftype -msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" -msgstr "База данных %s%s%s не нашла просмотрщик для просмотра справочной страницы типа %s" - -#: objinspstrconsts:oishelphelpdatabasenotfound -msgid "Help Database %s%s%s not found" -msgstr "База данных %s%s%s не найдена" - -#: objinspstrconsts:oishelphelpcontextnotfoundindatabase -msgid "Help context %s not found in Database %s%s%s." -msgstr "Содержание %s не найдено в базе данных %s%s%s" - -#: objinspstrconsts:oishelphelpcontextnotfound -msgid "Help context %s not found." -msgstr "Содержание %s не найдено" - -#: objinspstrconsts:oishelphelpkeywordnotfoundindatabase -msgid "Help keyword %s%s%s not found in Database %s%s%s." -msgstr "Слово %s%s%s не найдено в базе данных" - -#: objinspstrconsts:oishelphelpkeywordnotfound -msgid "Help keyword %s%s%s not found." -msgstr "Слово %s%s%s не найдено." - -#: objinspstrconsts:oishelphelpnodehasnohelpdatabase -msgid "Help node %s%s%s has no Help Database" -msgstr "" - -#: objinspstrconsts:oistdacthelphelphelphint -msgid "Help on help" -msgstr "Справка осправке" - -#: objinspstrconsts:sccstredtlabelimageindex -msgid "Image Index:" -msgstr "" - -#: objinspstrconsts:sccsiledtcaption -msgid "ImageList Editor" -msgstr "" - -#: objinspstrconsts:sccsiledtgrplcaption -msgid "Images" -msgstr "" - -#: objinspstrconsts:oisinputmask -msgid "Input Mask:" -msgstr "" - -#: objinspstrconsts:oistdactdatasetinserthint -msgid "Insert" -msgstr "Вставить" - -#: objinspstrconsts:nbcesinsertpage -msgid "Insert page" -msgstr "Вставить страницу" - -#: objinspstrconsts:oisint64 -msgid "Int64" -msgstr "" - -#: objinspstrconsts:oisinteger -msgid "Integer" -msgstr "" - -#: objinspstrconsts:oisinterface -msgid "Interface" -msgstr "Интерфейс" - -#: objinspstrconsts:oisinvalidpropertyvalue -msgid "Invalid property value" -msgstr "" - -#: objinspstrconsts:sccstredtitem -msgid "Item" -msgstr "" - -#: objinspstrconsts:sccstredtgrprcaption -msgid "Item Properties" -msgstr "" - -#: objinspstrconsts:sccstredtgrplcaption -msgid "Items" -msgstr "" - -#: objinspstrconsts:oistdactdatasetlasthint -msgid "Last" -msgstr "Последний" - -#: objinspstrconsts:sccslvedtcaption -msgid "ListView Items Editor" -msgstr "" - -#: objinspstrconsts:sccstredtload -msgid "Load" -msgstr "" - -#: objinspstrconsts:oisloadimagedialog -msgid "Load Image Dialog" -msgstr "Диалог загрузки картинки" - -#: objinspstrconsts:oisloadpicture -msgid "Load picture" -msgstr "Загрузить картинку" - -#: objinspstrconsts:oismasks -msgid "Masks..." -msgstr "" - -#: objinspstrconsts:oismethod -msgid "Method" -msgstr "Метод" - -#: objinspstrconsts:clbmodify -msgid "Modify the Item" -msgstr "Изменть элемент" - -#: objinspstrconsts:sccsiledtmovedown -msgid "Move Down" -msgstr "Переместить вниз" - -#: objinspstrconsts:sccsiledtmoveup -msgid "Move Up" -msgstr "Переместить вверх" - -#: objinspstrconsts:nbcesmovepageleft -msgid "Move page left" -msgstr "Переместить страниуцу влево" - -#: objinspstrconsts:nbcesmovepageright -msgid "Move page right" -msgstr "Переместить страницу вправо" - -#: objinspstrconsts:cactionlisteditornewaction -msgid "New Action" -msgstr "Новое действие" - -#: objinspstrconsts:sccstredtnewitem -msgid "New Item" -msgstr "" - -#: objinspstrconsts:cactionlisteditornewstdaction -msgid "New Standard Action" -msgstr "Новое стандартное действие" - -#: objinspstrconsts:sccstredtnewsubitem -msgid "New SubItem" -msgstr "" - -#: objinspstrconsts:oistdactdatasetnexthint -msgid "Next" -msgstr "Следующий" - -#: objinspstrconsts:oishelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe -msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" -msgstr "HTML броузер не найден. %sПожалуйста определите его в Справка-> Конфигурация справки -> Просмотрщики" - -#: objinspstrconsts:oishelpnohelpfoundforsource -msgid "No help found for line %d, column %d of %s." -msgstr "Справка не найдена для линии %d, колонки %d %s" - -#: objinspstrconsts:sccsiledtnone -msgid "None" -msgstr "" - -#: objinspstrconsts:oisobject -msgid "Object" -msgstr "Объект" - -#: objinspstrconsts:oisobjectinspector -msgid "Object Inspector" -msgstr "Инспектор объектов" - -#: objinspstrconsts:oisok2 -msgid "Ok" -msgstr "" - -#: objinspstrconsts:sccstredtopendialog -msgid "Open" -msgstr "Открыть" - -#: objinspstrconsts:oisopenmaskfile -msgid "Open masks file (*.dem)" -msgstr "" - -#: objinspstrconsts:oisoptions -msgid "Options" -msgstr "Опции" - -#: objinspstrconsts:oistdactdatasetpostheadline -msgid "P&ost" -msgstr "Отправить" - -#: objinspstrconsts:cactionlisteditorpaneldescrriptions -msgid "Panel Descriptions" -msgstr "Описание панели" - -#: objinspstrconsts:oispaste -msgid "Paste" -msgstr "Вставить" - -#: objinspstrconsts:clbdisable -msgid "Popup to disable/enable items" -msgstr "" - -#: objinspstrconsts:oistdactdatasetposthint -msgid "Post" -msgstr "Отправить" - -#: objinspstrconsts:oistdactdatasetpriorhint -msgid "Prior" -msgstr "Превый" - -#: objinspstrconsts:oisproperties -msgid "Properties" -msgstr "Свойства" - -#: objinspstrconsts:oispropertiesof -msgid "Properties of %s" -msgstr "" - -#: