diff --git a/languages/lazaruside.sk.po b/languages/lazaruside.sk.po
index f2d99995cd..00a8906895 100644
--- a/languages/lazaruside.sk.po
+++ b/languages/lazaruside.sk.po
@@ -3,13 +3,13 @@ msgstr ""
 "Project-Id-Version: lazaruside\n"
 "Report-Msgid-Bugs-To: \n"
 "POT-Creation-Date: 2007-12-26 15:21+0100\n"
-"PO-Revision-Date: 2020-08-10 10:46+0200\n"
+"PO-Revision-Date: 2022-01-07 17:50+0100\n"
 "Last-Translator: Slavko <slavino@slavino.sk>\n"
 "Language-Team: Slovenský <sk@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Generator: Poedit 2.2.3\n"
+"X-Generator: Poedit 3.0\n"
 "Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
 "Language: sk\n"
 
@@ -59,7 +59,7 @@ msgstr ""
 #: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
 #, object-pascal-format
 msgid "Unknown Breakpoint %s"
-msgstr ""
+msgstr "Neznámy bod prerušenia %s"
 
 #: lazarusidestrconsts.dbgeventbreakwatchpoint
 #, object-pascal-format
@@ -342,7 +342,7 @@ msgstr ""
 #: lazarusidestrconsts.dlfmousesimpletextsectpageright
 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
 msgid "Right"
-msgstr "šípka vpravo"
+msgstr "Vpravo"
 
 #: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
@@ -787,7 +787,7 @@ msgstr "Automaticky na malé písmená"
 
 #: lazarusidestrconsts.dlgautosaveactivedesktop
 msgid "Auto save active desktop"
-msgstr ""
+msgstr "Automatické uloženie aktívnej pracovnej plochy"
 
 #: lazarusidestrconsts.dlgautosaveactivedesktophint
 msgid ""
@@ -829,14 +829,12 @@ msgid "Selection"
 msgstr "Výber"
 
 #: lazarusidestrconsts.dlgblockindent
-#, fuzzy
-#| msgid "Block indent"
 msgid "Block indent (spaces)"
-msgstr "Odsadenie bloku"
+msgstr "Odsadenie bloku (medzery)"
 
 #: lazarusidestrconsts.dlgblockindentkeys
 msgid "Block indent"
-msgstr ""
+msgstr "Odsadenie bloku"
 
 #: lazarusidestrconsts.dlgblockindentlink
 msgid "(edit keys)"
@@ -944,7 +942,7 @@ msgstr ""
 
 #: lazarusidestrconsts.dlgccotestsrcinppupaths
 msgid "Test: Checking sources in fpc ppu search paths ..."
-msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu"
+msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu ..."
 
 #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
 msgid "Test: Compiling an empty file"
@@ -1678,7 +1676,7 @@ msgstr "On"
 
 #: lazarusidestrconsts.dlgedtabindent
 msgid "Tab and Indent"
-msgstr ""
+msgstr "Tab a odsadenie"
 
 #: lazarusidestrconsts.dlgedunder
 msgid "Underline"
@@ -1790,7 +1788,6 @@ msgid "%s files"
 msgstr ""
 
 #: lazarusidestrconsts.dlgfilterall
-#, fuzzy
 msgctxt "lazarusidestrconsts.dlgfilterall"
 msgid "All files"
 msgstr "Všetky súbory"
@@ -1806,23 +1803,22 @@ msgstr ""
 
 #: lazarusidestrconsts.dlgfilterdelphiform
 msgid "Delphi form"
-msgstr ""
+msgstr "Delphi formulár"
 
 #: lazarusidestrconsts.dlgfilterdelphipackage
 msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
 msgid "Delphi package"
-msgstr ""
+msgstr "Delphi balíček"
 
 #: lazarusidestrconsts.dlgfilterdelphiproject
-#, fuzzy
 msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
 msgid "Delphi project"
-msgstr "Projekt Delphi"
+msgstr "Delphi projekt"
 
