mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-08-28 21:20:46 +02:00
Merged revision(s) 59564 #3cefe5b042 from trunk:
Translations: Czech translation update by chronos, bug #34549 ........ git-svn-id: branches/fixes_2_0@59565 -
This commit is contained in:
parent
7ecfb56820
commit
6cbfa99e01
@ -2,14 +2,14 @@ msgid ""
|
||||
msgstr ""
|
||||
"Project-Id-Version: \n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2013-03-09 21:18+0100\n"
|
||||
"Last-Translator: Václav Valíček <Valicek1994@gmail.com>\n"
|
||||
"PO-Revision-Date: 2018-11-16 12:26+0100\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: \n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.5\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
|
||||
#: codetoolsstrconsts.crsbracketnotfound
|
||||
msgid "bracket ) not found"
|
||||
@ -69,7 +69,7 @@ msgstr "dvojkový operátor"
|
||||
|
||||
#: codetoolsstrconsts.ctsbracketcloseexpectedbutatomfound
|
||||
msgid "bracket close expected, but %s found"
|
||||
msgstr "očekávána uzavírací závorka, ale nalezeno %s "
|
||||
msgstr "očekávána uzavírací závorka, ale nalezeno %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsbracketnotfound
|
||||
msgid "bracket %s not found"
|
||||
@ -77,11 +77,11 @@ msgstr "závorka %s nenalezena"
|
||||
|
||||
#: codetoolsstrconsts.ctsbracketopenexpectedbutatomfound
|
||||
msgid "bracket open expected, but %s found"
|
||||
msgstr "očekávána otvírací závorka, ale nalezeno %s "
|
||||
msgstr "očekávána otvírací závorka, ale nalezeno %s"
|
||||
|
||||
#: codetoolsstrconsts.ctscannotaddaunittotheimplementationbecauseonlyaunith
|
||||
msgid "cannot add a unit to the implementation, because only a unit has one"
|
||||
msgstr ""
|
||||
msgstr "nelze přidat jednotku do implementace, protože pouze jednotka jednu má"
|
||||
|
||||
#: codetoolsstrconsts.ctscharacterconstantoutofrange
|
||||
msgid "character constant out of range"
|
||||
@ -100,14 +100,12 @@ msgid "class node without parent node"
|
||||
msgstr "uzel třídy bez rodičovského uzlu"
|
||||
|
||||
#: codetoolsstrconsts.ctsclassnotfound
|
||||
#, fuzzy,badformat
|
||||
#| msgid "class %s%s%s not found"
|
||||
msgid "class \"%s\" not found"
|
||||
msgstr "třída %s%s%s nenalezena"
|
||||
msgstr "třída \"%s\" nenalezena"
|
||||
|
||||
#: codetoolsstrconsts.ctsclassnotfound2
|
||||
msgid "class not found \"%s\""
|
||||
msgstr ""
|
||||
msgstr "třída nenalezena \"%s\""
|
||||
|
||||
#: codetoolsstrconsts.ctsclassofdefinitionnotresolved
|
||||
msgid "\"class of\" definition not resolved: %s"
|
||||
@ -175,7 +173,7 @@ msgstr "výchozí dispinterface předek IDispatch nenalezen"
|
||||
|
||||
#: codetoolsstrconsts.ctsdefaultfpcsource2operatingsystem
|
||||
msgid "Default fpc source Operating System 2"
|
||||
msgstr "Výchozí zdrojový Operační systém 2 fpc "
|
||||
msgstr "Výchozí zdrojový Operační systém 2 fpc"
|
||||
|
||||
#: codetoolsstrconsts.ctsdefaultfpcsourceoperatingsystem
|
||||
msgid "Default fpc source Operating System"
|
||||
@ -195,7 +193,7 @@ msgstr "Výchozí cílový procesor fpc"
|
||||
|
||||
#: codetoolsstrconsts.ctsdefaultinterfaceancestoriinterfacenotfound
|
||||
msgid "default interface ancestor IInterface not found"
|
||||
msgstr "Nenalezen výchozí předek rozhraní IInterface"
|
||||
msgstr "nenalezen výchozí předek rozhraní IInterface"
|
||||
|
||||
#: codetoolsstrconsts.ctsdefaultjavaclassancestorjlobjectnotfound
|
||||
msgid "default java class ancestor JLObject not found"
|
||||
@ -215,7 +213,7 @@ msgstr "výchozí specifikátor předefinován"
|
||||
|
||||
#: codetoolsstrconsts.ctsdefine
|
||||
msgid "Define "
|
||||
msgstr "Definice"
|
||||
msgstr "Definice "
|
||||
|
||||
#: codetoolsstrconsts.ctsdefinelcl
|
||||
msgid "Define LCL"
|
||||
@ -393,7 +391,7 @@ msgstr "HasError"
|
||||
|
||||
#: codetoolsstrconsts.ctshelperisnotallowed
|
||||
msgid "Helper after %s is not allowed"
|
||||
msgstr ""
|
||||
msgstr "Není povolen helper za %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsidedirectory
|
||||
msgid "IDE Directory"
|
||||
@ -401,7 +399,7 @@ msgstr "Adresář IDE"
|
||||
|
||||
#: codetoolsstrconsts.ctsidentexpectedbutatomfound
|
||||
msgid "identifier expected, but %s found"
|
||||
msgstr "Očekáván identifikátor, ale nalezen %s"
|
||||
msgstr "očekáván identifikátor, ale nalezen %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsidentexpectedbuteoffound
|
||||
msgid "unexpected end of file (identifier expected)"
|
||||
@ -413,7 +411,7 @@ msgstr "očekáván identifikátor, ale nalezeno klíčové slovo %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsidentifier
|
||||
msgid "identifier"
|
||||
msgstr "Identifikátor"
|
||||
msgstr "identifikátor"
|
||||
|
||||
#: codetoolsstrconsts.ctsidentifieralreadydefined
|
||||
msgid "Identifier %s already defined"
|
||||
@ -421,7 +419,7 @@ msgstr "Identifikátor %s již definován"
|
||||
|
||||
#: codetoolsstrconsts.ctsidentifiernotfound
|
||||
msgid "identifier not found: %s"
|
||||
msgstr "Identifikátor nenalezen: %s"
|
||||
msgstr "identifikátor nenalezen: %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsifdefdarwin
|
||||
msgid "IfDef Darwin"
|
||||
@ -504,16 +502,12 @@ msgid "interface section not found"
|
||||
msgstr "nenalezena sekce interface"
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidclassname
|
||||
#, fuzzy,badformat
|
||||
#| msgid "invalid class name=%s%s%s"
|
||||
msgid "invalid class name=\"%s\""
|
||||
msgstr "neplatné jméno třídy=%s%s%s"
|
||||
msgstr "neplatné jméno třídy=\"%s\""
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidclassname2
|
||||
#, fuzzy,badformat
|
||||
#| msgid "invalid class name %s%s%s"
|
||||
msgid "invalid class name \"%s\""
|
||||
msgstr "neplatné jméno třídy %s%s%s"
|
||||
msgstr "neplatné jméno třídy \"%s\""
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidflagvaluefordirective
|
||||
msgid "invalid flag value \"%s\" for directive %s"
|
||||
@ -533,7 +527,7 @@ msgstr "neplatný opetátor %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidpositionforinsertionofstatements
|
||||
msgid "invalid position for insertion of statements"
|
||||
msgstr ""
|
||||
msgstr "neplatná pozice pro vložení příkazů"
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidsubrange
|
||||
msgid "invalid subrange"
|
||||
@ -544,16 +538,12 @@ msgid "invalid type"
|
||||
msgstr "neplatný typ"
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidvariablename
|
||||
#, fuzzy,badformat
|
||||
#| msgid "invalid variable name %s%s%s"
|
||||
msgid "invalid variable name \"%s\""
|
||||
msgstr "neplatné jméno proměnné %s%s%s"
|
||||
msgstr "neplatné jméno proměnné \"%s\""
|
||||
|
||||
#: codetoolsstrconsts.ctsinvalidvariabletype
|
||||
#, fuzzy,badformat
|
||||
#| msgid "invalid variable type %s%s%s"
|
||||
msgid "invalid variable type \"%s\""
|
||||
msgstr "neplatný typ proměnné %s%s%s"
|
||||
msgstr "neplatný typ proměnné \"%s\""
|
||||
|
||||
#: codetoolsstrconsts.ctskeyword
|
||||
msgid "keyword"
|
||||
@ -577,7 +567,7 @@ msgstr "Zdroje Lazarusu"
|
||||
|
||||
#: codetoolsstrconsts.ctsmethodhasnodeclaration
|
||||
msgid "method \"%s\" has no declaration"
|
||||
msgstr ""
|
||||
msgstr "metoda \"%s\" nemá deklaraci"
|
||||
|
||||
#: codetoolsstrconsts.ctsmethodname
|
||||
msgid "method name"
|
||||
@ -617,7 +607,7 @@ msgstr "%s Projekt"
|
||||
|
||||
#: codetoolsstrconsts.ctsneededbymode
|
||||
msgid " (needed by mode \"%s\")"
|
||||
msgstr ""
|
||||
msgstr " (vyžadováno režimem \"%s\")"
|
||||
|
||||
#: codetoolsstrconsts.ctsnesteddefinitionsarenotallowed
|
||||
msgid "Nested %s definitions are not allowed"
|
||||
@ -727,7 +717,7 @@ msgstr "očekáván typ vlastnosti, ale nalezeno %s"
|
||||
|
||||
#: codetoolsstrconsts.ctspropertycurrentnotfound
|
||||
msgid "property Current not found"
|
||||
msgstr "Nenalezena vlastnost Current"
|
||||
msgstr "nenalezena vlastnost Current"
|
||||
|
||||
#: codetoolsstrconsts.ctspropertyspecifieralreadydefined
|
||||
msgid "property specifier already defined: %s"
|
||||
@ -778,20 +768,16 @@ msgid "source is not unit"
|
||||
msgstr "zdroj není jednotka"
|
||||
|
||||
#: codetoolsstrconsts.ctssourcenotfoundunit
|
||||
#, fuzzy
|
||||
#| msgid "source not found: unit %s"
|
||||
msgid "source not found: unit %s. Check your FPC source directory."