objinspstrconsts:oisrecord -msgid "Record" -msgstr "Записать" - -#: objinspstrconsts:oistdactdatasetrefreshhint -msgid "Refresh" -msgstr "Обновить" - -#: objinspstrconsts:oisremovefromfavorites -msgid "Remove from Favorites" -msgstr "Удалить из избранного" - -#: objinspstrconsts:oissamplemasks -msgid "Sample Masks:" -msgstr "" - -#: objinspstrconsts:sccstredtsave -msgid "Save" -msgstr "" - -#: objinspstrconsts:oistdactfilesaveasheadline -msgid "Save &As..." -msgstr "Сохранить как..." - -#: objinspstrconsts:oistdactfilesaveashint -msgid "Save As" -msgstr "Сохранить как" - -#: objinspstrconsts:sccsiledtsavedialog -msgid "Save Image" -msgstr "" - -#: objinspstrconsts:oissaveliteralcharacters -msgid "Save Literal Characters" -msgstr "" - -#: objinspstrconsts:oissavepicture -msgid "Save picture" -msgstr "Сохранить картинку" - -#: objinspstrconsts:sccsiledtsave -msgid "Save..." -msgstr "" - -#: objinspstrconsts:oistdacteditselectallheadline -msgid "Select &All" -msgstr "Выбрать всё" - -#: objinspstrconsts:oistdactcolorselect1headline -msgid "Select &Color..." -msgstr "Выбрать цвет..." - -#: objinspstrconsts:oistdactfonteditheadline -msgid "Select &Font..." -msgstr "Выбрать шрифт" - -#: objinspstrconsts:oistdacteditselectallshorthint -msgid "Select All" -msgstr "Выбрать всё" - -#: objinspstrconsts:oisselectafile -msgid "Select a file" -msgstr "Выбрать файл" - -#: objinspstrconsts:sccsiledtgrprcaption -msgid "Selected Image" -msgstr "" - -#: objinspstrconsts:sccstredtlabelselindex -msgid "Selected Index:" -msgstr "" - -#: objinspstrconsts:oisset -msgid "Set" -msgstr "Множество" - -#: objinspstrconsts:oissettodefaultvalue -msgid "Set to default value" -msgstr "Установить значение по умолчанию" - -#: objinspstrconsts:oissettodefault -msgid "Set to default: %s" -msgstr "Установить по умолчанию: %s" - -#: objinspstrconsts:oisshowcomponenttree -msgid "Show Component Tree" -msgstr "Показать дерево компонентов" - -#: objinspstrconsts:oisshowhints -msgid "Show Hints" -msgstr "Показать подсказку" - -#: objinspstrconsts:nbcesshowpage -msgid "Show page ..." -msgstr "Показать страницу ..." - -#: objinspstrconsts:oissort -msgid "Sort" -msgstr "Сортировка" - -#: objinspstrconsts:oisstdactionlisteditor -msgid "Standard Action Classes" -msgstr "Стандартые классы действий" - -#: objinspstrconsts:sccstredtlabelstateindex -msgid "State Index:" -msgstr "" - -#: objinspstrconsts:sccsiledtstretch -msgid "Stretch" -msgstr "" - -#: objinspstrconsts:oisstring -msgid "String" -msgstr "Строка" - -#: objinspstrconsts:cesstringgrideditor2 -msgid "StringGrid Editor" -msgstr "Редактор StringGrid" - -#: objinspstrconsts:cesstringgrideditor -msgid "StringGrid Editor ..." -msgstr "Редактор StringGrid ..." - -#: objinspstrconsts:oisstringseditordialog -msgid "Strings Editor Dialog" -msgstr "Диалог редактора строк" - -#: objinspstrconsts:oistestinput -msgid "Test Input" -msgstr "" - -#: objinspstrconsts:sccstredtlabeltext -msgid "Text:" -msgstr "" - -#: objinspstrconsts:oishelpthehelpdatabasewasunabletofindfile -msgid "The help database %s%s%s was unable to find file %s%s%s." -msgstr "Вспомогательная база данных %s%s%s не может найти файл %s%s%s." - -#: objinspstrconsts:oishelpthemacrosinbrowserparamswillbereplacedbytheurl -msgid "The macro %s in BrowserParams will be replaced by the URL." -msgstr "Макрос %s в BrowserParams будет заменём на URL" - -#: objinspstrconsts:cactionlisteditorpaneltoolbar -msgid "Toolbar" -msgstr "Панель инструментов" - -#: objinspstrconsts:oistdacthelptopicsearchhint -msgid "Topic Search" -msgstr "Поиск по топикам" - -#: objinspstrconsts:sccsiledtransparentcolor -msgid "Transparent Color:" -msgstr "" - -#: objinspstrconsts:sccstredtcaption -msgid "TreeView Items Editor" -msgstr "" - -#: objinspstrconsts:oisundo -msgid "Undo" -msgstr "Отмена" - -#: objinspstrconsts:oisunknown -msgid "Unknown" -msgstr "Не известно" - -#: objinspstrconsts:oicoleditup -msgid "Up" -msgstr "" - -#: objinspstrconsts:oisvalue -msgid "Value:" -msgstr "Значение:" - -#: objinspstrconsts:oisvariant -msgid "Variant" -msgstr "" - -#: objinspstrconsts:oisword -msgid "Word" -msgstr "Слово" - diff --git a/lcl/languages/lcl.ruold.po b/lcl/languages/lcl.ruold.po deleted file mode 100644 index 5a01963ed5..0000000000 --- a/lcl/languages/lcl.ruold.po +++ /dev/null @@ -1,632 +0,0 @@ -#: lclstrconsts:rsmodified -msgid " modified " -msgstr "" - -#: lclstrconsts:rssize -msgid " size " -msgstr "" - -#: lclstrconsts:rswarningunreleasedtimerinfos -msgid " WARNING: There are %d TimerInfo structures left, I'll free them" -msgstr " чойнбойе: пУФБМПУШ %d УФТХЛФХТ TimerInfo, С ЙИ ПУЧПВПЦДБА" - -#: lclstrconsts:rswarningunreleasedmessagesinqueue -msgid " WARNING: There are %d messages left in the queue! I'll free them" -msgstr " чойнбойе: ч ПЮЕТЕДЙ ПУФБМПУШ %d УППВЭЕОЙК! с ЙИ ХДБМСА" - -#: lclstrconsts:rswarningunreleaseddcsdump -msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" -msgstr " чойнбойе: оБКДЕОП %d ОЕПУЧПВПЦДЈООЩИ ЛПОФЕЛУФПЧ ХУФТПКУФЧ, УРЙУПЛ УН. ОЙЦЕ:" - -#: lclstrconsts:rswarningunreleasedgdiobjectsdump -msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:" -msgstr " чойнбойе: оБКДЕОП %d ОЕПУЧПВПЦДЈООЩИ GDIObject, УРЙУПЛ УН. ОЙЦЕ:" - -#: lclstrconsts:rswarningunremovedpaintmessages -msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left." -msgstr " чойнбойе: оБКДЕОП %s ОЕХДБМЈООЩИ LM_PAINT/LM_GtkPAINT УУЩМПЛ ОБ УППВЭЕОЙЕ." - -#: lclstrconsts:rsindexoutofbounds -msgid "%s Index %d out of bounds 0-%d" -msgstr "%s йОДЕЛУ %d ЧОЕ ДЙБРБЪПОБ 0-%d" - -#: lclstrconsts:rsisalreadyassociatedwith -msgid "%s is already associated with %s" -msgstr "%s ХЦЕ УПРПУФБЧМЕОП У %s" - -#: lclstrconsts:rspressoktoignoreandriskdatacorruptionpresscanceltok -msgid "%s%sPress Ok to ignore and risk data corruption.