mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-06-03 11:38:17 +02:00
git-svn-id: trunk@45042 -
This commit is contained in:
maxim
parent
736a701bff
commit
a1808b1422
2
.gitattributes
vendored
2
.gitattributes
vendored
@ -247,6 +247,7 @@ components/activex/activexcontainer.pas svneol=native#text/plain
|
||||
components/activex/activexstrconsts.pas svneol=native#text/pascal
|
||||
components/activex/importtypelib.lfm svneol=native#text/plain
|
||||
components/activex/importtypelib.pas svneol=native#text/plain
|
||||
components/activex/languages/activexstrconsts.cs.po svneol=native#text/plain
|
||||
components/activex/languages/activexstrconsts.fi.po svneol=native#text/plain
|
||||
components/activex/languages/activexstrconsts.po svneol=native#text/plain
|
||||
components/activex/languages/activexstrconsts.ru.po svneol=native#text/plain
|
||||
@ -6928,6 +6929,7 @@ lcl/interfaces/wince/wincewsstdctrls.pp svneol=native#text/plain
|
||||
lcl/interfaces/wince/winext.pas svneol=native#text/plain
|
||||
lcl/intfgraphics.pas svneol=native#text/pascal
|
||||
lcl/languages/README.txt svneol=native#text/plain
|
||||
lcl/languages/customdrawncontrols.cs.po svneol=native#text/plain
|
||||
lcl/languages/customdrawncontrols.hu.po svneol=native#text/plain
|
||||
lcl/languages/customdrawncontrols.po svneol=native#text/plain
|
||||
lcl/languages/customdrawncontrols.ru.po svneol=native#text/plain
|
||||
|
||||
49
components/activex/languages/activexstrconsts.cs.po
Normal file
49
components/activex/languages/activexstrconsts.cs.po
Normal file
@ -0,0 +1,49 @@
|
||||
msgid ""
|
||||
msgstr ""
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Project-Id-Version: Lazarus Activex Component\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: \n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: activexstrconsts.axconvertdependanttypelibs
|
||||
msgid "Convert dependant typelibs"
|
||||
msgstr "Převect závislé typové knihovny"
|
||||
|
||||
#: activexstrconsts.axcreatepackage
|
||||
msgid "Create package"
|
||||
msgstr "Vytvořit balíček"
|
||||
|
||||
#: activexstrconsts.axcreatevisualcomponenttactivexcontainerdescendant
|
||||
msgid "Create visual component (TActiveXContainer descendant)"
|
||||
msgstr "Vytvořit vizuální komponentu (potomka TActiveXContainer)"
|
||||
|
||||
#: activexstrconsts.axfilecontainingtypelibrary
|
||||
msgid "File containing type library:"
|
||||
msgstr "Soubor obsahující typovou knihovnu:"
|
||||
|
||||
#: activexstrconsts.aximporttypelibrary
|
||||
msgid "Import Type Library"
|
||||
msgstr "Importovat typovou knihovnu"
|
||||
|
||||
#: activexstrconsts.aximporttypelibrarymenu
|
||||
msgid "Import Type Library ..."
|
||||
msgstr "Importovat typovou knihovnu ..."
|
||||
|
||||
#: activexstrconsts.axselectdirectorytostorepackageplpk
|
||||
msgid "Select directory to store package %sP.lpk"
|
||||
msgstr "Vyberte složku k uchování balíčku %sP.lpk"
|
||||
|
||||
#: activexstrconsts.axtypelibraryfilestlbdllexeocxolbtlbdllexeocxolballf
|
||||
msgid ""
|
||||
"Type library files (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;*.ocx;*."
|
||||
"olb|All Files (*.*)|*.*"
|
||||
msgstr ""
|
||||
"Soubory typových knihoven (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;"
|
||||
"*.ocx;*.olb|All Files (*.*)|*.*"
|
||||
@ -1,17 +1,23 @@
|
||||
msgid ""
|
||||
msgstr ""
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Project-Id-Version: \n"
|
||||
"Project-Id-Version: Lazarus AnchorDocking Component\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: \n"
|
||||
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
|
||||
"Language-Team: \n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"Language: cs\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho
|
||||
msgid "A free side of a splitter must not be anchored: Node=%s%s%s Type=%s Anchors[%s]=%s%s%s"
|
||||
msgid ""
|
||||
"A free side of a splitter must not be anchored: Node=%s%s%s Type=%s "
|
||||
"Anchors[%s]=%s%s%s"
|
||||
msgstr ""
|
||||
"Volná strana děliče nesmí být ukotvena: Uzel=%s%s%s Typ=%s Kotvy[%s]=%s%s%s"
|
||||
|
||||
#: anchordockstr.adrsallfiles
|
||||
msgid "All files"
|
||||
@ -19,27 +25,31 @@ msgstr "Všechny soubory"
|
||||
|
||||
#: anchordockstr.adrsamountofpixelthemousehastodragbeforedragstarts
|
||||
msgid "Amount of pixel the mouse has to drag before drag starts"
|
||||
msgstr ""
|
||||
msgstr "Počet pixelů které musí myš táhnout, než posouvání začne"
|
||||
|
||||
#: anchordockstr.adrsanchordockinglayout
|
||||
msgid "Anchor Docking Layout"
|
||||
msgstr ""
|
||||
msgstr "Rozložení Kotvení-Dokování"
|
||||
|
||||
#: anchordockstr.adrsanchorisnotsplitternodeanchors
|
||||
msgid "Anchor is not splitter: Node=%s%s%s Anchors[%s]=%s%s%s"
|
||||
msgstr ""
|
||||
msgstr "Kotva není dělič: Uzel=%s%s%s Kotvy[%s]=%s%s%s"
|
||||
|
||||
#: anchordockstr.adrsanchornotfoundnodeanchors
|
||||
msgid "Anchor not found: Node=%s%s%s Anchors[%s]=%s%s%s"
|
||||
msgstr ""
|
||||
msgstr "Kotva nenalezena: Uzel=%s%s%s Kotvy[%s]=%s%s%s"
|
||||
|
||||
#: anchordockstr.adrsanchortowrongsideofsplitternodeanchors
|
||||
msgid "Anchor to wrong side of splitter: Node=%s%s%s Anchors[%s]=%s%s%s"
|
||||
msgstr ""
|
||||
msgstr "Kotva na špatnou stranu děliče: Uzel=%s%s%s Kotvy[%s]=%s%s%s"
|
||||
|
||||
#: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors
|
||||
msgid "A page must not be anchored: Node=%s%s%s Parent=%s ParentType=%s Anchors[%s]=%s%s%s"
|
||||
msgid ""
|
||||
"A page must not be anchored: Node=%s%s%s Parent=%s ParentType=%s Anchors[%s]="
|
||||
"%s%s%s"
|
||||
msgstr ""
|
||||
"Stránka nesmí být kotvena: Uzel=%s%s%s Rodič=%s Typ Rodiče=%s Kotvy[%s]=%s%s"
|
||||
"%s"
|
||||
|
||||
#: anchordockstr.adrsautomatically
|
||||
msgid "Automatically"
|
||||
@ -47,7 +57,7 @@ msgstr "Automaticky"
|
||||
|
||||
#: anchordockstr.adrsbottom
|
||||
msgid "bottom"
|
||||
msgstr "dole"
|
||||
msgstr "dolů"
|
||||
|
||||
#: anchordockstr.adrsclose
|
||||
msgid "Close"
|
||||
@ -55,19 +65,19 @@ msgstr "Zavřít"
|
||||
|
||||
#: anchordockstr.adrscontrolisalreadyadocksite
|
||||
msgid "control is already a docksite"
|
||||
msgstr ""
|
||||
msgstr "prvek již je dokován"
|
||||
|
||||
#: anchordockstr.adrscustomdocksitecanhaveonlyonesite
|
||||
msgid "Custom dock site %s%s%s can have only one site."