|
||||
msgstr "nenalezen zdroj: jednotka %s"
|
||||
msgstr "nenalezen zdroj: jednotka %s. Zkontrolujte váš zdrojový adresář FPC."
|
||||
|
||||
#: codetoolsstrconsts.ctssrcpathinitialization
|
||||
msgid "SrcPath Initialization"
|
||||
msgstr "Inicializace SrcPath"
|
||||
|
||||
#: codetoolsstrconsts.ctsstrexpectedbutatomfound
|
||||
#, fuzzy
|
||||
#| msgid "%s expected, but %s found"
|
||||
msgid "expected %s, but %s found"
|
||||
msgstr "%s očekáváno, ale nalezeno %s"
|
||||
msgstr "očekáváno %s, ale nalezeno %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsstringconstant
|
||||
msgid "string constant"
|
||||
@ -839,7 +825,7 @@ msgstr "nelze dokončit vlastnost"
|
||||
|
||||
#: codetoolsstrconsts.ctsundefine
|
||||
msgid "Undefine "
|
||||
msgstr "Nedefinovat"
|
||||
msgstr "Nedefinovat "
|
||||
|
||||
#: codetoolsstrconsts.ctsunexpectedendofsource
|
||||
msgid "unexpected end of source"
|
||||
@ -855,7 +841,7 @@ msgstr "neočekáváné klíčové slovo %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsunexpectedkeywordinasmblock
|
||||
msgid "unexpected keyword \"%s\" in asm block found"
|
||||
msgstr "nalezeno neočekávané klíčové slovo \"%s\" v bloku asm "
|
||||
msgstr "nalezeno neočekávané klíčové slovo \"%s\" v bloku asm"
|
||||
|
||||
#: codetoolsstrconsts.ctsunexpectedkeywordinbeginendblock
|
||||
msgid "unexpected keyword \"%s\" in begin..end found"
|
||||
@ -867,7 +853,7 @@ msgstr "nalezeno neočekávané klíčové slovo \"%s\" při zpětném čtení b
|
||||
|
||||
#: codetoolsstrconsts.ctsunexpectedsectionkeyword
|
||||
msgid "unexpected section keyword %s found"
|
||||
msgstr ""
|
||||
msgstr "nalezeno neočekávané klíčové slovo sekce %s"
|
||||
|
||||
#: codetoolsstrconsts.ctsunexpectedsubrangeoperatorfound
|
||||
msgid "unexpected subrange operator '..' found"
|
||||
@ -903,11 +889,11 @@ msgstr "použitá jednotka není pascalovská jednotka"
|
||||
|
||||
#: codetoolsstrconsts.ctsutilsdirectories
|
||||
msgid "Utils directories"
|
||||
msgstr "Adresáře nástrojů:"
|
||||
msgstr "Adresáře nástrojů"
|
||||
|
||||
#: codetoolsstrconsts.ctsvarisonlyallowedingenericsendofclassnotfound
|
||||
msgid "var is only allowed in generics, end of class not found"
|
||||
msgstr "var je povolen pouze v generikách, nenalezen konec třídy "
|
||||
msgstr "var je povolen pouze v generikách, nenalezen konec třídy"
|
||||
|
||||
#: codetoolsstrconsts.ctswordnotfound
|
||||
msgid "\"%s\" not found"
|
||||
|
@ -2,14 +2,14 @@ msgid ""
|
||||
msgstr ""
|
||||
"Project-Id-Version: \n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2013-01-09 16:21+0100\n"
|
||||
"Last-Translator: Václav Valíček <Valicek1994@gmail.com>\n"
|
||||
"PO-Revision-Date: 2018-11-16 10:51+0100\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: \n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
|
||||
#: objinspstrconsts.cactionlisteditorallcategory
|
||||
msgid "(All)"
|
||||
@ -133,15 +133,15 @@ msgstr "Nahoru"
|
||||
|
||||
#: objinspstrconsts.dceaddfields
|
||||
msgid "Add Fields"
|
||||
msgstr ""
|
||||
msgstr "Přidat položky"
|
||||
|
||||
#: objinspstrconsts.dcecolumneditor
|
||||
msgid "DBGrid Columns Editor"
|
||||
msgstr ""
|
||||
msgstr "Editor sloupců DBGrid"
|
||||
|
||||
#: objinspstrconsts.dcedeleteall
|
||||
msgid "Delete All"
|
||||
msgstr ""
|
||||
msgstr "Smazat vše"
|
||||
|
||||
#: objinspstrconsts.dcefetchlabels
|
||||
msgid "Fetch Labels"
|
||||
@ -149,7 +149,7 @@ msgstr ""
|
||||
|
||||
#: objinspstrconsts.dceoktodelete
|
||||
msgid "This will delete all columns. Continue?"
|
||||
msgstr ""
|
||||
msgstr "Toto smaže všechny sloupce. Pokračovat?"
|
||||
|
||||
#: objinspstrconsts.dcewillreplacecontinue
|
||||
msgid "This will replace all captions from dataset. Continue?"
|
||||
@ -261,7 +261,7 @@ msgstr "Přidat"
|
||||
|
||||
#: objinspstrconsts.itcssearchandreplace
|
||||
msgid "Search and replace"
|
||||
msgstr ""
|
||||
msgstr "Hledat a nahradit"
|
||||
|
||||
#: objinspstrconsts.liisaddvalue
|
||||
msgid "Add value"
|
||||
@ -293,11 +293,11 @@ msgstr "Nastavit hodnotu"
|
||||
|
||||
#: objinspstrconsts.lisunabletofindparserfortool
|
||||
msgid "Unable to find parser for tool \"%s\""
|
||||
msgstr ""
|
||||
msgstr "Nelze najít parser pro nástroj \"%s\""
|
||||
|
||||
#: objinspstrconsts.lisunabletofindparserwithname
|
||||
msgid "Unable to find parser with name \"%s\""
|
||||
msgstr ""
|
||||
msgstr "Nelze najít parser se jménem \"%s\""
|
||||
|
||||
#: objinspstrconsts.nbcesaddpage
|
||||
msgctxt "objinspstrconsts.nbcesaddpage"
|
||||
@ -369,7 +369,6 @@ msgid "ActionList Editor"
|
||||
msgstr "Editor ActionList"
|
||||
|
||||
#: objinspstrconsts.oisadd
|
||||
#, fuzzy
|
||||
msgctxt "objinspstrconsts.oisadd"
|
||||
msgid "Add"
|
||||
msgstr "Přidat"
|
||||
@ -387,7 +386,6 @@ msgid "Add fields from FieldDefs"
|
||||
msgstr "Přidat položky z FieldDefs"
|
||||
|
||||
#: objinspstrconsts.oisaddpage
|
||||
#, fuzzy
|
||||
msgctxt "objinspstrconsts.oisaddpage"
|
||||
msgid "Add Page"
|
||||
msgstr "Přidat stránku"
|
||||
@ -410,11 +408,11 @@ msgstr "Logická hodnota"
|
||||
|
||||
#: objinspstrconsts.oisbtncomponents
|
||||
msgid "Co&mponents"
|
||||
msgstr ""
|
||||
msgstr "Ko&mponenty"
|
||||
|
||||
#: objinspstrconsts.oisbtnproperties
|
||||
msgid "&Properties"
|
||||
msgstr ""
|
||||
msgstr "&Vlastnosti"
|
||||
|
||||
#: objinspstrconsts.oiscancel
|
||||
msgctxt "objinspstrconsts.oiscancel"
|
||||
@ -431,11 +429,11 @@ msgstr "Odstranit?"