%sPress Cancel to kill the program." -msgstr "" - -#: lclstrconsts:rsmball -msgid "&All" -msgstr "&чУЕ" - -#: lclstrconsts:rsmbclose -msgid "&Close" -msgstr "&ъБЛТЩФШ" - -#: lclstrconsts:rsmbhelp -msgid "&Help" -msgstr "&уРТБЧЛБ" - -#: lclstrconsts:rsmbignore -msgid "&Ignore" -msgstr "&рТПРХУЛ" - -#: lclstrconsts:rsmbno -msgid "&No" -msgstr "&оЕФ" - -#: lclstrconsts:rsmbok -msgid "&OK" -msgstr "&пл" - -#: lclstrconsts:rsmbretry -msgid "&Retry" -msgstr "&рПЧФПТ" - -#: lclstrconsts:rsmbyes -msgid "&Yes" -msgstr "&дБ" - -#: lclstrconsts:rsfileinfofilenotfound -msgid "(file not found: \"%s\")" -msgstr "(ЖБКМ ОЕ ОБКДЕО: \"%s\")" - -#: lclstrconsts:rsgtkoptionclass -msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." -msgstr "" - -#: lclstrconsts:rsgtkoptiondisplay -msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." -msgstr "--display h:s:d уЧСЪБФШУС У ХЛБЪБООЩН УЕТЧЕТПН ЙЛУПЧ, ЗДЕ \"h\" - ЙНС ИПУФБ, \"s\" - ОПНЕТ УЕТЧЕТБ (ПВЩЮОП 0) Й \"d\" - ОПНЕТ ДЙУРМЕС (ПВЩЮОП ПРХУЛБАФ). еУМЙ --display ОЕ ХЛБЪБО, ЙУРПМШЪХЕФУС РЕТЕНЕООБС ПЛТХЦЕОЙС DISPLAY." - -#: lclstrconsts:rsgoptionfatalwarnings -msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." -msgstr "" - -#: lclstrconsts:rsgdkoptiondebug -msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." -msgstr "--gdk-debug flags чЛМАЮЙФШ ХЛБЪБООЩЕ ПФМБДПЮОЩЕ УППВЭЕОЙС GDK." - -#: lclstrconsts:rsgdkoptionnodebug -msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages." -msgstr "--gdk-no-debug flags чЩЛМАЮЙФШ ХЛБЪБООЩЕ ПФМБДПЮОЩЕ УППВЭЕОЙС GDK." - -#: lclstrconsts:rsgtkoptiondebug -msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages." -msgstr "--gtk-debug flags чЛМАЮЙФШ ХЛБЪБООЩЕ ПФМБДПЮОЩЕ УППВЭЕОЙС Gtk+." - -#: lclstrconsts:rsgtkoptionmodule -msgid "--gtk-module module Load the specified module at startup." -msgstr "--gtk-module НПДХМШ ъБЗТХЪЙФШ ХЛБЪБООЩК НПДХМШ РТЙ ЪБРХУЛЕ." - -#: lclstrconsts:rsgtkoptionnodebug -msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." -msgstr "--gtk-no-debug flags чЩЛМАЮФШ ХЛБЪБООЩЕ ПФМБДПЮОЩЕ УППВЭЕОЙС Gtk+." - -#: lclstrconsts:rsgtkoptionnotransient -msgid "--lcl-no-transient Do not set transient order for modal forms" -msgstr "--lcl-no-transient оЕ ХУФБОБЧМЙЧБФШ ЧТЕНЕООЩК РПТСДПЛ НПДБМШОЩИ ЖПТН" - -#: lclstrconsts:rsgtkoptionname -msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStr(0)." -msgstr "--name ЙНСРТПЗ хУФБОБЧМЙЧБЕФ ЙНС РТПЗТБННЩ Ч \"ЙНСРТПЗ\". еУМЙ ОЕ ХЛБЪБОП, ЙНС РТПЗТБННЩ ВХДЕФ ХУФБОПЧМЕОП Ч ParamStr(0)." - -#: lclstrconsts:rsgtkoptionnoxshm -msgid "--no-xshm Disable use of the X Shared Memory Extension." -msgstr "--no-xshm ъБРТЕФ ЙУРПМШЪПЧБОЙС ТБУЫЙТЕОЙК X РП ТБЪДЕМСЕНПК РБНСФЙ." - -#: lclstrconsts:rsgtkoptionsync -msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." -msgstr "--sync чЩЪПЧ XSynchronize (display, True) РПУМЕ ХУФБОПЧМЕОЙ УПЕДЙОЕОЙС У Xserver'ПН. ьФП ПВМЕЗЮБЕФ ПФМБДЛХ ПЫЙВПЛ РТПФПЛПМБ X, Ф.Л. ЪБРТПУЩ ВХЖЕТЙЪБГЙЙ X ВХДХФ ПФЛМАЮЕОЩ, Й ПЫЙВЛЙ X ВХДХФ РПМХЮЕОЩ УТБЪХ РПУМЕ ЪБРТПУБ РТПФПЛПМБ, ЛПФПТЩК ЧЩЪЧБМ ЬФХ ПЫЙВЛХ, ПВТБВПФБООХА УЕТЧЕТПН X." - -#: lclstrconsts:rsacontrolcannothaveitselfasparent -msgid "A control can't have itself as parent" -msgstr "ьМЕНЕОФ ХРТБЧМЕОЙС ОЕ НПЦЕФ ВЩФШ УБН УЕВЕ РПФПНЛПН" - -#: lclstrconsts:rsmbabort -msgid "Abort" -msgstr "уВТПУ" - -#: lclstrconsts:ifsvk_accept -msgid "Accept" -msgstr "" - -#: lclstrconsts:rsallfiles -msgid "All files (%s)|%s|%s" -msgstr "" - -#: lclstrconsts:ifsvk_back -msgid "Backspace" -msgstr "" - -#: lclstrconsts:rsbitmaps -msgid "Bitmaps" -msgstr "" - -#: lclstrconsts:rsblank -msgid "Blank" -msgstr "рХУФПК" - -#: lclstrconsts:rscalculator -msgid "Calculator" -msgstr "лБМШЛХМСФПТ" - -#: lclstrconsts:rscannotfocus -msgid "Can not focus" -msgstr "оЕ НПЗХ РТЙОСФШ ЖПЛХУ" - -#: lclstrconsts:rsmbcancel -msgid "Cancel" -msgstr "пФНЕОБ" - -#: lclstrconsts:scannotfocus -msgid "Cannot focus a disabled or invisible window" -msgstr "оЕМШЪС ДБФШ ЖПЛХУ ПФЛМАЮЈООПНХ ЙМЙ ОЕЧЙДЙНПНХ ПЛОХ" - -#: lclstrconsts:rscanvasdoesnotallowdrawing -msgid "Canvas does not allow drawing" -msgstr "лБОЧБ ОЕ РПДДЕТЦЙЧБЕФ ТЙУПЧБОЙС" - -#: lclstrconsts:ifsvk_capital -msgid "Capital" -msgstr "" - -#: lclstrconsts:ifsvk_clear -msgid "Clear" -msgstr "" - -#: lclstrconsts:rsmtconfirmation -msgid "Confirmation" -msgstr "рПДФЧЕТЦДЕОЙЕ" - -#: lclstrconsts:ifsvk_control -msgid "Control" -msgstr "" - -#: lclstrconsts:ifsvk_convert -msgid "Convert" -msgstr "" - -#: lclstrconsts:rscreatinggdbcatchableerror -msgid "Creating gdb catchable error:" -msgstr "уПЪДБОЙЕ ЛЕЫЙТХЕНПК ПЫЙВЛЙ gdb:" - -#: lclstrconsts:rsmtcustom -msgid "Custom" -msgstr "рПМШЪПЧБФЕМШУЛЙК" - -#: lclstrconsts:ifsvk_delete -msgid "Delete" -msgstr "" - -#: lclstrconsts:rsfddirectorymustexist -msgid "Directory must exist" -msgstr "лБФБМПЗ ДПМЦЕО УХЭЕУФЧПЧБФШ" - -#: lclstrconsts:rsdocking -msgid "Docking" -msgstr "" - -#: lclstrconsts:ifsvk_down -msgid "Down" -msgstr "" - -#: lclstrconsts:sduplicatemenus -msgid "Duplicate menus" -msgstr "рПЧФПТСАЭЙЕУС НЕОА" - -#: lclstrconsts:rserrorinlcl -msgid "ERROR in LCL: " -msgstr "пыйвлб Ч LCL:" - -#: lclstrconsts:ifsvk_end -msgid "End" -msgstr "" - -#: lclstrconsts:rsmterror -msgid "Error" -msgstr "пЫЙВЛБ" - -#: lclstrconsts:rserrorcreatingdevicecontext -msgid "Error creating device context for %s.%s" -msgstr "пЫЙВЛБ УПЪДБОЙС ЛПОФЕЛУФБ ХУФТПКУФЧБ ДМС %s.%s" - -#: lclstrconsts:rserroroccurredinataddressframe -msgid "Error occurred in %s at %sAddress %s%s Frame %s" -msgstr "рТПЙЪПЫМБ ПЫЙВЛБ Ч %s РП %s БДТЕУХ %s%s ЖТЕКН %s" - -#: lclstrconsts:rserrorreadingproperty -msgid "Error reading %s%s%s: %s" -msgstr "пЫЙВЛБ ЮФЕОЙС %s%s%s: %s" - -#: lclstrconsts:rswin32error -msgid "Error:" -msgstr "пЫЙВЛБ:" - -#: lclstrconsts:ifsvk_escape -msgid "Escape" -msgstr "" - -#: lclstrconsts:rsexception -msgid "Exception" -msgstr "йУЛМАЮЕОЙЕ" - -#: lclstrconsts:ifsvk_execute -msgid "Execute" -msgstr "" - -#: lclstrconsts:rsfileinformation -msgid "File information" -msgstr "йОЖПТНБГЙС П ЖБКМЕ" - -#: lclstrconsts:rsfdfilereadonlytitle -msgid "File is not writable" -msgstr "жБКМ ОЕ ДПУФХРЕО ДМС ЪБРЙУЙ" - -#: lclstrconsts:rsfdfilemustexist -msgid "File must exist" -msgstr "жБКМ ДПМЦЕО УХЭЕУФЧПЧБФШ" - -#: lclstrconsts:rsgtkfilter -msgid "Filter:" -msgstr "" - -#: lclstrconsts:ifsvk_final -msgid "Final" -msgstr "" - -#: lclstrconsts:rsfixedcolstoobig -msgid "FixedCols can't be >= ColCount" -msgstr "FixedCols ОЕ НПЦЕФ ВЩФШ >= ColCount" - -#: lclstrconsts:rsfixedrowstoobig -msgid "FixedRows can't be >= RowCount" -msgstr "FixedRows ОЕ НПЦЕФ ВЩФШ >= RowCount" - -#: lclstrconsts:rsformstreamingerror -msgid "Form streaming \"%s\" error: %s" -msgstr "пЫЙВЛБ РПФПЛПЧ \"%s\" ЖПТН: %s" - -#: lclstrconsts:rsgridfiledoesnotexists -msgid "Grid file doesn't exists" -msgstr "жБКМ УЕФЛЙ ОЕ УХЭЕУФЧХЕФ" - -#: lclstrconsts:rsgroupindexcannotbelessthanprevious -msgid "GroupIndex cannot be less than a previous menu item's GroupIndex" -msgstr "GroupIndex ОЕ НПЦЕФ ВЩФШ НЕОШЫЕ GroupIndex ДМС РТЕДЩДХЭЕЗП ЬМЕНЕОФБ НЕОА" - -#: lclstrconsts:ifsvk_hanja -msgid "Hanja" -msgstr "" - -#: lclstrconsts:ifsvk_help -msgid "Help" -msgstr "" - -#: lclstrconsts:rsgtkhistory -msgid "History:" -msgstr "" - -#: lclstrconsts:ifsvk_home -msgid "Home" -msgstr "" - -#: lclstrconsts:rsicon -msgid "Icon" -msgstr "" - -#: lclstrconsts:rsindexoutofrange -msgid "Index Out of range Cell[Col=%d Row=%d]" -msgstr "йОДЕЛУ ЧОЕ ДЙБРБЪПОБ Cell[Col=%d Row=%d]" - -#: lclstrconsts:rsmtinformation -msgid "Information" -msgstr "уЧЕДЕОЙС" - -#: lclstrconsts:ifsvk_insert -msgid "Insert" -msgstr "" - -#: lclstrconsts:rsinvaliddate -msgid "Invalid Date : %s" -msgstr "" - -#: lclstrconsts:rsinvaliddaterangehint -msgid "Invalid Date: %s. Must be between %s and %s" -msgstr "" - -#: lclstrconsts:sinvalidindex -msgid "Invalid ImageList Index" -msgstr "оЕРТБЧЙМШОЩК ЙОДЕЛУ ImageList" - -#: lclstrconsts:sinvalidactioncreation -msgid "Invalid action creation" -msgstr "оЕРТБЧЙМШОПЕ УПЪДБОЙЕ ДЕКУФЧЙС" - -#: lclstrconsts:sinvalidactionenumeration -msgid "Invalid action enumeration" -msgstr "оЕРТБЧЙМШОПЕ РЕТЕЮЙУМЕОЙЕ ДЕКУФЧЙК" - -#: lclstrconsts:sinvalidactionregistration -msgid "Invalid action registration" -msgstr "оЕРТБЧЙМШОБС ТЕЗЙУФТБГЙС ДЕКУФЧЙС" - -#: lclstrconsts:sinvalidactionunregistration -msgid "Invalid action unregistration" -msgstr "оЕРТБЧЙМШОБС ТБЪТЕЗЙУФТБГЙС ДЕКУФЧЙС" - -#: lclstrconsts:sinvalidimagesize -msgid "Invalid image size" -msgstr "оЕРТБЧЙМШОЩК ТБЪНЕТ ТЙУХОЛБ" - -#: lclstrconsts:rsinvalidpropertyvalue -msgid "Invalid property value" -msgstr "оЕРТБЧЙМШОПЕ ЪОБЮЕОЙЕ УЧПКУФЧБ" - -#: lclstrconsts:rsinvalidstreamformat -msgid "Invalid stream format" -msgstr "оЕРТБЧЙМШОЩК ЖПТНБФ РПФПЛБ" - -#: lclstrconsts:ifsvk_junja -msgid "Junja" -msgstr "" - -#: lclstrconsts:ifsvk_kana -msgid "Kana" -msgstr "" - -#: lclstrconsts:ifsvk_left -msgid "Left" -msgstr "" - -#: lclstrconsts:rslistindexexceedsbounds -msgid "List index exceeds bounds (%d)" -msgstr "йОДЕЛУ УРЙУЛБ ЧОЕ ДЙБРБЪПОБ (%d)" - -#: lclstrconsts:rslistmustbeempty -msgid "List must be empty" -msgstr "уРЙУПЛ ДПМЦЕО ВЩФШ РХУФ" - -#: lclstrconsts:ifsvk_menu -msgid "Menu" -msgstr "" - -#: lclstrconsts:smenuindexerror -msgid "Menu index out of range" -msgstr "йОДЕЛУ НЕОА ЧОЕ ДЙБРБЪПОБ" - -#: lclstrconsts:smenuitemisnil -msgid "MenuItem is nil" -msgstr "MenuItem - ХЛБЪБФЕМШ ОБ ОХМШ" - -#: lclstrconsts:ifsvk_modechange -msgid "Mode Change" -msgstr "" - -#: lclstrconsts:ifsvk_lbutton -msgid "Mouse Button Left" -msgstr "" - -#: lclstrconsts:ifsvk_mbutton -msgid "Mouse Button Middle" -msgstr "" - -#: lclstrconsts:ifsvk_rbutton -msgid "Mouse Button