 #: lazarusidestrconsts.dlgfilterdelphiunit
 msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
 msgid "Delphi unit"
-msgstr ""
+msgstr "Delphi jednotka"
 
 #: lazarusidestrconsts.dlgfilterexecutable
 msgctxt "lazarusidestrconsts.dlgfilterexecutable"
@@ -2819,7 +2815,7 @@ msgstr ""
 #: lazarusidestrconsts.dlgmouseoptbtnleft
 msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
 msgid "Left"
-msgstr "šípka vľavo"
+msgstr "Vľavo"
 
 #: lazarusidestrconsts.dlgmouseoptbtnmiddle
 msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
@@ -2833,7 +2829,7 @@ msgstr ""
 #: lazarusidestrconsts.dlgmouseoptbtnright
 msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
 msgid "Right"
-msgstr "šípka vpravo"
+msgstr "Vpravo"
 
 #: lazarusidestrconsts.dlgmouseoptbtnwheeldown
 msgid "Wheel down"
@@ -3196,7 +3192,7 @@ msgstr "Pomenovanie"
 
 #: lazarusidestrconsts.dlgnewdesktop
 msgid "New desktop ..."
-msgstr ""
+msgstr "Nová pracovná plocha ..."
 
 #: lazarusidestrconsts.dlgnewprojecttype
 msgid "New Project Type"
@@ -3580,7 +3576,7 @@ msgstr "Prichytiť k mriežke"
 #: lazarusidestrconsts.dlgreallydeletedesktop
 #, object-pascal-format
 msgid "Really delete desktop \"%s\"?"
-msgstr ""
+msgstr "Naozaj zmazať pracovnú plochu \"%s\"?"
 
 #: lazarusidestrconsts.dlgreferencecolor
 msgid "Reference"
@@ -3592,7 +3588,7 @@ msgstr "&Regulárne výrazy"
 
 #: lazarusidestrconsts.dlgrenamedesktop
 msgid "Rename desktop"
-msgstr ""
+msgstr "Premenovať pracovnú plochu"
 
 #: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
 msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
@@ -3601,7 +3597,7 @@ msgstr "Premenovať"
 
 #: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
 msgid "Rename selected desktop"
-msgstr ""
+msgstr "Premenovať vybratú pracovnú plochu"
 
 #: lazarusidestrconsts.dlgreplaceall
 msgid "Replace &All"
@@ -4212,7 +4208,7 @@ msgstr ""
 
 #: lazarusidestrconsts.dlguseunitcaption
 msgid "Add unit to Uses section"
-msgstr ""
+msgstr "Pridať jednotku do sekcie Uses"
 
 #: lazarusidestrconsts.dlgvaluecolor
 msgctxt "lazarusidestrconsts.dlgvaluecolor"
@@ -4221,7 +4217,7 @@ msgstr "Hodnota"
 
 #: lazarusidestrconsts.dlgverbosity
 msgid "Verbosity during compilation:"
-msgstr "Výrečnosť počas prekladu"
+msgstr "Výrečnosť počas prekladu:"
 
 #: lazarusidestrconsts.dlgvisiblegutter
 msgid "Visible gutter"
@@ -5660,7 +5656,7 @@ msgstr ""
 
 #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
 msgid "Can only change the class of TComponents."
-msgstr "Zmeniť možno len triedu TComponents"
+msgstr "Zmeniť možno len triedu TComponents."
 
 #: lazarusidestrconsts.liscantfindavalidppu
 #, object-pascal-format
@@ -5730,7 +5726,7 @@ msgstr "CHYBA: "
 
 #: lazarusidestrconsts.lisccofpcunitpathhassource
 msgid "FPC unit path contains a source: "
-msgstr "Cesta k jednotkám FPC so zdrojovým kódom"
+msgstr "Cesta k jednotkám FPC obsahuje zdrojový kód: "
 
 #: lazarusidestrconsts.lisccohasnewline
 msgid "new line symbols"
@@ -5763,7 +5759,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisccomultiplecfgfound
 msgid "multiple compiler configs found: "
-msgstr "nájdené viaceré konfigurácie prekladača:"
+msgstr "nájdené viaceré konfigurácie prekladača: "
 
 #: lazarusidestrconsts.liscconocfgfound
 msgid "no fpc.cfg found"
@@ -5807,7 +5803,7 @@ msgstr "Všetky testy úspešné."
 