|
||||
|
||||
#: objinspstrconsts.oischangeclass
|
||||
msgid "Change Class ..."
|
||||
msgstr ""
|
||||
msgstr "Změnit třídu ..."
|
||||
|
||||
#: objinspstrconsts.oischangeparent
|
||||
msgid "Change Parent"
|
||||
msgstr ""
|
||||
msgstr "Změnit rodiče"
|
||||
|
||||
#: objinspstrconsts.oischar
|
||||
msgid "Char"
|
||||
@ -458,10 +456,8 @@ msgid "Clear picture"
|
||||
msgstr "Vyčistit obrázek"
|
||||
|
||||
#: objinspstrconsts.oiscomponentnameisnotavalididentifier
|
||||
#, fuzzy,badformat
|
||||
#| msgid "Component name %s%s%s is not a valid identifier"
|
||||
msgid "Component name \"%s\" is not a valid identifier"
|
||||
msgstr "Jméno komponenty %s%s%s není platný identifikátor"
|
||||
msgstr "Jméno komponenty \"%s\" není platný identifikátor"
|
||||
|
||||
#: objinspstrconsts.oiscomponentrestrictions
|
||||
msgid "Component restrictions: "
|
||||
@ -490,11 +486,11 @@ msgstr "Vytvořit nové pole a přidat je na aktuální pozici"
|
||||
|
||||
#: objinspstrconsts.oiscurrentparent
|
||||
msgid "Current parent"
|
||||
msgstr ""
|
||||
msgstr "Aktuální rodič"
|
||||
|
||||
#: objinspstrconsts.oiscurrentparents
|
||||
msgid "Current parents"
|
||||
msgstr ""
|
||||
msgstr "Aktuální rodiče"
|
||||
|
||||
#: objinspstrconsts.oiscutcomponents
|
||||
msgctxt "objinspstrconsts.oiscutcomponents"
|
||||
@ -512,14 +508,12 @@ msgid "&Delete"
|
||||
msgstr "&Smazat"
|
||||
|
||||
#: objinspstrconsts.oisdeleteitem
|
||||
#, fuzzy,badformat
|
||||
#| msgid "Delete item %s%s%s?"
|
||||
msgid "Delete item \"%s\"?"
|
||||
msgstr "Smazat položku %s%s%s?"
|
||||
msgstr "Smazat položku \"%s\"?"
|
||||
|
||||
#: objinspstrconsts.oisdeletepagequestion
|
||||
msgid "Do you want to delete the page?"
|
||||
msgstr ""
|
||||
msgstr "Chcete smazat stránku?"
|
||||
|
||||
#: objinspstrconsts.oisdeleteselectedfields
|
||||
msgid "Delete selected field(s)"
|
||||
@ -546,10 +540,8 @@ msgid "Error loading image"
|
||||
msgstr "Chyba načítání obrázku"
|
||||
|
||||
#: objinspstrconsts.oiserrorloadingimage2
|
||||
#, fuzzy,badformat
|
||||
#| msgid "Error loading image %s%s%s:%s%s"
|
||||
msgid "Error loading image \"%s\":%s%s"
|
||||
msgstr "Chyba načítání obrázku %s%s%s:%s%s"
|
||||
msgstr "Chyba načítání souboru \"%s\":%s%s"
|
||||
|
||||
#: objinspstrconsts.oiserrorwhiledeletingaction
|
||||
msgid "Error while deleting action:%s%s"
|
||||
@ -593,7 +585,7 @@ msgstr "Vstupní maska:"
|
||||
|
||||
#: objinspstrconsts.oisinsertpagename
|
||||
msgid "Insert Page Name"
|
||||
msgstr ""
|
||||
msgstr "Vložit jméno stránky"
|
||||
|
||||
#: objinspstrconsts.oisint64
|
||||
msgid "Int64"
|
||||
@ -609,17 +601,17 @@ msgstr "Rozhraní"
|
||||
|
||||
#: objinspstrconsts.oisinvalid
|
||||
msgid "(Invalid)"
|
||||
msgstr ""
|
||||
msgstr "(Neplatný)"
|
||||
|
||||
#: objinspstrconsts.oisinvalidpropertyvalue
|
||||
msgid "Invalid property value"
|
||||
msgstr "Neplatná hodnota vlastnosti"
|
||||
|
||||
#: objinspstrconsts.oisisnotavalidmethodname
|
||||
#, fuzzy,badformat
|
||||
#, fuzzy
|
||||
#| msgid "%s%s%s is not a valid method name."
|
||||
msgid "\"%s\" is not a valid method name."
|
||||
msgstr "%s%s%s není platné jméno metody"
|
||||
msgstr "\"%s\" není platné jméno jednotky."
|
||||
|
||||
#: objinspstrconsts.oisitemsselected
|
||||
msgid "%u items selected"
|
||||
@ -651,7 +643,7 @@ msgstr "Metoda"
|
||||
|
||||
#: objinspstrconsts.oismixed
|
||||
msgid "(Mixed)"
|
||||
msgstr ""
|
||||
msgstr "(Smíšený)"
|
||||
|
||||
#: objinspstrconsts.oismovedown
|
||||
msgid "Move &Down"
|
||||
@ -720,11 +712,11 @@ msgstr "Přesunout dopředu"
|
||||
|
||||
#: objinspstrconsts.oispages
|
||||
msgid "Pages"
|
||||
msgstr ""
|
||||
msgstr "Stránky"
|
||||
|
||||
#: objinspstrconsts.oispageseditordialog
|
||||
msgid "Pages Editor"
|
||||
msgstr ""
|
||||
msgstr "Editor stránek"
|
||||
|
||||
#: objinspstrconsts.oispastecomponents
|
||||
msgctxt "objinspstrconsts.oispastecomponents"
|
||||
@ -745,7 +737,7 @@ msgstr "Uložit obrázek jako"
|
||||
|
||||
#: objinspstrconsts.oispressakey
|
||||
msgid "Press a key ..."
|
||||
msgstr ""
|
||||
msgstr "Stiskněte klávestu ..."
|
||||
|
||||
#: objinspstrconsts.oispressakeyegctrlp
|
||||
msgid "You can press e.g. Ctrl+P ..."