|
||||
msgstr ""
|
||||
msgstr "Vlastní dok %s%s%s může mít pouze jednu stranu."
|
||||
|
||||
#: anchordockstr.adrsdockinganchordocking
|
||||
msgid "Docking / Anchordocking"
|
||||
msgstr ""
|
||||
msgstr "Dokování/skládání oken"
|
||||
|
||||
#: anchordockstr.adrsdockingoptions
|
||||
msgid "Docking options"
|
||||
msgstr "Volby ukotvení"
|
||||
msgstr "Nastavení kotvení"
|
||||
|
||||
#: anchordockstr.adrsdraganddockc
|
||||
#| msgid "Use the mouse to drag and dock window \"%c\""
|
||||
@ -76,15 +86,19 @@ msgstr "Použijte myš k uchopení a ukotvení okna \"%s\""
|
||||
|
||||
#: anchordockstr.adrsdragthreshold
|
||||
msgid "Drag threshold"
|
||||
msgstr ""
|
||||
msgstr "Hranice přetahování"
|
||||
|
||||
#: anchordockstr.adrsduplicatename
|
||||
msgid "Duplicate name: "
|
||||
msgstr "Vícenásobné jméno:"
|
||||
|
||||
#: anchordockstr.adrseachdockedwindowhasaheaderthatallowsdragginghasaco
|
||||
msgid "Each docked window has a header that allows dragging, has a context menu with extra layout functions and shows the caption of the docked window"
|
||||
msgid ""
|
||||
"Each docked window has a header that allows dragging, has a context menu "
|
||||
"with extra layout functions and shows the caption of the docked window"
|
||||
msgstr ""
|
||||
"Každé dokované okno má hlavičku, která umožňuje přetahování, má kontextové "
|
||||
"menu s extra funkcemi rozložení a ukazuje titulek dokoveného okna"
|
||||
|
||||
#: anchordockstr.adrsemptyname
|
||||
msgid "Empty name: "
|
||||
@ -96,7 +110,7 @@ msgstr "Rozšířit"
|
||||
|
||||
#: anchordockstr.adrsenlargeside
|
||||
msgid "Enlarge %s side"
|
||||
msgstr "Rozšířit %s stranu"
|
||||
msgstr "Rozšířit směrem %s"
|
||||
|
||||
#: anchordockstr.adrserror
|
||||
msgid "Error"
|
||||
@ -112,19 +126,19 @@ msgstr "Chyba zapisování rozvržení oken do souboru \"%s\"%s%s"
|
||||
|
||||
#: anchordockstr.adrsfilledheaders
|
||||
msgid "Fill headers"
|
||||
msgstr ""
|
||||
msgstr "Vyplnit záhlaví"
|
||||
|
||||
#: anchordockstr.adrsfilledheadershint
|
||||
msgid "Fill headers of docked controls"
|
||||
msgstr ""
|
||||
msgstr "Vyplnit záhlaví dokovaných komponent"
|
||||
|
||||
#: anchordockstr.adrsflattenheaders
|
||||
msgid "Flatten headers"
|
||||
msgstr ""
|
||||
msgstr "Zarovnat záhlaví"
|
||||
|
||||
#: anchordockstr.adrsflattenheadershint
|
||||
msgid "Flatten headers of docked controls"
|
||||
msgstr ""
|
||||
msgstr "Zarovnat záhlaví dokovaných komponent"
|
||||
|
||||
#: anchordockstr.adrsgeneraldockingoptions
|
||||
msgid "General docking options"
|
||||
@ -132,23 +146,27 @@ msgstr "Obecné volby ukotvení"
|
||||
|
||||
#: anchordockstr.adrsheaderalignleft
|
||||
msgid "Header align left"
|
||||
msgstr ""
|
||||
msgstr "Limit pro záhlaví zobrazené vlevo"
|
||||
|
||||
#: anchordockstr.adrsheaderaligntop
|
||||
msgid "Header align top"
|
||||
msgstr ""
|
||||
msgstr "Limit pro záhlaví zobrazené nahoře"
|
||||
|
||||
#: anchordockstr.adrsheaderposition
|
||||
msgid "Header position"
|
||||
msgstr "Pozice hlavičky"
|
||||
msgstr "Umístit hlavičku"
|
||||
|
||||
#: anchordockstr.adrsheaderstyle
|
||||
msgid "Header Style:"
|
||||
msgstr ""
|
||||
msgstr "Styl záhlaví:"
|
||||
|
||||
#: anchordockstr.adrshideheadercaptionsforsiteswithonlyonedockedcontrol
|
||||
msgid "Hide header captions for sites with only one docked control, as that is already shown in the normal window title"
|
||||
msgid ""
|
||||
"Hide header captions for sites with only one docked control, as that is "
|
||||
"already shown in the normal window title"
|
||||
msgstr ""
|
||||
"Skrýt popisky ze záhlaví, pokud je pouze jedna položka v okně, tzn titulek "
|
||||
"je zobrazen v titulku okna"
|
||||
|
||||
#: anchordockstr.adrsleft
|
||||
msgid "left"
|
||||
@ -181,38 +199,42 @@ msgstr "nelze ukotvit modální formuláře"
|
||||
#: anchordockstr.adrsmoveheadertoleftwhenwidthheight100headeralignleft
|
||||
msgid "Move header to left when (Width/Height)*100>=HeaderAlignLeft"
|
||||
msgstr ""
|
||||
"Posunout záhlaví vlevo, pokud poměr (Šířka/Výška)*100 přesáhne zadanou "
|
||||
"hodnotu"
|
||||
|
||||
#: anchordockstr.adrsmoveheadertotopwhenwidthheight100headeraligntop
|
||||
msgid "Move header to top when (Width/Height)*100<=HeaderAlignTop"
|
||||
msgstr ""
|
||||
"Posunout záhlaví nahoru, pokud poměr (Šířka/Výška)*100 přesáhne zadanou "
|
||||
"hodnotu"
|
||||
|
||||
#: anchordockstr.adrsmovepageleft
|
||||
msgid "Move page left"
|
||||
msgstr ""
|
||||
msgstr "Posunout vlevo"
|
||||
|
||||
#: anchordockstr.adrsmovepageleftmost
|
||||
msgid "Move page leftmost"
|
||||
msgstr ""
|
||||
msgstr "Posunout nejvíce vlevo"
|
||||
|
||||
#: anchordockstr.adrsmovepageright
|
||||
msgid "Move page right"
|
||||
msgstr ""
|
||||
msgstr "Posunout vpravo"
|
||||
|
||||
#: anchordockstr.adrsmovepagerightmost
|
||||
msgid "Move page rightmost"
|
||||
msgstr ""
|
||||
msgstr "Posunout nejvíce vpravo"
|
||||
|
||||
#: anchordockstr.adrsnocaptionsforfloatingsites
|
||||
msgid "No captions for floating sites"
|
||||
msgstr ""
|
||||
msgstr "Skrýt popisky samostatných položek"
|
||||
|
||||
#: anchordockstr.adrsnochildrenallowedfornodetype
|
||||
msgid "No children allowed for Node=%s%s%s Type=%s"
|
||||
msgstr ""
|
||||