 #: lazarusidestrconsts.lisccounabletocreatetestfile
 msgid "Unable to create Test File"
-msgstr "textového vytvoriť testovací súbor"
+msgstr "Nie je možné vytvoriť testovací súbor"
 
 #: lazarusidestrconsts.lisccounabletocreatetestpascalfile
 #, object-pascal-format, fuzzy
@@ -6324,15 +6320,15 @@ msgstr ""
 
 #: lazarusidestrconsts.lischoosedelphipackage
 msgid "Choose Delphi package (*.dpk)"
-msgstr ""
+msgstr "Vyberte Delphi balíček (*.dpk)"
 
 #: lazarusidestrconsts.lischoosedelphiproject
 msgid "Choose Delphi project (*.dpr)"
-msgstr ""
+msgstr "Vyberte Delphi projekt (*.dpr)"
 
 #: lazarusidestrconsts.lischoosedelphiunit
 msgid "Choose Delphi unit (*.pas)"
-msgstr "Zvoliť jednotku Delphi (*.pas)"
+msgstr "Zvoliť Delphi jednotku (*.pas)"
 
 #: lazarusidestrconsts.lischoosedirectory
 msgid "Choose directory"
@@ -6474,11 +6470,11 @@ msgstr ""
 #: lazarusidestrconsts.liscleanupandbuild
 msgctxt "lazarusidestrconsts.liscleanupandbuild"
 msgid "Clean up and build"
-msgstr ""
+msgstr "Vyčistiť a vybudovať"
 
 #: lazarusidestrconsts.liscleanupandbuildproject
 msgid "Clean up and build project"
-msgstr ""
+msgstr "Vyčistiť a vybudovať projekt"
 
 #: lazarusidestrconsts.liscleanuppackage
 #, object-pascal-format
@@ -7637,15 +7633,15 @@ msgstr ""
 
 #: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
 msgid "Convert Delphi package"
-msgstr ""
+msgstr "Konvertovať Delphi balíček"
 
 #: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
 msgid "Convert Delphi project"
-msgstr ""
+msgstr "Konvertovať Delphi projekt"
 
 #: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
 msgid "Convert Delphi unit"
-msgstr ""
+msgstr "Konvertovať Delphi jednotku"
 
 #: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
 msgid "*** Converting unit files found during conversion ***"
@@ -7684,7 +7680,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisconvdelphifunc
 msgid "Delphi Function"
-msgstr ""
+msgstr "Delphi funkcia"
 
 #: lazarusidestrconsts.lisconvdelphimissingincludefile
 #, object-pascal-format
@@ -7693,7 +7689,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisconvdelphiname
 msgid "Delphi Name"
-msgstr ""
+msgstr "Delphi meno"
 
 #: lazarusidestrconsts.lisconvdelphipackagenameexists
 msgid "Package name exists"
@@ -8271,7 +8267,7 @@ msgstr ""
 
 #: lazarusidestrconsts.liscreateproject
 msgid "Create project"
-msgstr ""
+msgstr "Vytvoriť projekt"
 
 #: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
 msgid "Create/update .po file when saving a lfm file"
@@ -8465,7 +8461,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisdbgemnewvalue
 msgid "&New value:"
-msgstr ""
+msgstr "&Nová hodnota:"
 
 #: lazarusidestrconsts.lisdbgemresult
 msgid "&Result:"
@@ -8965,7 +8961,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisdesktops
 msgid "Desktops ..."
-msgstr ""
+msgstr "Pracovné plochy ..."
 