|
||||
@ -769,11 +761,11 @@ msgstr "Odebrat z oblíbených"
|
||||
|
||||
#: objinspstrconsts.oisrename
|
||||
msgid "Rename"
|
||||
msgstr ""
|
||||
msgstr "Přejmenovat"
|
||||
|
||||
#: objinspstrconsts.oisrenamepage
|
||||
msgid "Rename Page"
|
||||
msgstr ""
|
||||
msgstr "Přejmenovat stránku"
|
||||
|
||||
#: objinspstrconsts.oisrestricted
|
||||
msgid "Restricted"
|
||||
@ -781,7 +773,7 @@ msgstr "Omezené"
|
||||
|
||||
#: objinspstrconsts.oisreverttoinherited
|
||||
msgid "Revert to inherited"
|
||||
msgstr ""
|
||||
msgstr "Vrátit na zděděné"
|
||||
|
||||
#: objinspstrconsts.oissamplemasks
|
||||
msgid "Sample Masks:"
|
||||
@ -813,15 +805,15 @@ msgstr "Vybrat všechna pole"
|
||||
|
||||
#: objinspstrconsts.oisselectedcontrol
|
||||
msgid "Selected control"
|
||||
msgstr ""
|
||||
msgstr "Vybraný prvek"
|
||||
|
||||
#: objinspstrconsts.oisselectedcontrols
|
||||
msgid "Selected controls"
|
||||
msgstr ""
|
||||
msgstr "Vybrané prvky"
|
||||
|
||||
#: objinspstrconsts.oisselectedproperties
|
||||
msgid "&Selected Properties"
|
||||
msgstr ""
|
||||
msgstr "&Vybrané vlastnosti"
|
||||
|
||||
#: objinspstrconsts.oisselectshortcut
|
||||
msgid "Select short cut"
|
||||
@ -857,11 +849,11 @@ msgstr "Natavit hodnotu vlastnosti jako Výchozí"
|
||||
|
||||
#: objinspstrconsts.oisshowalloutputlines
|
||||
msgid "Show all output lines"
|
||||
msgstr ""
|
||||
msgstr "Ukázat všechny výstupní řádky"
|
||||
|
||||
#: objinspstrconsts.oisshowclasses
|
||||
msgid "Show classes"
|
||||
msgstr ""
|
||||
msgstr "Ukázat třídy"
|
||||
|
||||
#: objinspstrconsts.oisshowcomponenttree
|
||||
msgid "Show Component Tree"
|
||||
@ -873,11 +865,11 @@ msgstr "Ukázat pokyny"
|
||||
|
||||
#: objinspstrconsts.oisshowinfobox
|
||||
msgid "Show Information Box"
|
||||
msgstr ""
|
||||
msgstr "Ukázat informační rámeček"
|
||||
|
||||
#: objinspstrconsts.oisshowstatusbar
|
||||
msgid "Show Status Bar"
|
||||
msgstr ""
|
||||
msgstr "Ukázat stavovou lištu"
|
||||
|
||||
#: objinspstrconsts.oissort
|
||||
msgid "Sort"
|
||||
@ -1191,28 +1183,20 @@ msgid "Test Input"
|
||||
msgstr "Zkušební vstup"
|
||||
|
||||
#: objinspstrconsts.oistheidentifierisnotamethodpresscanceltoundopressign
|
||||
#, fuzzy,badformat
|
||||
#| msgid "The identifier %s%s%s is not a method.%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgid "The identifier \"%s\" is not a method.%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgstr "Identifikátor %s%s%s není metoda.%sStiskněte Zrušit k návratu zpět,%sstiskněte Ignorovat k vynucení."
|
||||
msgstr "Identifikátor \"%s\" není metoda.%sStiskněte Zrušit k návratu zpět,%sstiskněte Ignorovat k vynucení."
|
||||
|
||||
#: objinspstrconsts.oisthemethodisincompatibletothiseventpresscanceltound
|
||||
#, fuzzy,badformat
|
||||
#| msgid "The method %s%s%s is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgid "The method \"%s\" is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgstr "Metoda %s%s%s není kompatibilní s touto událostí (%s).%sStiskněte Zrušit pro návrat zpět, %sstiskněte Ignorovat pro vynucení."
|
||||
msgstr "Metoda \"%s\" není kompatibilní s touto událostí (%s).%sStiskněte Zrušit pro návrat zpět, %sstiskněte Ignorovat pro vynucení."
|
||||
|
||||
#: objinspstrconsts.oisthemethodisnotpublishedpresscanceltoundopressignor
|
||||
#, fuzzy,badformat
|
||||
#| msgid "The method %s%s%s is not published.%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgid "The method \"%s\" is not published.%sPress Cancel to undo,%spress Ignore to force it."
|
||||
msgstr "Metoda %s%s%s není zveřejněná.%sStiskněte Zrušit pro návrat zpět,%sstiskněte Ignorovat pro vynucení."
|
||||
msgstr "Metoda \"%s\" není zveřejněná.%sStiskněte Zrušit pro návrat zpět,%sstiskněte Ignorovat pro vynucení."
|
||||
|
||||
#: objinspstrconsts.oisunabletochangeparentofcontroltonewparent
|
||||
#, fuzzy,badformat
|
||||
#| msgid "Unable to change parent of control %s%s%s to new parent %s%s%s.%s%s"
|
||||
msgid "Unable to change parent of control \"%s\" to new parent \"%s\".%s%s"
|
||||
msgstr "Nelze změnit rodiče ovládacího prvku %s%s%s na nového rodiče %s%s%s.%s%s"
|
||||
msgstr "Nelze změnit rodiče ovládacího prvku \"%s\" na nového rodiče \"%s\".%s%s"
|
||||
|
||||
#: objinspstrconsts.oisundo
|
||||
msgctxt "objinspstrconsts.oisundo"
|
||||
@ -1333,15 +1317,15 @@ msgstr "Přidat ..."
|
||||
|
||||
#: objinspstrconsts.sccsiledtaddmoreresolutions
|
||||
msgid "Add more resolutions ..."
|
||||
msgstr ""
|
||||
msgstr "Přidat více rozlišení ..."
|
||||
|
||||
#: objinspstrconsts.sccsiledtaddnewresolution
|
||||
msgid "New resolution ..."
|
||||
msgstr ""
|
||||
msgstr "Nové rozlišení ..."
|
||||
|
||||
#: objinspstrconsts.sccsiledtaddsliced
|
||||
msgid "Add sliced ..."
|
||||
msgstr ""
|
||||
msgstr "Přidat "
|
||||
|
||||
#: objinspstrconsts.sccsiledtaddslicediconerror
|
||||
msgid "Adding sliced icons is not supported."
|
||||
@ -1358,7 +1342,7 @@ msgstr "Použít"
|
||||
|
||||
#: objinspstrconsts.sccsiledtcannotdeleteresolution
|
||||
msgid "Cannot delete default resolution."
|
||||
msgstr ""
|
||||
msgstr "Nelze smazat výchozí rozlišení."
|
||||
|
||||
#: objinspstrconsts.sccsiledtcannotslice
|
||||
msgid "Source image size must be an integer multiple of the ImageList's Width and Height."
|
||||
@ -1388,11 +1372,11 @@ msgstr "Odstranit"
|
||||
|
||||
#: objinspstrconsts.sccsiledtdeleteresolution
|
||||
msgid "Delete resolution ..."
|
||||
msgstr ""
|
||||
msgstr "Smazat rozlišení ..."
|
||||
|
||||
#: objinspstrconsts.sccsiledtdeleteresolutionconfirmation
|
||||
msgid "Select the resolution to delete."
|
||||
msgstr ""
|
||||
msgstr "Vybrat rozlišení ke smazání."
|
||||
|
||||
#: objinspstrconsts.sccsiledtgrplcaption
|
||||
msgid "Images"
|
||||
@ -1404,7 +1388,7 @@ msgstr "Vybraný obrázek"
|
||||
|
||||
#: objinspstrconsts.sccsiledtimagewidthofnewresolution
|
||||
msgid "Image width of the new resolution:"
|
||||
msgstr ""
|
||||
msgstr "Šířka obrázku nového rozlišení"
|
||||
|
||||
#: objinspstrconsts.sccsiledtmovedown
|
||||
msgctxt "objinspstrconsts.sccsiledtmovedown"
|
||||
@ -1426,7 +1410,7 @@ msgstr "Přidat obrázky"
|
||||
|
||||
#: objinspstrconsts.sccsiledtopendialogn
|
||||
msgid "New Image"
|
||||
msgstr ""
|
||||
msgstr "Nový obrázek"
|
||||
|
||||
#: objinspstrconsts.sccsiledtransparentcolor
|
||||
msgid "Transparent Color:"
|
||||
@ -1434,11 +1418,11 @@ msgstr "Průhledná barva:"
|
||||
|
||||
#: objinspstrconsts.sccsiledtreplace
|
||||
msgid "&Replace ..."
|
||||
msgstr ""
|
||||
msgstr "&Nahradit"
|
||||
|
||||
#: objinspstrconsts.sccsiledtreplaceallresolutions
|
||||
msgid "Replace all resolutions ..."
|
||||
msgstr ""
|
||||
msgstr "Nahradit všechny rozlišení ..."