msgstr "Žádní potomci nejsou povolení pro Uzel=%s%s%s Typ=%s"
|
||||
|
||||
#: anchordockstr.adrsnotsupportedhasparent
|
||||
msgid "Not supported: %s has parent %s"
|
||||
msgstr ""
|
||||
msgstr "Nepodporováno: %s má rodiče %s"
|
||||
|
||||
#: anchordockstr.adrsquit
|
||||
msgid "Quit %s"
|
||||
@ -220,11 +242,11 @@ msgstr "Ukončit %s"
|
||||
|
||||
#: anchordockstr.adrsrequestedbutcreated
|
||||
msgid "%s requested, but %s created"
|
||||
msgstr ""
|
||||
msgstr "%s požadováno,ale %s vytvořeno"
|
||||
|
||||
#: anchordockstr.adrsrestoredefaultlayout
|
||||
msgid "Restore default layout"
|
||||
msgstr ""
|
||||
msgstr "Obnovit výchozí rozložení"
|
||||
|
||||
#: anchordockstr.adrsright
|
||||
msgid "right"
|
||||
@ -244,23 +266,23 @@ msgstr "Uložit rozvržení oken do souboru (*.xml)"
|
||||
|
||||
#: anchordockstr.adrsscaleonresize
|
||||
msgid "Scale on resize"
|
||||
msgstr ""
|
||||
msgstr "Změna velikosti v měřítku"
|
||||
|
||||
#: anchordockstr.adrsscalesubsiteswhenasiteisresized
|
||||
msgid "Scale sub sites when a site is resized"
|
||||
msgstr ""
|
||||
msgstr "Měnit velikost podpoložek pokud je velikost hlavního okna změněna"
|
||||
|
||||
#: anchordockstr.adrsshowcaptionsofdockedcontrolsintheheader
|
||||
msgid "Show captions of docked controls in the header"
|
||||
msgstr ""
|
||||
msgstr "Zobrazit popisek dokovaných komponent v záhlaví"
|
||||
|
||||
#: anchordockstr.adrsshowheadercaptions
|
||||
msgid "Show header captions"
|
||||
msgstr ""
|
||||
msgstr "Zobrazit popisky v záhlaví"
|
||||
|
||||
#: anchordockstr.adrsshowheaders
|
||||
msgid "Show headers"
|
||||
msgstr ""
|
||||
msgstr "Zobrazit záhlaví"
|
||||
|
||||
#: anchordockstr.adrssplitterthickness
|
||||
msgid "Splitter thickness"
|
||||
@ -275,12 +297,18 @@ msgid "Tab position"
|
||||
msgstr "Pozice záložek"
|
||||
|
||||
#: anchordockstr.adrsthereisanotherdockmasterinstalledonlyonedockingpac
|
||||
msgid "There is another dock master installed. Only one docking package can be installed at a time. Please uninstall the other dock master %s and restart the IDE"
|
||||
msgstr "Už je instalován jiný správce ukotvení. Může být instalován najednou pouze jeden ukotvovací balíček. Prosíme odinstalujte jiný správce ukotvení %sa restartujte IDE"
|
||||
msgid ""
|
||||
"There is another dock master installed. Only one docking package can be "
|
||||
"installed at a time. Please uninstall the other dock master %s and restart "
|
||||
"the IDE"
|
||||
msgstr ""
|
||||
"Už je instalován jiný správce ukotvení. Může být instalován najednou pouze "
|
||||
"jeden ukotvovací balíček. Prosíme odinstalujte jiný správce ukotvení %sa "
|
||||
"restartujte IDE"
|
||||
|
||||
#: anchordockstr.adrstop
|
||||
msgid "top"
|
||||
msgstr "nahoře"
|
||||
msgstr "nahoru"
|
||||
|
||||
#: anchordockstr.adrstouseanchordockingyoumustfirstuninstall
|
||||
msgid "To use anchordocking you must first uninstall %s"
|
||||
@ -288,5 +316,4 @@ msgstr "K použití anchordicking musíte nejdříve odinstalovat %s"
|
||||
|
||||
#: anchordockstr.adrsundock
|
||||
msgid "Undock"
|
||||
msgstr "Odkotvit"
|
||||
|
||||
msgstr "Uvolnit"
|
||||
|
||||
@ -31,11 +31,11 @@ msgstr ""
|
||||
|
||||
#: pocheckerconsts.scheckforduplicateuntranslatedvalues
|
||||
msgid "Check for duplicate untranslated values"
|
||||
msgstr "Zkontrolovat výskyt duplikátních nepřeložených hodnot"
|
||||
msgstr "Zkontrolovat výskyt duplicitních nepřeložených hodnot"
|
||||
|
||||
#: pocheckerconsts.scheckforincompatibleformatarguments
|
||||
msgid "Check for incompatible format arguments"
|
||||
msgstr "Zkontrolovat výskyt nekompatibilních argumentů fce format"
|
||||
msgstr "Zkontrolovat výskyt nekompatibilních argumentů funkce format"
|
||||
|
||||
#: pocheckerconsts.scheckformismatchesinuntranslatedstrings
|
||||
msgid "Check for mismatches in untranslated strings"
|
||||
@ -51,8 +51,7 @@ msgstr "Zkontrolovat počet položek"
|
||||
|
||||
#: pocheckerconsts.scheckstatistics
|
||||
msgid "Check percentage of (un)translated and fuzzy strings"
|
||||
msgstr ""
|
||||
"Zkontrolovat procentuelní zastoupení (ne)přeložených a nepřesných řetězců"
|
||||
msgstr "Spočítat procentuální zastoupení (ne)přeložených a nepřesných řetězců"
|
||||
|
||||
#: pocheckerconsts.scopycaption
|
||||
msgid "Copy to clipboard"
|
||||
@ -60,7 +59,7 @@ msgstr "Kopírovat do schránky"
|
||||
|
||||
#: pocheckerconsts.scurrentpofile
|
||||
msgid "Current po-file:"
|
||||
msgstr "Aktuální PO soubor:"
|
||||
msgstr "Současný PO soubor:"
|
||||
|
||||
#: pocheckerconsts.scurrenttest
|
||||
msgid "Current Test:"
|
||||
@ -80,7 +79,7 @@ msgid ""
|
||||
"%s\n"
|
||||
"Please close the program\n"
|
||||
msgstr ""
|
||||
"Stala se neopravitelná chyba\n"
|
||||
"Nastala fatální chyba\n"
|
||||
"%s\n"
|
||||
"Prosím ukončete program\n"
|
||||
|
||||
@ -89,12 +88,12 @@ msgid ""
|
||||
"Error creating an instance of TPoFamily:\n"
|
||||
"%s\n"
|
||||
msgstr ""
|
||||
"Chyba vytváření instance z TPoRodiny:\n"
|
||||
"Chyba vytváření instance z TPoFamily:\n"
|
||||
"%s\n"
|
||||
|
||||
#: pocheckerconsts.serrorsbytest
|
||||
msgid "Errors / warnings reported by %s for:"
|
||||
msgstr "Chyby / varování nahlášená %s pro:"
|
||||
msgstr "Chyby / varování nahlášené %s pro:"