 #: lazarusidestrconsts.lisdestinationdirectory
 msgid "Destination directory"
@@ -9937,7 +9933,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lisevaluatemodify
 msgid "&Evaluate/Modify"
-msgstr ""
+msgstr "Vyhodnotiť/Upraviť"
 
 #: lazarusidestrconsts.liseventlogclear
 msgid "Clear Events"
@@ -11825,7 +11821,7 @@ msgstr "Pridať pozorovanie"
 
 #: lazarusidestrconsts.liskmbuildmanymodes
 msgid "Build many modes"
-msgstr ""
+msgstr "Vybudovať viacej režimov"
 
 #: lazarusidestrconsts.liskmbuildprojectprogram
 msgid "Build project/program"
@@ -11842,7 +11838,7 @@ msgstr "Klasický"
 #: lazarusidestrconsts.liskmcleanupandbuild
 msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
 msgid "Clean up and build"
-msgstr ""
+msgstr "Vyčistiť a vybudovať"
 
 #: lazarusidestrconsts.liskmcloseproject
 msgid "Close project"
@@ -11874,23 +11870,17 @@ msgstr "Kontextovo závislá pomoc"
 
 #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
 msgid "Convert Delphi package to Lazarus package"
-msgstr "Konvertovať balíček Delhi na Lazarus"
+msgstr "Konvertovať Delphi balíček na Lazarus balíček"
 
 #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
-#, fuzzy
-#| msgid "Convert Delphi project to Lazarus project"
 msgid "Convert Delphi Project to Lazarus Project"
-msgstr "Konvertovať projekt Delphi na Lazarus"
+msgstr "Konvertovať Delphi projekt na Lazarus projekt"
 
 #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
-#, fuzzy
-#| msgid "Convert Delphi unit to Lazarus unit"
 msgid "Convert Delphi Unit to Lazarus Unit"
-msgstr "Konvertovať jednotku Delphi na Lazarus"
+msgstr "Konvertovať Delphi jednotku na Lazarus jednotku"
 
 #: lazarusidestrconsts.liskmconvertdfmfiletolfm
-#, fuzzy
-#| msgid "Convert DFM file to LFM"
 msgid "Convert DFM File to LFM"
 msgstr "Konvertovať súbor DFM na LFM"
 
@@ -11934,11 +11924,11 @@ msgstr "Uzavrieť výber"
 
 #: lazarusidestrconsts.liskmevaluatemodify
 msgid "Evaluate/Modify"
-msgstr "Vyskúšať/Upraviť"
+msgstr "Vyhodnotiť/Upraviť"
 
 #: lazarusidestrconsts.liskmexampleprojects
 msgid "Example Projects"
-msgstr ""
+msgstr "Vzorové projekty"
 
 #: lazarusidestrconsts.liskmexternaltoolssettings
 msgid "External Tools settings"
@@ -12462,7 +12452,7 @@ msgstr "Akcia"
 
 #: lazarusidestrconsts.lislazbuildabochooseoutputdir
 msgid "Choose output directory of the IDE executable "
-msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE"
+msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE "
 
 #: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
 msgid "Are you sure you want to delete this build profile?"
@@ -12659,7 +12649,7 @@ msgstr "Jednotku %s nevlastní žiadny balíček alebo projekt.%sProsím pridajt
 #: lazarusidestrconsts.lisleft
 msgctxt "lazarusidestrconsts.lisleft"
 msgid "Left"
-msgstr "šípka vľavo"
+msgstr "Vľavo"
 
 #: lazarusidestrconsts.lisleftborderspacespinedithint
 msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
@@ -13032,19 +13022,15 @@ msgstr "Pridať &bod prerušenia"
 
 #: lazarusidestrconsts.lismenuaddcurfiletopkg
 msgid "Add Active File to Package ..."
-msgstr ""
+msgstr "Pridať aktívny súbor do balíčka ..."
 