Right" -msgstr "" - -#: lclstrconsts:ifsvk_next -msgid "Next" -msgstr "" - -#: lclstrconsts:snomdiform -msgid "No MDI form present." -msgstr "" - -#: lclstrconsts:snotimers -msgid "No timers available" -msgstr "оЕДПУФХРОЩ ФБКНЕТЩ" - -#: lclstrconsts:rsmbnotoall -msgid "No to all" -msgstr "оЕФ ДМС ЧУЕИ" - -#: lclstrconsts:rsnowidgetset -msgid "No widgetset object. Plz check if the unit \"interfaces\" was added to the programs uses clause." -msgstr "" - -#: lclstrconsts:ifsvk_nonconvert -msgid "Nonconvert" -msgstr "" - -#: lclstrconsts:rsnotavalidgridfile -msgid "Not a valid grid file" -msgstr "оЕРТБЧЙМШОЩК ЖБКМ УЕФЛЙ" - -#: lclstrconsts:ifsvk_numlock -msgid "Numlock" -msgstr "" - -#: lclstrconsts:ifsvk_numpad -msgid "Numpad %d" -msgstr "" - -#: lclstrconsts:rsfdopenfile -msgid "Open existing file" -msgstr "пФЛТЩФШ УХЭЕУФЧХАЭЙК ЖБКМ" - -#: lclstrconsts:rsfdoverwritefile -msgid "Overwrite file ?" -msgstr "рЕТЕРЙУБФШ ЖБКМ ?" - -#: lclstrconsts:rsfdpathmustexist -msgid "Path must exist" -msgstr "рХФШ ДПМЦЕО УХЭЕУФЧПЧБФШ" - -#: lclstrconsts:ifsvk_pause -msgid "Pause key" -msgstr "" - -#: lclstrconsts:rspixmap -msgid "Pixmap" -msgstr "" - -#: lclstrconsts:rsportablenetworkgraphic -msgid "Portable Network Graphic" -msgstr "" - -#: lclstrconsts:ifsvk_print -msgid "Print" -msgstr "" - -#: lclstrconsts:ifsvk_prior -msgid "Prior" -msgstr "" - -#: lclstrconsts:rspropertydoesnotexist -msgid "Property %s does not exist" -msgstr "уЧПКУФЧП %s ОЕ УХЭЕУФЧХЕФ" - -#: lclstrconsts:lislclresourcesnotfound -msgid "Resource %s not found" -msgstr "тЕУХТУ %s ОЕ ОБКДЕО" - -#: lclstrconsts:ifsvk_return -msgid "Return" -msgstr "" - -#: lclstrconsts:ifsvk_right -msgid "Right" -msgstr "" - -#: lclstrconsts:rsfdfilesaveas -msgid "Save file as" -msgstr "уПИТБОЙФШ ЖБКМ ЛБЛ" - -#: lclstrconsts:ifsvk_scroll -msgid "Scroll" -msgstr "" - -#: lclstrconsts:rsscrollbaroutofrange -msgid "ScrollBar property out of range" -msgstr "УЧПКУФЧП ScrollBar ЧОЕ ДЙБРБЪПОБ" - -#: lclstrconsts:ifsvk_select -msgid "Select" -msgstr "" - -#: lclstrconsts:rsfdselectdirectory -msgid "Select Directory" -msgstr "чЩВЕТЙФЕ ЛБФБМПЗ" - -#: lclstrconsts:rspickdate -msgid "Select a date" -msgstr "чЩВЕТЙФЕ ДБФХ" - -#: lclstrconsts:rsselectfonttitle -msgid "Select a font" -msgstr "чЩВТБФШ ЫТЙЖФ" - -#: lclstrconsts:rsselectcolortitle -msgid "Select color" -msgstr "чЩВТБФШ ГЧЕФ" - -#: lclstrconsts:ifsvk_shift -msgid "Shift" -msgstr "" - -#: lclstrconsts:ifsvk_snapshot -msgid "Snapshot" -msgstr "" - -#: lclstrconsts:ifsvk_space -msgid "Space key" -msgstr "" - -#: lclstrconsts:smenunotfound -msgid "Sub-menu is not in menu" -msgstr "рПДНЕОА ОЕ Ч НЕОА" - -#: lclstrconsts:ifsvk_tab -msgid "Tab" -msgstr "" - -#: lclstrconsts:rsfddirectorynotexist -msgid "The directory \"%s\" does not exist." -msgstr "лБФБМПЗ \"%s\" ОЕ УХЭЕУФЧХЕФ." - -#: lclstrconsts:rsfdfilealreadyexists -msgid "The file \"%s\" already exists. Overwrite ?" -msgstr "" - -#: lclstrconsts:rsfdfilenotexist -msgid "The file \"%s\" does not exist." -msgstr "жБКМ \"%s\" ОЕ УХЭЕУФЧХЕФ" - -#: lclstrconsts:rsfdfilereadonly -msgid "The file \"%s\" is not writable." -msgstr "жБКМ \"%s\" ОЕ ДПУФХРЕО ДМС ЪБРЙУЙ." - -#: lclstrconsts:rsfdpathnoexist -msgid "The path \"%s\" does not exist." -msgstr "рХФШ \"%s\" ОЕ УХЭЕУФЧХЕФ." - -#: lclstrconsts:rsunabletoloaddefaultfont -msgid "Unable to load default font" -msgstr "оЕ НПЗХ ЪБЗТХЪЙФШ ЫТЙЖФ РП ХНПМЮБОЙА" - -#: lclstrconsts:ifsvk_unknown -msgid "Unknown" -msgstr "" - -#: lclstrconsts:rsunknownpictureextension -msgid "Unknown picture extension" -msgstr "оЕЙЪЧЕУФОПЕ ТБУЫЙТЕОЙЕ ЖБКМБ ЙЪПВТБЦЕОЙС" - -#: lclstrconsts:rsunsupportedbitmapformat -msgid "Unsupported bitmap format." -msgstr "оЕРПДДЕТЦЙЧБЕНЩК ФЙР ФПЮЕЮОПЗП ТЙУХОЛБ." - -#: lclstrconsts:rsunsupportedclipboardformat -msgid "Unsupported clipboard format: %s" -msgstr "оЕРПДДЕТЦЙЧБЕНЩК ЖПТНБФ ВХЖЕТБ ПВНЕОБ: %s" - -#: lclstrconsts:ifsvk_up -msgid "Up" -msgstr "" - -#: lclstrconsts:rsmtwarning -msgid "Warning" -msgstr "рТЕДХРТЕЦДЕОЙЕ" - -#: lclstrconsts:rswin32warning -msgid "Warning:" -msgstr "рТЕДХРТЕЦДЕОЙЕ:" - -#: lclstrconsts:rsmbyestoall -msgid "Yes to all" -msgstr "дБ ДМС ЧУЕИ" - -#: lclstrconsts:ifsvk_apps -msgid "application key" -msgstr "" - -#: lclstrconsts:rsinvalidformobjectstream -msgid "invalid Form object stream" -msgstr "ОЕРТБЧЙМШОЩК РПФПЛ ПВЯЕЛФБ жПТНЩ" - -#: lclstrconsts:ifsvk_lwin -msgid "left windows key" -msgstr "" - -#: lclstrconsts:rsdefaultfileinfovalue -msgid "permissions user group size date time" -msgstr "ТБЪТЕЫЕОЙС РПМШЪПЧБФЕМШ ЗТХРРБ ДБФБ ЧТЕНС" - -#: lclstrconsts:ifsvk_rwin -msgid "right windows key" -msgstr "" - diff --git a/lcl/languages/lcl.ruwin.po b/lcl/languages/lcl.ruwin.po deleted file mode 100644 index 6bb5ea0ad8..0000000000 --- a/lcl/languages/lcl.ruwin.po +++ /dev/null @@ -1,632 +0,0 @@ -#: lclstrconsts:rsmodified -msgid " modified " -msgstr "" - -#: lclstrconsts:rssize -msgid " size " -msgstr "" - -#: lclstrconsts:rswarningunreleasedtimerinfos -msgid " WARNING: There are %d TimerInfo structures left, I'll free them" -msgstr " ВНИМАНИЕ: Осталось %d структур TimerInfo, я их