|
||||
|
||||
#: pocheckerconsts.sfindalltranslatedpofiles
|
||||
msgid "Find all translated po-files"
|
||||
@ -169,15 +168,15 @@ msgstr "Originál"
|
||||
|
||||
#: pocheckerconsts.spercfuzzy
|
||||
msgid "Fuzzy strings: %2.0f%%."
|
||||
msgstr "Nepřesné řetězce: %2.0f%%."
|
||||
msgstr "Nepřesné překlady: %2.0f%%."
|
||||
|
||||
#: pocheckerconsts.sperctranslated
|
||||
msgid "Translated strings: %2.0f%%."
|
||||
msgstr "Přeložené řetězce: %2.0f%%."
|
||||
msgstr "Přeloženo: %2.0f%%."
|
||||
|
||||
#: pocheckerconsts.spercuntranslated
|
||||
msgid "Untranslated strings: %2.0f%%."
|
||||
msgstr "Nepřeložené řetězce: %2.0f%%."
|
||||
msgstr "Nepřeloženo: %2.0f%%."
|
||||
|
||||
#: pocheckerconsts.sresults
|
||||
msgid "Results"
|
||||
|
||||
@ -2,7 +2,7 @@ msgid ""
|
||||
msgstr ""
|
||||
"Project-Id-Version: Lazarus\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2014-05-13 09:00+0100\n"
|
||||
"PO-Revision-Date: 2014-05-14 09:18+0100\n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
@ -3209,7 +3209,7 @@ msgstr "Neuložený řádek"
|
||||
|
||||
#: lazarusidestrconsts.dlgusecodefolding
|
||||
msgid "Code Folding"
|
||||
msgstr "Zabalování kódu"
|
||||
msgstr "Skládání bloků kódu"
|
||||
|
||||
#: lazarusidestrconsts.dlgusecustomconfig
|
||||
msgid "Use additional compiler config file"
|
||||
@ -3673,7 +3673,7 @@ msgstr "Jméno jednotky %s%s%s nesouhlasí s názvem souboru."
|
||||
|
||||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||||
#, fuzzy
|
||||
#| msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages.The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages.The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
||||
#| msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages.The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages.The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages.The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
||||
msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
||||
msgstr "Jméno jednotky %s%s%s je stejné jako má registrované komponenta.%sToto použití může způsobit podivná chybová hlášení."
|
||||
|
||||
@ -3739,7 +3739,7 @@ msgstr "Oficiální:"
|
||||
|
||||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||||
#, fuzzy
|
||||
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it.A %s cannot hold TControls.%sYou can only put non visual components on it.A %s cannot hold TControls.%sYou can only put non visual components on it."
|
||||
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it.A %s cannot hold TControls.%sYou can only put non visual components on it.A %s cannot hold TControls.%sYou can only put non visual components on it.A %s cannot hold TControls.%sYou can only put non visual components on it."
|
||||
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
||||
msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze negrafické komponenty."
|
||||
|
||||
@ -4476,7 +4476,7 @@ msgstr "Zkopírovat výstup do schránky"
|
||||
|
||||
#: lazarusidestrconsts.lisccodatesdiffer
|
||||
#, fuzzy
|
||||
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %sThe dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %sThe dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||||
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %sThe dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %sThe dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %sThe dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||||
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||||
msgstr "Datumy .ppu souborů FPC se liší o víc než hodinu.%sTo může znamenat, že jsou z různých instalací.%sSoubor1: %s%sSoubor2: %s"
|
||||
|
||||
@ -5457,9 +5457,9 @@ msgstr "Akce: %s"
|
||||
|
||||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||||
#, fuzzy
|
||||
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||||
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||||
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||||
msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůže mít ručně vytvořené uzly potomků."
|
||||
msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůžou mít ručně vytvořené uzly potomků."
|
||||
|
||||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||||
msgid "%s, auto generated"
|
||||
@ -6613,9 +6613,9 @@ msgstr "Řádek kurzoru v aktuálním editoru"
|
||||
|
||||
#: lazarusidestrconsts.liscustomopthint
|
||||
#, fuzzy
|
||||
#| msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces.These options are passed to the compiler after comments are deleted and macros are replaced.These options are passed to the compiler after comments are deleted and macros are replaced."
|
||||
#| msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces.These options are passed to the compiler after comments are deleted and macros are replaced.These options are passed to the compiler after comments are deleted and macros are replaced.These options are passed to the compiler after comments are deleted and macros are replaced."
|
||||
msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
|
||||
msgstr "Tyto volby jsou přímo předány do překladače jakmile jsou Makra nahrazena a komentáře odstraněny."