 #: lazarusidestrconsts.lismenuaddjumppointtohistory
-#, fuzzy
-#| msgid "Add jump point to history"
 msgid "Add Jump Point to History"
 msgstr "Pridať bod skoku do histórie"
 
 #: lazarusidestrconsts.lismenuaddtoproject
-#, fuzzy
-#| msgid "Add editor file to Project"
 msgid "Add Editor File to Project"
-msgstr "Pridať z editora do projektu"
+msgstr "Pridať editovaný súbor do projektu"
 
 #: lazarusidestrconsts.lismenuaddwatch
 msgid "Add &Watch ..."
@@ -13106,8 +13092,6 @@ msgid "CodeTools Defines Editor ..."
 msgstr "Editor definícií CodeTools ..."
 
 #: lazarusidestrconsts.lismenucommentselection
-#, fuzzy
-#| msgid "Comment selection"
 msgid "Comment Selection"
 msgstr "Zakomentovať výber"
 
@@ -13156,15 +13140,15 @@ msgstr "Pokračovať"
 
 #: lazarusidestrconsts.lismenuconvertdelphipackage
 msgid "Convert Delphi Package to Lazarus Package ..."
-msgstr "Konvertovať balíček Delphi na Lazarus ..."
+msgstr "Konvertovať Delphi balíček na Lazarus balíček ..."
 
 #: lazarusidestrconsts.lismenuconvertdelphiproject
 msgid "Convert Delphi Project to Lazarus Project ..."
-msgstr "Konvertovať projekt Delphi na Lazarus ..."
+msgstr "Konvertovať Delphi projekt na Lazarus projekt ..."
 
 #: lazarusidestrconsts.lismenuconvertdelphiunit
 msgid "Convert Delphi Unit to Lazarus Unit ..."
-msgstr "Konvertovať jednotku Deplhi na Lazarus ..."
+msgstr "Konvertovať Delphi jednotku na Lazarus jednotku ..."
 
 #: lazarusidestrconsts.lismenuconvertdfmtolfm
 #, fuzzy
@@ -13182,7 +13166,7 @@ msgstr "Okná ladenia"
 
 #: lazarusidestrconsts.lismenudelphiconversion
 msgid "Delphi Conversion"
-msgstr ""
+msgstr "Delphi konverzia"
 
 #: lazarusidestrconsts.lismenuedit
 msgid "&Edit"
@@ -13785,14 +13769,12 @@ msgid "Enclose Selection ..."
 msgstr "Uzavrieť výber ..."
 
 #: lazarusidestrconsts.lismenuevaluate
-#, fuzzy
-#| msgid "Evaluate/Modify ..."
 msgid "E&valuate/Modify ..."
-msgstr "Vyskúšať/Upraviť ..."
+msgstr "Vyhodnotiť/Upraviť ..."
 
 #: lazarusidestrconsts.lismenuexampleprojects
 msgid "Example Projects ..."
-msgstr ""
+msgstr "Vzorové projekty ..."
 
 #: lazarusidestrconsts.lismenuextractproc
 #, fuzzy
@@ -13814,14 +13796,10 @@ msgid "&Find ..."
 msgstr "&Nájsť ..."
 
 #: lazarusidestrconsts.lismenufindblockotherendofcodeblock
-#, fuzzy
-#| msgid "Find other end of code block"
 msgid "Find Other End of Code Block"
-msgstr "Nájsť druhý koniec bloku kódu"
+msgstr "Nájsť zodpovedajúci koniec bloku kódu"
 
 #: lazarusidestrconsts.lismenufindcodeblockstart
-#, fuzzy
-#| msgid "Find code block start"
 msgid "Find Start of Code Block"
 msgstr "Nájsť začiatok bloku kódu"
 
@@ -13872,10 +13850,8 @@ msgid "Guess Misplaced IFDEF/ENDIF"
 msgstr "Odhadni zle umiestnený IFDEF/ENDIF"
 
 #: lazarusidestrconsts.lismenuguessunclosedblock
-#, fuzzy
-#| msgid "Guess unclosed block"
 msgid "Guess Unclosed Block"
-msgstr "Odhadni neuzavretý blok"
+msgstr "Odhadnúť neuzavretý blok"
 
 #: lazarusidestrconsts.lismenuhelp
 msgid "&Help"
@@ -14107,14 +14083,10 @@ msgid "Open Loaded Package ..."
 msgstr "Otvoriť načítaný balíček ..."
 