|
||||
|
||||
#: objinspstrconsts.sccsiledtsave
|
||||
msgctxt "objinspstrconsts.sccsiledtsave"
|
||||
|
@ -8,6 +8,8 @@ msgstr ""
|
||||
"Language-Team: \n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
|
||||
#: heaptrcview.rsdtimes
|
||||
msgid " (%d times)"
|
||||
@ -18,10 +20,8 @@ msgid "Error while parsing trace file"
|
||||
msgstr "Chyba při rozkládání stopovacího souboru"
|
||||
|
||||
#: heaptrcview.rsleakview
|
||||
#, fuzzy
|
||||
#| msgid "Find source lines for leak/stack-traces"
|
||||
msgid "Leaks and Traces"
|
||||
msgstr "Prohlížeč úniků"
|
||||
msgstr "Úniky a trasování"
|
||||
|
||||
#: heaptrcview.sbtnclipbrd
|
||||
msgid "Paste Clipboard"
|
||||
@ -29,7 +29,7 @@ msgstr "Vložit ze schránky"
|
||||
|
||||
#: heaptrcview.sbtnresolve
|
||||
msgid "Resolve"
|
||||
msgstr ""
|
||||
msgstr "Vyřešit"
|
||||
|
||||
#: heaptrcview.sbtnupdate
|
||||
msgid "Update"
|
||||
@ -44,18 +44,16 @@ msgid "Stay on top"
|
||||
msgstr "Zůstat nahoře"
|
||||
|
||||
#: heaptrcview.sfrmcap
|
||||
#, fuzzy
|
||||
#| msgid "LeakView - HeapTrc output viewer"
|
||||
msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer"
|
||||
msgstr "Prohlížeč úniků(LeakView) - prohlížeč výstupu HeapTrc"
|
||||
msgstr "Úniky a trasování - Prohlížeš výstupu HeapTrc a zpětného trasování GDB"
|
||||
|
||||
#: heaptrcview.sfrmselectfilewithdebuginfo
|
||||
msgid "Select file with debug info"
|
||||
msgstr ""
|
||||
msgstr "Vyberte soubor s ladícími informacemi"
|
||||
|
||||
#: heaptrcview.sfrmselecttrcfile
|
||||
msgid "Select file with trace log"
|
||||
msgstr ""
|
||||
msgstr "Vyberte soubor se záznamem trasování"
|
||||
|
||||
#: heaptrcview.slbltrace
|
||||
msgid ".trc file"
|
||||
@ -82,13 +80,10 @@ msgid "Leaking Blocks Count: %d"
|
||||
msgstr "Počet uniklých bloků: %d"
|
||||
|
||||
#: heaptrcview.strleakingmemsize
|
||||
#, fuzzy,badformat
|
||||
msgid "Leaking Mem Size: %d"
|
||||
msgstr "Velikost uniklé paměti: %s"
|
||||
msgstr "Velikost uniklé paměti: %d"
|
||||
|
||||
#: heaptrcview.strtotalmemalloc
|
||||
#, fuzzy
|
||||
#| msgid "Total Mem alloced: %d"
|
||||
msgid "Total Mem allocated: %d"
|
||||
msgstr "Celkem přidělené paměti: %d"
|
||||
|
||||
|
@ -4,136 +4,132 @@ msgstr ""
|
||||
"Project-Id-Version: PoChecker\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: \n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: <vaclav@valicek.name>\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
||||
"Language: cs\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: pocheckerconsts.rspochecker
|
||||
#, fuzzy
|
||||
#| msgid "PO File Checker"
|
||||
msgid "Check PO Files ..."
|
||||
msgstr "PO File Checker"
|
||||
msgstr "Kontrolovat PO soubory ..."
|
||||
|
||||
#: pocheckerconsts.rs_lang_af_za
|
||||
msgid "Afrikaans"
|
||||
msgstr ""
|
||||
msgstr "Afrikánština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_all
|
||||
msgid "All languages"
|
||||
msgstr ""
|
||||
msgstr "Všechny jazyky"
|
||||
|
||||
#: pocheckerconsts.rs_lang_ar
|
||||
msgid "Arabic"
|
||||
msgstr ""
|
||||
msgstr "Arabština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_ca
|
||||
msgid "Catalan"
|
||||
msgstr ""
|
||||
msgstr "Katalánština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_cs
|
||||
msgid "Czech"
|
||||
msgstr ""
|
||||
msgstr "Čeština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_de
|
||||
msgid "German"
|
||||
msgstr ""
|
||||
msgstr "Němčina"
|
||||
|
||||
#: pocheckerconsts.rs_lang_en
|
||||
msgid "English"
|
||||
msgstr ""
|
||||
msgstr "Angličtina"
|
||||
|
||||
#: pocheckerconsts.rs_lang_es
|
||||
msgid "Spanish"
|
||||
msgstr ""
|
||||
msgstr "Španělština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_fi
|
||||
msgid "Finnish"
|
||||
msgstr ""
|
||||
msgstr "Finština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_fr
|
||||
msgid "French"
|
||||
msgstr ""
|
||||
msgstr "Francouzština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_he
|
||||
msgid "Hebrew"
|
||||
msgstr ""
|
||||
msgstr "Hebrejština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_hu
|
||||
msgid "Hungarian"
|
||||
msgstr ""
|
||||
msgstr "Maďarština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_id
|
||||
msgid "Indonesian"
|
||||
msgstr ""
|
||||
msgstr "Indonésština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_it
|
||||
msgid "Italian"
|
||||
msgstr ""
|
||||
msgstr "Italština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_ja
|
||||
msgid "Japanese"
|
||||
msgstr ""
|
||||
msgstr "Japonština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_lt
|
||||
msgid "Lithuanian"
|
||||
msgstr ""
|
||||
msgstr "Litevština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_nl
|
||||
msgid "Dutch"
|
||||
msgstr ""
|
||||
msgstr "Holandština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_pl
|
||||
msgid "Polish"
|
||||
msgstr ""
|
||||
msgstr "Polština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_pt
|
||||
msgid "Portuguese"
|
||||
msgstr ""
|
||||
msgstr "Portugalština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_pt_br
|
||||
msgid "Brazilian Portuguese"
|
||||
msgstr ""
|
||||
msgstr "Brazilská portugalština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_ru
|
||||
msgid "Russian"
|
||||
msgstr ""
|
||||
msgstr "Ruština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_sk
|
||||
msgid "Slovak"
|
||||
msgstr ""
|
||||
msgstr "Slovenština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_tr
|
||||
msgid "Turkish"
|
||||
msgstr ""
|
||||
msgstr "Turečtina"
|
||||
|
||||
#: pocheckerconsts.rs_lang_uk
|
||||
msgid "Ukrainian"
|
||||
msgstr ""
|
||||
msgstr "Ukrajinština"
|
||||
|
||||
#: pocheckerconsts.rs_lang_zh_cn
|
||||
msgid "Chinese, simplified"
|
||||
msgstr ""
|
||||
msgstr "Čínština, zjednodušená"
|
||||
|
||||
#: pocheckerconsts.salllanguages
|
||||
msgid "All Languages"
|
||||
msgstr ""
|
||||
msgstr "Všechny jazyky"
|
||||
|
||||
#: pocheckerconsts.scannotwritefileyoucanpressretrytorefreshthistransl
|
||||
msgid "Cannot write file%s%s%s%sYou can press \"Retry\" to refresh this translation family again and continue."
|
||||
msgstr ""
|
||||
msgstr "Nelze zapisovat do souboru%s%s%s%sMůžete stisknout \"Znovu\" pro znovu obnovení a pokračování této překladové rodiny."