|
||||
msgstr "Tyto volby jsou přímo předány překladači jakmile jsou Makra nahrazena a komentáře odstraněny."
|
||||
|
||||
#: lazarusidestrconsts.liscustomoptions
|
||||
msgid "custom options"
|
||||
@ -6808,9 +6808,9 @@ msgstr "Přesto nastavit bod přerušení"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||||
#, fuzzy
|
||||
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu.There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu.There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||||
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu.There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu.There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu.There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||||
msgstr "Není zadaný ladič.%sNastavení bodu přerušení nemá význam, dokud nenastavíte ladič v dialogu Volby ladiče v menu."
|
||||
msgstr "Není nastaven ladič.%sNastavení bodu přerušení nemá význam, dokud nenastavíte ladič v dialogu Volby ladiče v menu."
|
||||
|
||||
#: lazarusidestrconsts.lisdbgwinpower
|
||||
msgid "On/Off"
|
||||
@ -9315,7 +9315,7 @@ msgstr "Upravit kontextově citlivou nápovědu"
|
||||
|
||||
#: lazarusidestrconsts.liskmencloseselection
|
||||
msgid "Enclose Selection"
|
||||
msgstr "Obklopit výběr"
|
||||
msgstr "Zabalit výběr do bloku kódu"
|
||||
|
||||
#: lazarusidestrconsts.liskmevaluatemodify
|
||||
msgid "Evaluate/Modify"
|
||||
@ -12944,25 +12944,25 @@ msgstr "Selhal překlad balíčku %s%s%s.%sOdstranit jej z instalačního seznam
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||||
#, fuzzy
|
||||
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name.The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name.The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
||||
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name.The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name.The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name.The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
||||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
||||
msgstr "Jméno souboru balíčku %s%s%s v%s%s%s%s není platné jméno balíčku Lazarusu."
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||||
#, fuzzy
|
||||
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||||
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||||
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||||
msgstr "Balíček %s je balíčkem běhovým. %sBěhové balíčky nelze instalovat do IDE."
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
||||
#, fuzzy
|
||||
#| msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies.The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies.The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||||
#| msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies.The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies.The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies.The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||||
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||||
msgstr "Balíček %s je překládán automaticky a jeho výstupní adresář je \"%s\", což je přednastavená prohledávaná cesta jednotek překladače. Balíček používá jiné balíčky, které rovněž používají přednastavenou prohledávanou cestu jednotek překladače. To vytváří nekonečnou smyčku.%sTento problém%smůžete opravit odstraněním cesty z Vaší konfigurace překladače (např.: fpc.cfg)%snebo zakázáním automatické změny tohoto balíčku%snebo odstraněním závislostí."
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||||
#, fuzzy
|
||||
#| msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
||||
#| msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
||||
msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
||||
msgstr "Balíček %s%s%s je označen k instalaci, ale nedá se najít.%sOdstranit závislost ze seznamu instalovaných balíčků?"
|
||||
|
||||
@ -12980,13 +12980,13 @@ msgstr "Jméno balíčku %s%s%s %ssouboru %s%s%s je neplatné."
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||||
#, fuzzy
|
||||
#| msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
#| msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
msgstr "Balíček %s%s%s byl označen.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečné odinstalování vyžaduje znovu sestavení a restartování lazarusu.%s%sChcete teď znovu sestavit Lazarus?"
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||||
#, fuzzy
|
||||
#| msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
#| msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||||
msgstr "Balíček %s%s%s byl označen pro instalaci.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečná instalace vyžaduje znovu sestavení a restart lazarusu.%s%sChcete teď znovu sestavit Lazarus?"
|
||||
|
||||
@ -13044,7 +13044,7 @@ msgstr "Nelze vytvořit zdrojový adresář %s%s%s%s balíčku %s."
|
||||
|
||||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||||
#, fuzzy
|
||||
#| msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages.Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages.Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||||
#| msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages.Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages.Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages.Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||||
msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||||
msgstr "Nelze vytvořit cílový adresář Lazarusu:%s%s%s%s.%sTento adresář je nutný pro nové, změněné Lazarus IDE s vlastními balíčky."
|
||||
|
||||
@ -14824,7 +14824,7 @@ msgstr "Aplikační balík byl vytvořen pro \"%s\""
|
||||
|
||||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||||
#, fuzzy
|
||||
#| msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste.The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste.The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||||
#| msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste.The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste.The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste.The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||||
msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||||
msgstr "Třída %s%s%s je TControl a nemůže být vložena na neovládací prvek.%sNelze vložit."
|
||||
|
||||
@ -14866,7 +14866,7 @@ msgstr "Komponenta %s je zděděná z %s.%sKe přejmenování zděděné kompone
|
||||
|
||||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||||
#, fuzzy
|
||||
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier.The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier.The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||||
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier.The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier.The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier.The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||||
msgstr "Jméno komponenty musí být jedinečné ve všech komponentách na formuláři/datovém modulu. Jméno je porovnáváno bez citlivosti na velikost písmen jako normální identifikátor pascalu."
|
||||
|
||||
@ -14957,7 +14957,7 @@ msgstr "Soubor %s%s%s je symbolický odkaz.%s%sOtevřít místo něj %s%s%s?"
|
||||
|
||||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||||
#, fuzzy
|
||||
#| msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
|
||||
#| msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
|
||||
msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
|
||||
msgstr "Soubor %s%s%s není projekt lazarusu.%sVytvořit nový projekt pro %s?"
|
||||
|
||||
@ -14971,13 +14971,13 @@ msgstr "Maska souboru \"%s\" není platný regulární výraz."
|
||||
|
||||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||||
#, fuzzy
|
||||
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source.The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source.The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||||
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source.The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source.The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source.The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||||
msgstr "Soubor %s%s%s%svypadá jako program. Zavřít aktuální projekt a vytvořit nový projekt Lazarusu pro tento program?%s\"Ne\" načte soubor jako normální zdroj."
|
||||
|
||||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||||
#, fuzzy
|
||||
#| msgid "The file %s seems to be the program file of an existing lazarus Project.The file %s seems to be the program file of an existing Lazarus Project.The file %s seems to be the program file of an existing Lazarus Project."
|
||||
#| msgid "The file %s seems to be the program file of an existing lazarus Project.The file %s seems to be the program file of an existing Lazarus Project.The file %s seems to be the program file of an existing Lazarus Project.The file %s seems to be the program file of an existing Lazarus Project."
|
||||
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
||||
msgstr "Soubor %s vypadá, že je programový soubor existujícího projektu Lazarusu."