освобождаю" - -#: lclstrconsts:rswarningunreleasedmessagesinqueue -msgid " WARNING: There are %d messages left in the queue! I'll free them" -msgstr " ВНИМАНИЕ: В очереди осталось %d сообщений! Я их удаляю" - -#: lclstrconsts:rswarningunreleaseddcsdump -msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" -msgstr " ВНИМАНИЕ: Найдено %d неосвобождённых контекстов устройств, список см. ниже:" - -#: lclstrconsts:rswarningunreleasedgdiobjectsdump -msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:" -msgstr " ВНИМАНИЕ: Найдено %d неосвобождённых GDIObject, список см. ниже:" - -#: lclstrconsts:rswarningunremovedpaintmessages -msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left." -msgstr " ВНИМАНИЕ: Найдено %s неудалённых LM_PAINT/LM_GtkPAINT ссылок на сообщение." - -#: lclstrconsts:rsindexoutofbounds -msgid "%s Index %d out of bounds 0-%d" -msgstr "%s Индекс %d вне диапазона 0-%d" - -#: lclstrconsts:rsisalreadyassociatedwith -msgid "%s is already associated with %s" -msgstr "%s уже сопоставлено с %s" - -#: lclstrconsts:rspressoktoignoreandriskdatacorruptionpresscanceltok -msgid "%s%sPress Ok to ignore and risk data corruption.%sPress Cancel to kill the program." -msgstr "" - -#: lclstrconsts:rsmball -msgid "&All" -msgstr "&Все" - -#: lclstrconsts:rsmbclose -msgid "&Close" -msgstr "&Закрыть" - -#: lclstrconsts:rsmbhelp -msgid "&Help" -msgstr "&Справка" - -#: lclstrconsts:rsmbignore -msgid "&Ignore" -msgstr "&Пропуск" - -#: lclstrconsts:rsmbno -msgid "&No" -msgstr "&Нет" - -#: lclstrconsts:rsmbok -msgid "&OK" -msgstr "&ОК" - -#: lclstrconsts:rsmbretry -msgid "&Retry" -msgstr "&Повтор" - -#: lclstrconsts:rsmbyes -msgid "&Yes" -msgstr "&Да" - -#: lclstrconsts:rsfileinfofilenotfound -msgid "(file not found: \"%s\")" -msgstr "(файл не найден: \"%s\")" - -#: lclstrconsts:rsgtkoptionclass -msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." -msgstr "" - -#: lclstrconsts:rsgtkoptiondisplay -msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." -msgstr "--display h:s:d Связаться с указанным сервером иксов, где \"h\" - имя хоста, \"s\" - номер сервера (обычно 0) и \"d\" - номер дисплея (обычно опускают). Если --display не указан, используется переменная окружения DISPLAY." - -#: lclstrconsts:rsgoptionfatalwarnings -msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." -msgstr "" - -#: lclstrconsts:rsgdkoptiondebug -msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." -msgstr "--gdk-debug flags Включить указанные отладочные сообщения GDK." - -#: lclstrconsts:rsgdkoptionnodebug -msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages." -msgstr "--gdk-no-debug flags Выключить указанные отладочные сообщения GDK." - -#: lclstrconsts:rsgtkoptiondebug -msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages." -msgstr "--gtk-debug flags Включить указанные отладочные сообщения Gtk+." - -#: lclstrconsts:rsgtkoptionmodule -msgid "--gtk-module module Load the specified module at startup." -msgstr "--gtk-module модуль Загрузить указанный модуль при запуске." - -#: lclstrconsts:rsgtkoptionnodebug -msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." -msgstr "--gtk-no-debug flags Выключть указанные отладочные сообщения Gtk+." - -#: lclstrconsts:rsgtkoptionnotransient -msgid "--lcl-no-transient Do not set transient order for modal forms" -msgstr "--lcl-no-transient Не устанавливать временный порядок модальных форм" - -#: lclstrconsts:rsgtkoptionname -msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStr(0)." -msgstr "--name имяпрог Устанавливает имя программы в \"имяпрог\". Если не указано, имя программы будет установлено в ParamStr(0)." - -#: lclstrconsts:rsgtkoptionnoxshm -msgid "--no-xshm Disable use of the X Shared Memory Extension." -msgstr "--no-xshm Запрет использования расширений X по разделяемой памяти." - -#: lclstrconsts:rsgtkoptionsync -msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." -msgstr "--sync Вызов XSynchronize (display, True) после установлени соединения с Xserver'ом. Это облегчает отладку ошибок протокола X, т.к. запросы буферизации X будут отключены, и ошибки X будут получены сразу после запроса протокола, который вызвал эту ошибку, обработанную сервером X." - -#: lclstrconsts:rsacontrolcannothaveitselfasparent -msgid "A control can't have itself as parent" -msgstr "Элемент управления не может быть сам себе потомком" - -#: lclstrconsts:rsmbabort -msgid "Abort" -msgstr "Сброс" - -#: lclstrconsts:ifsvk_accept -msgid "Accept" -msgstr "" - -#: lclstrconsts:rsallfiles -msgid "All files (%s)|%s|%s" -msgstr "" - -#: lclstrconsts:ifsvk_back -msgid "Backspace" -msgstr "" - -#: lclstrconsts:rsbitmaps -msgid "Bitmaps" -msgstr "" - -#: lclstrconsts:rsblank -msgid "Blank" -msgstr "Пустой" - -#: lclstrconsts:rscalculator -msgid "Calculator" -msgstr "Калькулятор" - -#: lclstrconsts:rscannotfocus -msgid "Can not focus" -msgstr "Не могу принять фокус" - -#: lclstrconsts:rsmbcancel -msgid "Cancel" -msgstr "Отмена" - -#: lclstrconsts:scannotfocus -msgid "Cannot focus a disabled or invisible window" -msgstr "Нельзя дать фокус отключённому или невидимому окну" - -#: lclstrconsts:rscanvasdoesnotallowdrawing -msgid "Canvas does not allow drawing" -msgstr "Канва не поддерживает рисования" - -#: lclstrconsts:ifsvk_capital -msgid "Capital" -msgstr "" - -#: lclstrconsts:ifsvk_clear -msgid "Clear" -msgstr "" - -#: lclstrconsts:rsmtconfirmation -msgid "Confirmation" -msgstr "Подтверждение" - -#: lclstrconsts:ifsvk_control -msgid "Control" -msgstr "" - -#: lclstrconsts:ifsvk_convert -msgid "Convert" -msgstr "" - -#: lclstrconsts:rscreatinggdbcatchableerror -msgid "Creating gdb catchable error:" -msgstr "Создание кешируемой ошибки gdb:" - -#: lclstrconsts:rsmtcustom -msgid "Custom" -msgstr "Пользовательский" - -#: lclstrconsts:ifsvk_delete -msgid "Delete" -msgstr "" - -#: lclstrconsts:rsfddirectorymustexist -msgid "Directory must exist" -msgstr "Каталог должен существовать" - -#: lclstrconsts:rsdocking -msgid "Docking" -msgstr "" - -#: lclstrconsts:ifsvk_down -msgid "Down" -msgstr "" - -#: lclstrconsts:sduplicatemenus -msgid "Duplicate menus" -msgstr "Повторяющиеся меню" - -#: lclstrconsts:rserrorinlcl -msgid "ERROR in LCL: " -msgstr "ОШИБКА в LCL:" - -#: lclstrconsts:ifsvk_end -msgid "End" -msgstr "" - -#: lclstrconsts:rsmterror -msgid "Error" -msgstr "Ошибка" - -#: lclstrconsts:rserrorcreatingdevicecontext -msgid "Error creating device context for %s.%s" -msgstr "Ошибка создания контекста устройства для %s.%s" - -#: lclstrconsts:rserroroccurredinataddressframe -msgid "Error occurred in %s at %sAddress %s%s Frame %s" -msgstr "Произошла ошибка в %s по %s адресу %s%s фрейм %s" - -#: lclstrconsts:rserrorreadingproperty -msgid "Error reading %s%s%s: %s" -msgstr "Ошибка чтения %s%s%s: %s" - -#: lclstrconsts:rswin32error -msgid "Error:" -msgstr "Ошибка:" - -#: lclstrconsts:ifsvk_escape -msgid "Escape" -msgstr "" - -#: lclstrconsts:rsexception -msgid "Exception" -msgstr "Исключение" - -#: lclstrconsts:ifsvk_execute -msgid "Execute" -msgstr "" - -#: lclstrconsts:rsfileinformation -msgid "File information" -msgstr "Информация о файле" - -#: lclstrconsts:rsfdfilereadonlytitle -msgid "File is not writable" -msgstr "Файл не доступен для записи" - -#: lclstrconsts:rsfdfilemustexist -msgid "File must exist" -msgstr "Файл должен существовать" - -#: lclstrconsts:rsgtkfilter -msgid "Filter:" -msgstr "" - -#: lclstrconsts:ifsvk_final -msgid "Final" -msgstr "" - -#: lclstrconsts:rsfixedcolstoobig -msgid "FixedCols can't be >= ColCount" -msgstr "FixedCols не может быть >= ColCount" - -#: lclstrconsts:rsfixedrowstoobig -msgid "FixedRows can't be >= RowCount" -msgstr "FixedRows не может быть >= RowCount" - -#: lclstrconsts:rsformstreamingerror -msgid "Form streaming \"%s\" error: %s" -msgstr "Ошибка потоков \"%s\" форм: %s" - -#: lclstrconsts:rsgridfiledoesnotexists -msgid "Grid file doesn't exists" -msgstr "Файл сетки не существует" - -#: lclstrconsts:rsgroupindexcannotbelessthanprevious -msgid "GroupIndex cannot be less than a previous menu item's GroupIndex" -msgstr "GroupIndex не может быть меньше GroupIndex для предыдущего элемента меню" - -#: lclstrconsts:ifsvk_hanja -msgid "Hanja" -msgstr "" - -#: lclstrconsts:ifsvk_help -msgid "Help" -msgstr "" - -#: lclstrconsts:rsgtkhistory -msgid "History:" -msgstr "" - -#: lclstrconsts:ifsvk_home -msgid "Home" -msgstr "" - -#: lclstrconsts:rsicon -msgid "Icon" -msgstr "" - -#: lclstrconsts:rsindexoutofrange -msgid "Index Out of range Cell[Col=%d Row=%d]" -msgstr "Индекс вне диапазона Cell[Col=%d Row=%d]" - -#: lclstrconsts:rsmtinformation -msgid "Information" -msgstr "Сведения" - -#: lclstrconsts:ifsvk_insert -msgid "Insert" -msgstr "" - -#: lclstrconsts:rsinvaliddate -msgid "Invalid Date : %s" -msgstr "" - -#: lclstrconsts:rsinvaliddaterangehint -msgid "Invalid Date: %s. Must be between %s and %s" -msgstr "" - -#: lclstrconsts:sinvalidindex -msgid "Invalid ImageList Index" -msgstr "Неправильный индекс ImageList" - -#: lclstrconsts:sinvalidactioncreation -msgid "Invalid action creation" -msgstr "Неправильное создание действия" - -#: lclstrconsts:sinvalidactionenumeration -msgid "Invalid action enumeration" -msgstr "Неправильное перечисление действий" - -#: lclstrconsts:sinvalidactionregistration -msgid "Invalid action registration" -msgstr "Неправильная регистрация действия" - -#: lclstrconsts:sinvalidactionunregistration -msgid "Invalid action unregistration" -msgstr "Неправильная разрегистрация действия" - -#: lclstrconsts:sinvalidimagesize -msgid "Invalid image size" -msgstr "Неправильный размер рисунка" - -#: lclstrconsts:rsinvalidpropertyvalue -msgid "Invalid property value" -msgstr "Неправильное значение свойства" - -#: lclstrconsts:rsinvalidstreamformat -msgid "Invalid stream format" -msgstr "Неправильный формат потока" - -#: lclstrconsts:ifsvk_junja -msgid "Junja" -msgstr "" - -#: lclstrconsts:ifsvk_kana -msgid "Kana" -msgstr "" - -#: lclstrconsts:ifsvk_left -msgid "Left" -msgstr "" - -#: lclstrconsts:rslistindexexceedsbounds -msgid "List index exceeds bounds (%d)" -msgstr "Индекс списка вне диапазона (%d)" - -#: lclstrconsts:rslistmustbeempty -msgid "List must be empty" -msgstr "Список должен быть пуст" - -#: lclstrconsts:ifsvk_menu -msgid "Menu" -msgstr "" - -#: lclstrconsts:smenuindexerror -msgid "Menu index out of range" -msgstr "Индекс меню вне диапазона" - -#: lclstrconsts:smenuitemisnil -msgid "MenuItem is nil" -msgstr "MenuItem - указатель на нуль" - -#: lclstrconsts:ifsvk_modechange -msgid "Mode Change" -msgstr "" - -#: lclstrconsts:ifsvk_lbutton -msgid "Mouse Button Left" -msgstr "" - -#: lclstrconsts:ifsvk_mbutton -msgid "Mouse Button Middle" -msgstr "" - -#: lclstrconsts:ifsvk_rbutton -msgid "Mouse Button Right" -msgstr "" - -#: lclstrconsts:ifsvk_next -msgid "Next" -msgstr "" - -#: lclstrconsts:snomdiform -msgid "No MDI form present." -msgstr "" - -#: lclstrconsts:snotimers -msgid "No timers available" -msgstr "Недоступны таймеры" - -#: lclstrconsts:rsmbnotoall -msgid "No to all" -msgstr "Нет для всех" - -#: lclstrconsts:rsnowidgetset -msgid "No widgetset object. Plz check if the unit \"interfaces\" was added to the programs uses clause." -msgstr "" - -#: lclstrconsts:ifsvk_nonconvert -msgid "Nonconvert" -msgstr "" - -#: lclstrconsts:rsnotavalidgridfile -msgid "Not a valid grid file" -msgstr "Неправильный файл сетки" - -#: lclstrconsts:ifsvk_numlock -msgid "Numlock" -msgstr "" - -#: lclstrconsts:ifsvk_numpad -msgid "Numpad %d" -msgstr "" - -#: lclstrconsts:rsfdopenfile -msgid "Open existing file" -msgstr "Открыть существующий файл" - -#: lclstrconsts:rsfdoverwritefile -msgid "Overwrite file ?" -msgstr "Переписать файл ?" - -#: lclstrconsts:rsfdpathmustexist -msgid "Path must exist" -msgstr "Путь должен существовать" - -#: lclstrconsts:ifsvk_pause -msgid "Pause key" -msgstr "" - -#: lclstrconsts:rspixmap -msgid "Pixmap" -msgstr "" - -#: lclstrconsts:rsportablenetworkgraphic -msgid "Portable Network Graphic" -msgstr "" - -#: lclstrconsts:ifsvk_print -msgid "Print" -msgstr "" - -#: lclstrconsts:ifsvk_prior -msgid "Prior" -msgstr "" - -#: lclstrconsts:rspropertydoesnotexist -msgid "Property %s does not exist" -msgstr "Свойство %s не существует" - -#: lclstrconsts:lislclresourcesnotfound -msgid "Resource %s not found" -msgstr "Ресурс %s не найден" - -#: lclstrconsts:ifsvk_return -msgid "Return" -msgstr "" - -#: lclstrconsts:ifsvk_right -msgid "Right" -msgstr "" - -#: lclstrconsts:rsfdfilesaveas -msgid "Save file as" -msgstr "Сохранить файл как" - -#: lclstrconsts:ifsvk_scroll -msgid "Scroll" -msgstr "" - -#: lclstrconsts:rsscrollbaroutofrange -msgid "ScrollBar property out of range" -msgstr "свойство ScrollBar вне диапазона" - -#: lclstrconsts:ifsvk_select -msgid "Select" -msgstr "" - -#: lclstrconsts:rsfdselectdirectory -msgid "Select Directory" -msgstr "Выберите каталог" - -#: lclstrconsts:rspickdate -msgid "Select a date" -msgstr "Выберите дату" - -#: lclstrconsts:rsselectfonttitle -msgid "Select a font" -msgstr "Выбрать шрифт" - -#: lclstrconsts:rsselectcolortitle -msgid "Select color" -msgstr "Выбрать цвет" - -#: lclstrconsts:ifsvk_shift -msgid "Shift" -msgstr "" - -#: lclstrconsts:ifsvk_snapshot -msgid "Snapshot" -msgstr "" - -#: lclstrconsts:ifsvk_space -msgid "Space key" -msgstr "" - -#: lclstrconsts:smenunotfound -msgid "Sub-menu is not in menu" -msgstr "Подменю не в меню" - -#: lclstrconsts:ifsvk_tab -msgid "Tab" -msgstr "" - -#: lclstrconsts:rsfddirectorynotexist -msgid "The directory \"%s\" does not exist." -msgstr "Каталог \"%s\" не существует." - -#: lclstrconsts:rsfdfilealreadyexists -msgid "The file \"%s\" already exists. Overwrite ?" -msgstr "" - -#: lclstrconsts:rsfdfilenotexist -msgid "The file \"%s\" does not exist." -msgstr "Файл \"%s\" не существует" - -#: lclstrconsts:rsfdfilereadonly -msgid "The file \"%s\" is not writable." -msgstr "Файл \"%s\" не доступен для записи." - -#: lclstrconsts:rsfdpathnoexist -msgid "The path \"%s\" does not exist." -msgstr "Путь \"%s\" не существует." - -#: lclstrconsts:rsunabletoloaddefaultfont -msgid "Unable to load default font" -msgstr "Не могу загрузить шрифт по умолчанию" - -#: lclstrconsts:ifsvk_unknown -msgid "Unknown" -msgstr "" - -#: lclstrconsts:rsunknownpictureextension -msgid "Unknown picture extension" -msgstr "Неизвестное расширение файла изображения" - -#: lclstrconsts:rsunsupportedbitmapformat -msgid "Unsupported bitmap format." -msgstr "Неподдерживаемый тип точечного рисунка." - -#: lclstrconsts:rsunsupportedclipboardformat -msgid "Unsupported clipboard format: %s" -msgstr "Неподдерживаемый формат буфера обмена: %s" - -#: lclstrconsts:ifsvk_up -msgid "Up" -msgstr "" - -#: lclstrconsts:rsmtwarning -msgid "Warning" -msgstr "Предупреждение" - -#: lclstrconsts:rswin32warning -msgid "Warning:" -msgstr "Предупреждение:" - -#: lclstrconsts:rsmbyestoall -msgid "Yes to all" -msgstr "Да для всех" - -#: lclstrconsts:ifsvk_apps -msgid "application key" -msgstr "" - -#: lclstrconsts:rsinvalidformobjectstream -msgid "invalid Form object stream" -msgstr "неправильный поток объекта Формы" - -#: lclstrconsts:ifsvk_lwin -msgid "left windows key" -msgstr "" - -#: lclstrconsts:rsdefaultfileinfovalue -msgid "permissions user group size date time" -msgstr "разрешения пользователь группа дата время" - -#: lclstrconsts:ifsvk_rwin -msgid "right windows key" -msgstr "" -