|
||||
|
||||
#: pocheckerconsts.scheckforincompatibleformatarguments
|
||||
msgid "Check for incompatible format arguments"
|
||||
msgstr "Zkontrolovat výskyt nekompatibilních argumentů funkce format"
|
||||
|
||||
#: pocheckerconsts.scheckformismatchesinuntranslatedstrings
|
||||
#, fuzzy
|
||||
#| msgid "Check for mismatches in untranslated strings"
|
||||
msgid "Check for mismatches of originals"
|
||||
msgstr "Zkontrolovat výskyt chyb v nepřeložených řetězcích"
|
||||
|
||||
@ -147,33 +143,31 @@ msgstr "Zkontrolovat počet položek"
|
||||
|
||||
#: pocheckerconsts.sclearlistbox
|
||||
msgid "Clear"
|
||||
msgstr ""
|
||||
msgstr "Smazat"
|
||||
|
||||
#: pocheckerconsts.scopy
|
||||
msgid "&Copy"
|
||||
msgstr ""
|
||||
msgstr "Kopírovat"
|
||||
|
||||
#: pocheckerconsts.screatingiconxofy
|
||||
msgid "Creating icon nr. %d of %d"
|
||||
msgstr ""
|
||||
msgstr "Vytváření ikony č. %d z %d"
|
||||
|
||||
#: pocheckerconsts.scurrenttest
|
||||
msgid "Test: %s on %s"
|
||||
msgstr ""
|
||||
msgstr "Test: %s na %s"
|
||||
|
||||
#: pocheckerconsts.sduplicatelinenrwithvalue
|
||||
msgid "[Line %d] %s"
|
||||
msgstr "[Řádek %d] %s"
|
||||
|
||||
#: pocheckerconsts.sduplicateoriginals
|
||||
#, fuzzy
|
||||
#| msgid "The (untranslated) value \"%s\" is used for more than 1 entry:"
|
||||
msgid "Original value \"%s\" is used for more than 1 entry:"
|
||||
msgstr "(Nepřeložený) řetězec \"%s\" je využitý na více než jednom místě:"
|
||||
msgstr "Původní hodnota \"%s\" je použita pro více než 1 položku:"
|
||||
|
||||
#: pocheckerconsts.sduplicateoriginalstab
|
||||
msgid "Duplicate Originals"
|
||||
msgstr ""
|
||||
msgstr "Zdvojené originály"
|
||||
|
||||
#: pocheckerconsts.serroroncleanup
|
||||
msgid ""
|
||||
@ -199,29 +193,31 @@ msgstr "Chyby / varování nahlášené %s pro:"
|
||||
|
||||
#: pocheckerconsts.sfile
|
||||
msgid "File %s"
|
||||
msgstr ""
|
||||
msgstr "Soubor %s"
|
||||
|
||||
#: pocheckerconsts.sfilesnotfoundandremoved
|
||||
msgid ""
|
||||
"The following non-existent files were removed from the list:\n"
|
||||
"%s\n"
|
||||
msgstr ""
|
||||
"Odstraněno následujících neexistujících souborů ze seznamu:\n"
|
||||
"%s\n"
|
||||
|
||||
#: pocheckerconsts.sfuzzystrings
|
||||
msgid "Fuzzy strings"
|
||||
msgstr ""
|
||||
msgstr "Nejednoznačné řetězce"
|
||||
|
||||
#: pocheckerconsts.sfuzzystringstotal
|
||||
msgid "Fuzzy strings (total: %s)"
|
||||
msgstr ""
|
||||
msgstr "Nejednoznačné řetězce (celkem: %s)"
|
||||
|
||||
#: pocheckerconsts.sgeneralinfo
|
||||
msgid "General Info"
|
||||
msgstr ""
|
||||
msgstr "Obecné informace"
|
||||
|
||||
#: pocheckerconsts.sgrapstatformcaption
|
||||
msgid "Graphical summary"
|
||||
msgstr ""
|
||||
msgstr "Grafický přehled"
|
||||
|
||||
#: pocheckerconsts.sguipofilecheckingtool
|
||||
msgid "GUI Po-file checking tool"
|
||||
@ -237,11 +233,11 @@ msgstr "[Řádek %d] Nekompatibilní/vadné argumenty funkce format():"
|
||||
|
||||
#: pocheckerconsts.slanguage
|
||||
msgid "Language:"
|
||||
msgstr ""
|
||||
msgstr "Jazyk:"
|
||||
|
||||
#: pocheckerconsts.slastsearchpath
|
||||
msgid "Last search path:"
|
||||
msgstr ""
|
||||
msgstr "Poslední cesta hledání:"
|
||||
|
||||
#: pocheckerconsts.slineinfilename
|
||||
msgid "[Line %d] in %s:"
|
||||
@ -257,7 +253,7 @@ msgstr "Identifikátor [%s] nalezen v %s, ale neexistuje v %s"
|
||||
|
||||
#: pocheckerconsts.snofileslefttocheck
|
||||
msgid "There are no files left to check."
|
||||
msgstr ""
|
||||
msgstr "Žádný další soubory pro kontrolu."
|
||||
|
||||
#: pocheckerconsts.snotestselected
|
||||
msgid "There are no tests selected."
|
||||
@ -265,7 +261,7 @@ msgstr "Nejsou vybrány žádné testy."
|
||||
|
||||
#: pocheckerconsts.snotetranslationisfuzzy
|
||||
msgid "Note: translation is fuzzy"
|
||||
msgstr ""
|
||||
msgstr "Poznámka: překlad je nejednoznačný"
|
||||
|
||||
#: pocheckerconsts.snrerrorsfound
|
||||
msgid "Found %d errors."
|
||||
@ -281,13 +277,15 @@ msgstr "%s: %d položek"
|
||||
|
||||
#: pocheckerconsts.snrwarningsfound
|
||||
msgid "Found %d warnings."
|
||||
msgstr "Nalezeno %d varování"
|
||||
msgstr "Nalezeno %d varování."
|
||||
|
||||
#: pocheckerconsts.sopenfail
|
||||
msgid ""
|
||||
"Unable to open file:\n"
|
||||
"\"%s\"\n"
|
||||
msgstr ""
|
||||
"Nelze otevřít soubor:\n"
|
||||
"\"%s\"\n"
|
||||
|
||||
#: pocheckerconsts.sopenfailexternal
|
||||
msgid ""
|
||||
@ -296,56 +294,54 @@ msgid ""
|
||||
"in external editor\n"
|
||||
"\"%s\"\n"
|
||||
msgstr ""
|
||||
"Nelze otevřít soubor\n"
|
||||
"\"%s\"\n"
|
||||
"ve vnějším editoru\n"
|
||||
"\"%s\"\n"
|
||||
|
||||
#: pocheckerconsts.sopenfileinexternaleditor
|
||||
msgid "Open file in external editor"
|
||||
msgstr ""
|
||||
msgstr "Otevřít soubor ve vnějším editoru"
|
||||
|
||||
#: pocheckerconsts.sopenfileinideeditor
|
||||
msgid "Open file in IDE editor"
|
||||
msgstr ""
|
||||
msgstr "Otevřít soubor v editoru IDE"
|
||||
|
||||
#: pocheckerconsts.sopenfileinsystempoeditor
|
||||
msgid "Open file in system PO editor"
|
||||
msgstr ""
|
||||
msgstr "Otevřít soubor v systémovém PO editoru"
|
||||
|
||||
#: pocheckerconsts.soriginal
|
||||
msgid "Original"
|
||||
msgstr "Originál"
|
||||
|
||||
#: pocheckerconsts.spercfuzzy
|
||||
#, fuzzy,badformat
|
||||
#| msgid "%s: %4.1f%% fuzzy strings."
|
||||
msgid "%s: %5.1f%% fuzzy strings."
|
||||
msgstr "Nepřesné překlady: %2.0f%%."
|
||||
msgstr "%s: %5.1f%% nejednoznačných řetězců."
|
||||
|
||||
#: pocheckerconsts.sperctranslated
|
||||
#, fuzzy,badformat
|
||||
#| msgid "%s: %4.1f%% translated strings."
|
||||
msgid "%s: %5.1f%% translated strings."
|
||||
msgstr "Přeloženo: %2.0f%%."
|
||||
msgstr "%s: %5.1f%% přeložených řetězců."
|
||||
|
||||
#: pocheckerconsts.spercuntranslated
|
||||
#, fuzzy,badformat
|
||||
#| msgid "%s: %4.1f%% untranslated strings."
|
||||
msgid "%s: %5.1f%% untranslated strings."
|
||||
msgstr "Nepřeloženo: %2.0f%%."
|
||||
msgstr "%s: %5.1f%% nepřeložených řetězců."
|
||||
|
||||
#: pocheckerconsts.sprocessingtranslationfamily
|
||||
msgid "Processing translation family..."
|
||||
msgstr ""
|
||||
msgstr "Zpracovávání překladové rodiny..."