|
||||
|
||||
@ -15031,7 +15031,7 @@ msgstr "Adresář Lazarusu \"%s\" nevypadá v pořádku:%s%s"
|
||||
|
||||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||||
#, fuzzy
|
||||
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||||
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||||
msgstr "Soubor LFM (formulář Lazarusu) obsahuje neplatné vlastnosti. To například znamená, že obsahuje nějaké vlastnosti/třídy, které neexistují v aktuálním LCL. Obvyklá oprava je odstranit tyto vlastnosti z lfm a ručně opravit kód Pascalu."
|
||||
|
||||
@ -15045,7 +15045,7 @@ msgstr "Spouštěcí soubor \"make\" má obvykle jméno \"%s\". Je potřeba pro
|
||||
|
||||
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
||||
#, fuzzy
|
||||
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s?The new include file is not yet in the include search path.%sAdd directory %s to build modes?The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
|
||||
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s?The new include file is not yet in the include search path.%sAdd directory %s to build modes?The new include file is not yet in the include search path.%sAdd directory %s to build modes?The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
|
||||
msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
|
||||
msgstr "Nový zahrnovaný soubor ještě není ve vyhledávací cestě zahrnutí.%sPřidat adresář %s do režimů sestavení?"
|
||||
|
||||
@ -15108,7 +15108,7 @@ msgstr "Balíček již obsahuje jednotku s tímto jménem."
|
||||
|
||||
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
||||
#, fuzzy
|
||||
#| msgid "The package %s can not be installed, because it requires the package \"%s\", which is a runtime only package.The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package.The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
||||
#| msgid "The package %s can not be installed, because it requires the package \"%s\", which is a runtime only package.The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package.The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package.The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
||||
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
||||
msgstr "Balíček %s nelze nainstalovat, protože vyžaduje balíček \"%s\", který je balíčkem běhovým."
|
||||
|
||||
@ -15126,7 +15126,7 @@ msgstr "Balíček %s je již v seznamu"
|
||||
|
||||
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
||||
#, fuzzy
|
||||
#| msgid "The package %s is not a design time package. It cannot be installed in the IDEThe package %s is not a design time package. It cannot be installed in the IDE.The package %s is not a design time package. It cannot be installed in the IDE."
|
||||
#| msgid "The package %s is not a design time package. It cannot be installed in the IDEThe package %s is not a design time package. It cannot be installed in the IDE.The package %s is not a design time package. It cannot be installed in the IDE.The package %s is not a design time package. It cannot be installed in the IDE."
|
||||
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
||||
msgstr "Balíček %s není balíčkem designovým. Nelze jej nainstalovat v IDE"
|
||||
|
||||
@ -15136,9 +15136,9 @@ msgstr "Cesta \"make\" není správná: \"%s\""
|
||||
|
||||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||||
#, fuzzy
|
||||
#| msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%sThe program %smake%s was not found.%sThis tool is needed to build Lazarus.%sThe program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
||||
#| msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%sThe program %smake%s was not found.%sThis tool is needed to build Lazarus.%sThe program %smake%s was not found.%sThis tool is needed to build Lazarus.%sThe program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
||||
msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
||||
msgstr "Program %smake%s nebyl nalezen.%sTento nástroj je nutný k sestavení Lazarusu.%s"
|
||||
msgstr "Program %smake%s nenalezen.%sTento nástroj je nutný k sestavení Lazarusu.%s"
|
||||
|
||||
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
||||
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
||||
@ -15319,7 +15319,7 @@ msgstr "tato zpráva nápovědy"
|
||||
|
||||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||||
#, fuzzy
|
||||
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||||
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||||
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||||
msgstr "Vypadá to jako pascalovský soubor.%sDoporučujeme ve jméně použít malá písmena, aby jste předešli problémům na některých souborových systémech a různých překladačích.%sPřejmenovat na malá písmena?"
|
||||
|
||||
@ -15640,7 +15640,7 @@ msgstr "Hledaný řetězec '%s' nenalezen!"
|
||||
|
||||
#: lazarusidestrconsts.lisuethecurre
|
||||
#, fuzzy
|
||||
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options.The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options.The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||||
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options.The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options.The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options.The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||||
msgstr "Aktuální písmo editoru nepodporuje UTF-8, ale váš sytém vypadá, že ho používá.%sTo znamená, že ne-ASCII budou pravděpodobně zobrazeny nekorektně.%sMůžete vybrat jiný font v nastavení editoru."
|
||||
|
||||
@ -15841,7 +15841,7 @@ msgstr "Nelze nalézt soubor %s%s%s."
|
||||
|
||||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||||
#, fuzzy
|
||||
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> TestUnable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> TestUnable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||||
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> TestUnable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> TestUnable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> TestUnable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||||
msgstr "Nelze najít soubor %s%s%s.%sPokud patří do Vašeho projektu, zkontrolujte cestu hledání v %sProjekt -> Volby překladače -> Prohledávané cesty -> Ostatní soubory jednotek. Pokud tento soubor patří do balíčku, zkontrolujte příslušné volby překladače balíčku. Pokud tento soubor patří do Lazarusu, ujistěte se čistým přeložením. Pokud soubor patří do FPC, zkontrolujte fpc.cfg. Pokud si nejste jistí, použijte Projekt -> Volby překladače -> Test"
|
||||
|
||||
|
||||
17
lcl/languages/customdrawncontrols.cs.po
Normal file
17
lcl/languages/customdrawncontrols.cs.po
Normal file
@ -0,0 +1,17 @@
|
||||
msgid ""
|
||||
msgstr ""
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Project-Id-Version: Lazarus CustomDrawControls\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: \n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: customdrawncontrols.stabsheet_default_name
|
||||
msgid "CTabSheet"
|
||||
msgstr "CTabSheet"
|
||||
@ -1,15 +1,17 @@
|
||||
msgid ""
|
||||
msgstr ""
|
||||
"Project-Id-Version: \n"
|
||||
"Project-Id-Version: Lazarus LCL\n"
|
||||
"POT-Creation-Date: \n"
|
||||
"PO-Revision-Date: 2013-01-09 20:28+0100\n"
|
||||
"Last-Translator: Václav Valíček <Valicek1994@gmail.com>\n"
|
||||
"Language-Team: \n"
|
||||
"PO-Revision-Date: 2014-05-13 10:04+0100\n"
|
||||
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
|
||||
"Language-Team: Czech <vaclav@valicek.name>\n"
|
||||
"MIME-Version: 1.0\n"
|
||||
"Content-Type: text/plain; charset=UTF-8\n"
|
||||
"Content-Transfer-Encoding: 8bit\n"
|
||||
"Language: cs\n"
|
||||
"X-Generator: Poedit 1.5.4\n"
|
||||
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
||||
"X-Poedit-SourceCharset: UTF-8\n"
|
||||
|
||||
#: lclstrconsts.hhshelpbrowsernotexecutable
|
||||
msgid "Browser %s%s%s not executable."