|
||||
|
||||
#: pocheckerconsts.sprocessingtranslationfamilyof
|
||||
msgid "Processing translation family %s of %s"
|
||||
msgstr ""
|
||||
msgstr "Zpracovávání překladové rodiny %s z %s"
|
||||
|
||||
#: pocheckerconsts.srefreshalltranslationfamilies
|
||||
msgid "Refresh all translation families"
|
||||
msgstr ""
|
||||
msgstr "Obnovit všechny překladové rodiny"
|
||||
|
||||
#: pocheckerconsts.srefreshcurrenttranslationfamily
|
||||
msgid "Refresh current translation family"
|
||||
msgstr ""
|
||||
msgstr "Obnovit aktuální překladovou rodinu"
|
||||
|
||||
#: pocheckerconsts.sresults
|
||||
msgid "Results"
|
||||
@ -357,7 +353,7 @@ msgstr "&Spustit vybrané testy"
|
||||
|
||||
#: pocheckerconsts.ssaveas
|
||||
msgid "Save &As ..."
|
||||
msgstr ""
|
||||
msgstr "Uložit &jako..."
|
||||
|
||||
#: pocheckerconsts.ssaveerror
|
||||
msgid ""
|
||||
@ -369,19 +365,19 @@ msgstr ""
|
||||
|
||||
#: pocheckerconsts.sscandir
|
||||
msgid "Scan a folder"
|
||||
msgstr ""
|
||||
msgstr "Prozkoumat složku"
|
||||
|
||||
#: pocheckerconsts.sscanninginprogress
|
||||
msgid "Scanning in progress, please wait ..."
|
||||
msgstr ""
|
||||
msgstr "Běží zkoumání, prosím čekejte ..."
|
||||
|
||||
#: pocheckerconsts.sselectalllistbox
|
||||
msgid "Select all files"
|
||||
msgstr ""
|
||||
msgstr "Vybrat všechny soubory"
|
||||
|
||||
#: pocheckerconsts.sselectalltests
|
||||
msgid "Select &All"
|
||||
msgstr ""
|
||||
msgstr "Vybrat &vše"
|
||||
|
||||
#: pocheckerconsts.sselecttesttypes
|
||||
msgid "Select test types"
|
||||
@ -389,7 +385,7 @@ msgstr "Vybrat typy testu"
|
||||
|
||||
#: pocheckerconsts.sshowstatgraph
|
||||
msgid "Show statistics graph"
|
||||
msgstr ""
|
||||
msgstr "Ukázat statistický graf"
|
||||
|
||||
#: pocheckerconsts.sstathint
|
||||
msgid ""
|
||||
@ -398,50 +394,50 @@ msgid ""
|
||||
"Fuzzy: %d (%.1f%%)\n"
|
||||
"Errors in selected tests: %d\n"
|
||||
msgstr ""
|
||||
"Přeložených: %d (%.1f%%)\n"
|
||||
"Nepřeložených: %d (%.1f%%)\n"
|
||||
"Nejednoznačných: %d (%.1f%%)\n"
|
||||
"Chyb ve vybraných testech: %d\n"
|
||||
|
||||
#: pocheckerconsts.sthefollowingmissingmasterpofileswereremoved
|
||||
msgid "The following %s missing master .po file(s) were removed from the list:"
|
||||
msgstr ""
|
||||
msgstr "Následující %s cyhbějících hlavních .po souborů bylo odstraněno ze seznamu:"
|
||||
|
||||
#: pocheckerconsts.sthefollowingorphanedpofilesfound
|
||||
msgid "The following %s orphaned .po file(s) found:"
|
||||
msgstr ""
|
||||
msgstr "Nalezeno následujících %s sirotčích .po souborů:"
|
||||
|
||||
#: pocheckerconsts.stotalerrors
|
||||
#, fuzzy
|
||||
#| msgid "Total errors / warnings found: %d"
|
||||
msgid "Total errors: %d"
|
||||
msgstr "Nalezeno celkem %d chyb / varování."
|
||||
msgstr "Celkem chyb %d"
|
||||
|
||||
#: pocheckerconsts.stotalerrorsnonfuzzy
|
||||
msgid "Total errors: %d (formatting errors in non-fuzzy strings: %d)"
|
||||
msgstr ""
|
||||
msgstr "Celkem chyb: %d (chyb formátování mimo nejednoznačné řetězce: %d)"
|
||||
|
||||
#: pocheckerconsts.stotalfuzzystrings
|
||||
msgid "Total fuzzy strings: %s"
|
||||
msgstr ""
|
||||
msgstr "Celkem nejednoznačných řetězců: %s"
|
||||
|
||||
#: pocheckerconsts.stotaltranslatedstrings
|
||||
msgid "Total translated strings: %s (%.1f%%)"
|
||||
msgstr ""
|
||||
msgstr "Celkem přeložených řetězců: %s (%.1f%%)"
|
||||
|
||||
#: pocheckerconsts.stotaluntranslatedstrings
|
||||
msgid "Total untranslated strings: %s"
|
||||
msgstr ""
|
||||
msgstr "Celkem nepřeložených řetězců: %s"
|
||||
|
||||
#: pocheckerconsts.stotalwarnings
|
||||
#, fuzzy
|
||||
#| msgid "Total warnings found: %d"
|
||||
msgid "Total warnings: %d"
|
||||
msgstr "Celkem nalezeno varování: %d"
|
||||
msgstr "Celkem varování: %d"
|
||||
|
||||
#: pocheckerconsts.stranslatedstrings
|
||||
msgid "Translated strings"
|
||||
msgstr ""
|
||||
msgstr "Přeložené řetězce"
|
||||
|
||||
#: pocheckerconsts.stranslatedstringstotal
|
||||
msgid "Translated strings (total: %s [%.1f%%])"
|
||||
msgstr ""
|
||||
msgstr "Přeložených řetězců (celkem: %s [%.1f%%])"
|
||||
|
||||
#: pocheckerconsts.stranslation
|
||||
msgid "Translation"
|
||||
@ -449,25 +445,25 @@ msgstr "Překlad"
|
||||
|
||||
#: pocheckerconsts.stranslationstatistics
|
||||
msgid "Translation Statistics"
|
||||
msgstr ""
|
||||
msgstr "Statistika překladu"
|
||||
|
||||
#: pocheckerconsts.stroublesomefiles
|
||||
msgid "Troublesome files"
|
||||
msgstr ""
|
||||
msgstr "Problémové soubory"
|
||||
|
||||
#: pocheckerconsts.sunselectalltests
|
||||
msgid "&Unselect All"
|
||||
msgstr ""
|
||||
msgstr "&Odznačit soubory"
|
||||
|
||||
#: pocheckerconsts.sunselectlistbox
|
||||
msgid "Unselect all files"
|
||||
msgstr ""
|
||||
msgstr "&Odznačit všechny soubory"
|
||||
|
||||
#: pocheckerconsts.suntranslatedstrings
|
||||
msgid "Untranslated strings"
|
||||
msgstr ""
|
||||
msgstr "Nepřeložené řetězce"
|
||||
|
||||
#: pocheckerconsts.suntranslatedstringstotal
|
||||
msgid "Untranslated strings (total: %s)"
|
||||
msgstr ""
|
||||
msgstr "Nepřeložené řetězce (celkem: %s)"
|
||||
|
||||
|
@ -2,7 +2,7 @@ msgid ""
|
||||
msgstr ""
|
||||
"Project-Id-Version: Lazarus\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2018-11-13 13:58+0100\n"
|
||||
"PO-Revision-Date: 2018-11-16 10:40+0100\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
@ -5206,7 +5206,7 @@ msgstr "Nelze odstranit poslední režim."
|
||||
|
||||
#: lazarusidestrconsts.liscannotexecute
|
||||
msgid "cannot execute \"%s\""
|
||||
msgstr "nelze spustit \" %s\""
|
||||
msgstr "nelze spustit \"%s\""
|
||||
|
||||
#: lazarusidestrconsts.liscannotfind
|
||||
msgid "Cannot find %s"
|
||||
@ -12164,9 +12164,8 @@ msgid "Add &submenu right"
|
||||
msgstr "Přidat &podnabídku napravo"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
||||
#, fuzzy,badformat
|
||||
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
||||
msgstr "Nová šablona menu popsaná jako \"%s% byla uložena na základě %s, s %d podpoložkami"
|
||||
msgstr "Nová šablona menu popsaná jako \"%s\" byla uložena na základě %s, s %d podpoložkami"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
||||
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
||||
@ -12491,9 +12490,8 @@ msgid "Save menu shown as a new template"
|
||||
msgstr "Uložit zobrazenou nabídku jako novou šablonu"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
||||
#, fuzzy,badformat
|
||||
msgid "%s conflicts with %s"
|
||||
msgstr "% koliduje s %s"
|
||||
msgstr "%s koliduje s %s"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditorseparators
|
||||
msgid "Se¶tors"
|
||||
@ -17307,9 +17305,8 @@ msgid "Sort Unicode range list alphabetically"
|
||||
msgstr "Řadit Unicode seznam rozsahu abecedně"
|
||||
|
||||
#: lazarusidestrconsts.lissourceanddestinationaresame
|
||||
#, fuzzy,badformat
|
||||
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
|
||||
msgstr "Zdrojový \"%s\"%a cílový \"%s\"%sadresář je stejný. Prosím vyberte jiný adresář."
|
||||
msgstr "Zdrojový \"%s\"%sa cílový \"%s\"%sadresář je stejný. Prosím vyberte jiný adresář."
|
||||
|
||||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||||
msgid "Source and Destination are the same:%s%s"
|
||||
|
@ -4,12 +4,12 @@ msgstr ""
|
||||
"Project-Id-Version: JsonViewer\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: \n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: Václav Valíček <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: msgjsonviewer.sarray
|
||||
@ -38,15 +38,11 @@ msgid "JSON document modified"
|
||||
msgstr "JSON dokument upraven"
|
||||
|
||||
#: msgjsonviewer.sdocumentmodifiedaction
|
||||
#, fuzzy,badformat
|
||||
#| msgid ""
|
||||
#| "The JSON data was changed but not saved.\n"
|
||||
#| "What do want to do ?\n"
|
||||
msgid ""
|
||||
"The JSON data in \"%s\" was changed but not saved.\n"
|
||||
"What do want to do ?\n"
|
||||
msgstr ""
|
||||
"Data JSONu byla upravena, ale ne uložena.\n"
|
||||
"Data JSONu v \"%s\" byla upravena, ale neuložena.\n"
|
||||
"Co si přejete udělat?\n"
|
||||
|
||||
#: msgjsonviewer.sduplicatemembername
|
||||
|
@ -3,12 +3,13 @@ msgstr ""
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Project-Id-Version: \n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2013-03-10 13:47+0100\n"
|
||||
"Last-Translator: Václav Valíček <Valicek1994@gmail.com>\n"
|
||||
"PO-Revision-Date: 2018-11-16 12:50+0100\n"
|
||||
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
||||
"Language-Team: \n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"X-Generator: Poedit 1.5.5\n"
|
||||
"X-Generator: Poedit 2.2\n"
|
||||
"Language: cs\n"
|
||||
|
||||
#: lazdatadeskstr.eoaddterminator
|
||||
msgid "Add terminator"
|
||||
@ -225,8 +226,6 @@ msgid "Save SQL statement to file"
|
||||
msgstr "Uložit SQL příkaz do souboru"
|
||||
|
||||
#: lazdatadeskstr.simportdictinto
|
||||
#, fuzzy
|
||||
#| msgid "Import datadictionary"
|
||||
msgid "Import data dictionary"
|
||||
msgstr "Importovat datový slovník"
|
||||
|
||||
@ -412,10 +411,8 @@ msgid "Save &as"
|
||||
msgstr "Uložit &jako"
|
||||
|
||||
#: lazdatadeskstr.sld_actionsaveash
|
||||
#, fuzzy
|
||||
#| msgid "Save datadictionary as"
|
||||
msgid "Save data dictionary as"
|
||||
msgstr "Uložit slovník jako"
|
||||
msgstr "Uložit datový slovník jako"
|
||||
|
||||
#: lazdatadeskstr.sld_actionsaveh
|
||||
msgid "Save Data Dictionary"
|
||||
@ -457,10 +454,8 @@ msgid "Connections/Dictionaries"
|
||||
msgstr ""
|
||||
|
||||
#: lazdatadeskstr.sld_connecttoadatabase
|
||||
#, fuzzy,badformat
|
||||
#| msgid "Connect to a database"
|
||||
msgid "Connect to a database of type %s"
|
||||
msgstr "Připojit k databázi"
|
||||
msgstr "Připojit k databázi typu %s"
|
||||
|
||||
#: lazdatadeskstr.sld_createfulltablecreationsql
|
||||
msgid "Create full table creation SQL"
|
||||
@ -505,10 +500,8 @@ msgid "Host"
|
||||
msgstr "Hostitel"
|
||||
|
||||
#: lazdatadeskstr.sld_importupdatedatadictionary
|
||||
#, fuzzy
|
||||
#| msgid "Import/Update datadictionary"
|
||||
msgid "Import/Update data dictionary"
|
||||
msgstr "Importovat/Aktualizvoat datový slovník"
|
||||
msgstr "Importovat/Aktualizovat datový slovník"
|
||||
|
||||
#: lazdatadeskstr.sld_indent
|
||||
msgid "I&ndent"
|
||||
@ -560,11 +553,9 @@ msgid "&OK"
|
||||
msgstr "&OK"
|
||||
|
||||
#: lazdatadeskstr.sld_opendatadictionaryfilter
|
||||
#, fuzzy
|
||||
#| msgid "Data dictionary files|*.fpd|Ini files|*.ini|All files|*.*"
|
||||
msgctxt "lazdatadeskstr.sld_opendatadictionaryfilter"
|
||||
msgid "Data dictionary files (fdd)|*.fdd|Ini files|*.ini|All files|*.*"
|
||||
msgstr "Soubory datových slovníků|*.fpd|Ini files|*.ini|All files|*.*"
|
||||
msgstr "Soubory datových slovníků (fdd)|*.fdd|Ini soubory|*.ini|Všechny soubory|*.*"
|
||||
|
||||
#: lazdatadeskstr.sld_opendatadictionarytitle
|
||||
msgid "Open data dictionary"
|
||||
@ -593,11 +584,9 @@ msgid "Last used on"
|
||||
msgstr "Naposledy použito"
|
||||
|
||||
#: lazdatadeskstr.sld_savefileasfilter
|
||||
#, fuzzy
|
||||
#| msgid "Data dictionary files|*.fpd|Ini files|*.ini|All files|*.*"
|
||||
msgctxt "lazdatadeskstr.sld_savefileasfilter"
|
||||
msgid "Data dictionary files (fdd)|*.fdd|Ini files|*.ini|All files|*.*"
|
||||
msgstr "Soubory datových slovníků|*.fpd|Ini files|*.ini|All files|*.*"
|
||||
msgstr "Soubory datových slovníků (fdd)|*.fdd|Ini soubory|*.ini|Všechny soubory|*.*"
|
||||
|
||||
#: lazdatadeskstr.sld_savefileastitle
|
||||
msgid "Save file as"
|
||||
@ -692,10 +681,8 @@ msgid "New connection"
|
||||
msgstr "Nové připojení"
|
||||
|
||||
#: lazdatadeskstr.snewdictionary
|
||||
#, fuzzy
|
||||
#| msgid "New database"
|
||||
msgid "New data dictionary"
|
||||
msgstr "Nová databáze"
|
||||
msgstr "Nová datový slovník"
|
||||
|
||||
#: lazdatadeskstr.snewdomain
|
||||
msgid "Create new domain"
|
||||
@ -759,8 +746,6 @@ msgid "Database"
|
||||
msgstr "Databáze"
|
||||
|
||||
#: lazdatadeskstr.snodedatadictionary
|
||||
#, fuzzy
|
||||
#| msgid "Datadictionary"
|
||||
msgid "Data dictionary"
|
||||
msgstr "Datový slovník"
|
||||
|
||||
@ -836,10 +821,8 @@ msgid "Retry the statement"
|
||||
msgstr ""
|
||||
|
||||
#: lazdatadeskstr.srowsaffected
|
||||
#, fuzzy
|
||||
#| msgid "Query executed succesfully: %d rows affected."
|
||||
msgid "Query executed successfully: %d rows affected."
|
||||
msgstr "Dotaz vykonán úspěšně: %d záznamů ovlivněno"
|
||||
msgstr "Dotaz vykonán úspěšně: %d záznamů ovlivněno."
|
||||
|
||||
#: lazdatadeskstr.ssave
|
||||
msgid "Save SQL"
|
||||
|
Loading…
Reference in New Issue
Block a user