|
||||
@ -531,16 +533,14 @@ msgid "First"
|
||||
msgstr "První"
|
||||
|
||||
#: lclstrconsts.rsfixedcolstoobig
|
||||
#, fuzzy
|
||||
#| msgid "FixedCols can't be >= ColCount"
|
||||
msgid "FixedCols can't be > ColCount"
|
||||
msgstr "FixedCols nemůže být >= ColCount"
|
||||
msgstr "FixedCols nemůže být > ColCount"
|
||||
|
||||
#: lclstrconsts.rsfixedrowstoobig
|
||||
#, fuzzy
|
||||
#| msgid "FixedRows can't be >= RowCount"
|
||||
msgid "FixedRows can't be > RowCount"
|
||||
msgstr "FixedRows nemůže být >= RowCount"
|
||||
msgstr "FixedRows nemůže být > RowCount"
|
||||
|
||||
#: lclstrconsts.rsformcolorcaption
|
||||
msgid "Form"
|
||||
@ -564,11 +564,11 @@ msgstr "Fuksiová"
|
||||
|
||||
#: lclstrconsts.rsgdkoptiondebug
|
||||
msgid "--gdk-debug flags Turn on specific GDK trace/debug messages."
|
||||
msgstr ""
|
||||
msgstr "--gdk-debug flags Zapnout specifické ladící/sledovací zprávy GDK."
|
||||
|
||||
#: lclstrconsts.rsgdkoptionnodebug
|
||||
msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages."
|
||||
msgstr ""
|
||||
msgstr "--gdk-no-debug flags Vypnout specifické ladící/sledovací zprávy GDK."
|
||||
|
||||
#: lclstrconsts.rsgif
|
||||
msgid "Graphics Interchange Format"
|
||||
@ -576,7 +576,7 @@ msgstr "Graphics Interchange Format"
|
||||
|
||||
#: lclstrconsts.rsgoptionfatalwarnings
|
||||
msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application."
|
||||
msgstr ""
|
||||
msgstr "--g-fatal-warnings Varování a chyby generované Gtk+/GDK ukončí alplikaci."
|
||||
|
||||
#: lclstrconsts.rsgradientactivecaptioncolorcaption
|
||||
msgid "Gradient Active Caption"
|
||||
@ -624,39 +624,39 @@ msgstr "Historie:"
|
||||
|
||||
#: lclstrconsts.rsgtkoptionclass
|
||||
msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"."
|
||||
msgstr ""
|
||||
msgstr "--class classname Následujíce Xt konvence, třída programu je název programu s prvním písmenkem velkým. Například, \"classname\" pro gimp je \"Gimp\". Pokud specifikujeme parametr --class, třída programu bude \"classname\""
|
||||
|
||||
#: lclstrconsts.rsgtkoptiondebug
|
||||
msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages."
|
||||
msgstr ""
|
||||
msgstr "--gtk-debug flags Zapnout specifické ladící/sledovací zprávy Gtk+"
|
||||
|
||||
#: lclstrconsts.rsgtkoptiondisplay
|
||||
msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used."
|
||||
msgstr ""
|
||||
msgstr "--display h:s:d Připojit k zadanému X serveru, kde \"h\" je jméno hosta, \"s\" je číslo serveru (většinou 0), a \"d\" je číslo displeje (většinou se nezadává). Pokud nezadáme --display, použije se obsah proměnné DISPLAY z prostředí."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionmodule
|
||||
msgid "--gtk-module module Load the specified module at startup."
|
||||
msgstr ""
|
||||
msgstr "--gtk-module module Načíst zadaný modul při startu."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionname
|
||||
msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStrUTF8(0)."
|
||||
msgstr ""
|
||||
msgstr "--name programe Nastaví jméno programu na \"programe\". Pokud se nezadá, použije se ParamStrUTF8(0)."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionnodebug
|
||||
msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages."
|
||||
msgstr ""
|
||||
msgstr "--gtk-no-debug flags Vypnout zadané ladící/sledovací zrávy Gtk+."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionnotransient
|
||||
msgid "--lcl-no-transient Do not set transient order for modal forms"
|
||||
msgstr ""
|
||||
msgstr "--lcl-no-transient Nenastavovat přechodné pořadí pro modální formuláře."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionnoxshm
|
||||
msgid "--no-xshm Disable use of the X Shared Memory Extension."
|
||||
msgstr ""
|
||||
msgstr "--no-xshm Vypnout použití rozšíření X Shared Memory."
|
||||
|
||||
#: lclstrconsts.rsgtkoptionsync
|
||||
msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediately after the protocol request that generated the error has been processed by the X server."
|
||||
msgstr ""
|
||||
msgstr "--sync Volat XSynchronize (displej, True) po stabilizaci připojení k X Serveru. Toto dělá ladění chyb X protokolu jednodušší, protože cacheování X žádostí bude vypnuto a chyby X budou doručeny okamžitě po žádosti, která vyvolala chybu."
|
||||
|
||||
#: lclstrconsts.rshelpalreadyregistered
|
||||
msgid "%s: Already registered"
|
||||
@ -1066,83 +1066,83 @@ msgstr "Fialová"
|
||||
|
||||
#: lclstrconsts.rsqtoptiondograb
|
||||
msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG."
|
||||
msgstr ""
|
||||
msgstr "-dograb (pouze pod X11), běh v debuggeru může vyústit v implicitní --nograb, použijte -dograb k přepisu. Potřebujete QT_DEBUG."
|
||||
|
||||
#: lclstrconsts.rsqtoptiongraphicsstyle
|
||||
msgid "-graphicssystem param, sets the backend to be used for on-screen widgets and QPixmaps. Available options are native, raster and opengl. OpenGL is still unstable."
|
||||
msgstr ""
|
||||
msgstr "-graphicssystem param, nastaví backend k použití pro widgety a QPixmaps na obrazovce. Dostupné volby jsou native, raster a opengl. OpenGL je stále nestabilní."
|
||||
|
||||
#: lclstrconsts.rsqtoptionnograb
|
||||
msgid "-nograb, tells Qt that it must never grab the mouse or the keyboard. Need QT_DEBUG."
|
||||
msgstr ""
|
||||
msgstr "-nograb říká Qt že nemá nikdy zabírat klávesnici a myš. Potřebujete QT_DEBUG."
|
||||
|
||||
#: lclstrconsts.rsqtoptionreverse
|
||||
msgid "-reverse, sets the application's layout direction to Qt::RightToLeft."
|
||||
msgstr ""
|
||||
msgstr "-reverse, nastavuje směr rozložení aplikace na Qt::RightToLeft."
|
||||
|
||||
#: lclstrconsts.rsqtoptionsession
|
||||
msgid "-session session, restores the application from an earlier session."
|
||||
msgstr ""
|
||||
msgstr "-session session - obnovuje aplikaci z dřívějšího sezení"
|
||||
|
||||
#: lclstrconsts.rsqtoptionstyle
|
||||
msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)."
|
||||
msgstr ""
|
||||
msgstr "-style style nebo -style=style - nastavuje GUI styl aplikace. Možné hodnoty jsou motif, windows a platinum. Pokud jste kompiloval Qt s přidanými styly nebo máte přidané styly jako pluginy, potom budou též dostupné jako volba pro tento parametr. POZOR: Ne všechny styly jsou dostupné na všech platformách - pokud styl neexistuje, Qt spustí aplikaci s vlastním výchozím stylem (windows)."
|
||||
|
||||
#: lclstrconsts.rsqtoptionstylesheet
|
||||
msgid "-stylesheet stylesheet or -stylesheet=stylesheet, sets the application Style Sheet. The value must be a path to a file that contains the Style Sheet. Note: Relative URLs in the Style Sheet file are relative to the Style Sheet file's path."
|
||||
msgstr ""
|
||||
msgstr "-stylesheet stylesheet nebo -stylesheet=stylesheet - nastavuje styl aplikace. Hodnota musí být cesta k souboru obsahujícímu Style Sheet. POZOR: Relativní cesty v URL v souboru jsou relativní vůči cestě k souboru."
|
||||
|
||||
#: lclstrconsts.rsqtoptionsync
|
||||
msgid "-sync (only under X11), switches to synchronous mode for debugging."
|
||||
msgstr ""
|
||||
msgstr "-sync (pouze pod X11) - přepíná do synchronního režimu pro ladění."
|
||||
|
||||
#: lclstrconsts.rsqtoptionwidgetcount
|
||||
msgid "-widgetcount, prints debug message at the end about number of widgets left undestroyed and maximum number of widgets existed at the same time."
|
||||
msgstr ""
|
||||
msgstr "-widgetcount - vypíše na konci ladící zprávu o počtu nezrušených widgetů a o maximálním počtu widgetů existujícím současně."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11bgcolor
|
||||
msgid "-bg or -background color, sets the default background color and an application palette (light and dark shades are calculated)."
|
||||
msgstr ""
|
||||
msgstr "-bg nebo -background color - nastavuje výchozí barvu pozadí a paletu aplikace (světlé a tmavé stíny jsou dopočítány)"
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11btncolor
|
||||
msgid "-btn or -button color, sets the default button color."
|
||||
msgstr ""
|
||||
msgstr "-btn nebo -button color - nastavuje výchozí barvu tlačítek."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11cmap
|
||||
msgid "-cmap, causes the application to install a private color map on an 8-bit display."
|
||||
msgstr ""
|
||||
msgstr "-cmap - způsobuje, že si aplikace nainstaluje soukromou causemapu barev na 8-mi bitovém displeji."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11display
|
||||
msgid "-display display, sets the X display (default is $DISPLAY)."
|
||||
msgstr ""
|
||||
msgstr "-display display - nastavuje X display (výchozí je $DISPLAY)."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11fgcolor
|
||||
msgid "-fg or -foreground color, sets the default foreground color."
|
||||
msgstr ""
|
||||
msgstr "-fg nebo -foreground color - nastavuje výchozí barvu popředí."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11font
|
||||
msgid "-fn or -font font, defines the application font. The font should be specified using an X logical font description."
|
||||
msgstr ""
|
||||
msgstr "-fn nebo -font font - definuje font aplikace. Font by měl být specifikován X logickým popisem fontu."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11geometry
|
||||
msgid "-geometry geometry, sets the client geometry of the first window that is shown."
|
||||
msgstr ""
|
||||
msgstr "-geometry geometry - nastavuje klientskou geometrii prvního zobrazeného okna."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11im
|
||||
msgid "-im, sets the input method server (equivalent to setting the XMODIFIERS environment variable)."
|
||||
msgstr ""
|
||||
msgstr "-im - nastavuje server metody vstupu (ekvivalent nastavení proměnné prostředí XMODIFIERS)."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11inputstyle
|
||||
msgid "-inputstyle, defines how the input is inserted into the given widget, e.g. onTheSpot makes the input appear directly in the widget, while overTheSpot makes the input appear in a box floating over the widget and is not inserted until the editing is done."
|
||||
msgstr ""
|
||||
msgstr "-inputstyle - definuje jakten NVIDIA Shield zamlouvat. Brzo o něm \"uslyšíte\" i v našem pořadu. Nedávno tam vyšel Portal, teď legenda je vstup vkládán do daného widgetu, například onTheSpot způsobuje, že se vstup objebuje přímo ve widgetu, zatímco overTheSpot způsobuje, že se vstup objeví v rámu plovoucím nad widgetem a je vložen až po dokončení editace."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11name
|
||||
msgid "-name name, sets the application name."
|
||||
msgstr ""
|
||||
msgstr "-name name - nastavuje jméno aplikace"
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11ncols
|
||||
msgid "-ncols count, limits the number of colors allocated in the color cube on an 8-bit display, if the application is using the QApplication::ManyColor color specification. If count is 216 then a 6x6x6 color cube is used (i.e. 6 levels of red, 6 of green, and 6 of blue); for other values, a cube approximately proportional to a 2x3x1 cube is used."
|
||||
msgstr ""
|
||||
msgstr "-ncols count - omezuje počet barev alokovaných v barevné krychli na 8-mi bitovém displeji pokud aplikace využívá specifikaci QApplication::ManyColor . Pokud je počet barev 216, pak je použita krychle 6x6x6 barev (6 stupňů červené, 6 zelené a 6 modré); pro ostatní případy je použita krychle zhruba v poměru 2x3x1."
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11title
|
||||
msgid "-title title, sets the application title."
|
||||
@ -1150,7 +1150,7 @@ msgstr "-title titulek, nastavuje titulek aplikace"
|
||||
|
||||
#: lclstrconsts.rsqtoptionx11visual
|
||||
msgid "-visual TrueColor, forces the application to use a TrueColor visual on an 8-bit display."
|
||||
msgstr ""
|
||||
msgstr "-visual TrueColor - donutí použít vzhled TrueColor na 8-mi bitovém displeji."
|
||||
|
||||
#: lclstrconsts.rsrasterimageendupdate
|
||||
msgid "Endupdate while no update in progress"
|
||||
|
||||
Loading…
Reference in New Issue
Block a user