 #: lazarusidestrconsts.lismenuopenpackagefile
-#, fuzzy
-#| msgid "Open package file (.lpk) ..."
 msgid "Open Package File (.lpk) ..."
 msgstr "Otvoriť súbor balíčka (.lpk) ..."
 
 #: lazarusidestrconsts.lismenuopenpackageofcurunit
-#, fuzzy
-#| msgid "Open package of current unit"
 msgid "Open Package of Current Unit"
 msgstr "Otvoriť balíček aktuálnej jednotky"
 
@@ -14148,10 +14120,8 @@ msgid "Package Graph"
 msgstr "Graf balíčkov"
 
 #: lazarusidestrconsts.lismenupackagelinks
-#, fuzzy
-#| msgid "Package links ..."
 msgid "Package Links ..."
-msgstr "Odkazy balíčkov ..."
+msgstr "Odkazy balíčka ..."
 
 #: lazarusidestrconsts.lismenupastefromclipboard
 msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
@@ -14215,7 +14185,7 @@ msgstr "Hlásenie chyby"
 
 #: lazarusidestrconsts.lismenuresaveformswithi18n
 msgid "Resave forms with enabled i18n"
-msgstr ""
+msgstr "Znovu uložiť formuláre s povoleným i18n"
 
 #: lazarusidestrconsts.lismenurescanfpcsourcedirectory
 msgid "Rescan FPC Source Directory"
@@ -14243,8 +14213,6 @@ msgid "Run &Parameters ..."
 msgstr "&Parametre spustenia ..."
 
 #: lazarusidestrconsts.lismenuruntocursor
-#, fuzzy
-#| msgid "Run to &Cursor"
 msgctxt "lazarusidestrconsts.lismenuruntocursor"
 msgid "Run to Cursor"
 msgstr "Spustiť po kurzor"
@@ -14405,17 +14373,15 @@ msgstr "Výber na veľké písmená"
 #: lazarusidestrconsts.lismenuuseunit
 msgctxt "lazarusidestrconsts.lismenuuseunit"
 msgid "Add Unit to Uses Section ..."
-msgstr ""
+msgstr "Pridať jednotku do sekcie Uses ..."
 
 #: lazarusidestrconsts.lismenuview
 msgid "&View"
 msgstr "&Zobraziť"
 
 #: lazarusidestrconsts.lismenuviewanchoreditor
-#, fuzzy
-#| msgid "View Anchor Editor"
 msgid "Anchor Editor"
-msgstr "Zobraziť Editor ukotvenia"
+msgstr "Editor ukotvenia"
 
 #: lazarusidestrconsts.lismenuviewassembler
 msgctxt "lazarusidestrconsts.lismenuviewassembler"
@@ -14431,7 +14397,6 @@ msgid "Call Stack"
 msgstr "Zásobník volaní"
 
 #: lazarusidestrconsts.lismenuviewcodebrowser
-#, fuzzy
 msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
 msgid "Code Browser"
 msgstr "Prehliadač kódu"
@@ -14442,10 +14407,8 @@ msgid "Code Explorer"
 msgstr "Prieskumník kódu"
 
 #: lazarusidestrconsts.lismenuviewcomponentpalette
-#, fuzzy
-#| msgid "View Component Palette"
 msgid "Component Palette"
-msgstr "Zobraziť Paletu komponentov"
+msgstr "Paleta komponentov"
 
 #: lazarusidestrconsts.lismenuviewcomponents
 msgid "&Components"
@@ -14530,11 +14493,9 @@ msgid "Toggle Form/Unit View"
 msgstr "Prepnúť formulár/jednotka"
 
 #: lazarusidestrconsts.lismenuviewunitdependencies
-#, fuzzy
-#| msgid "Unit Dependencies ..."
 msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
 msgid "Unit Dependencies"
-msgstr "Zobraziť závislosti jednotky"
+msgstr "Závislosti jednotky"
 
 #: lazarusidestrconsts.lismenuviewunitinfo
 msgid "Unit Information ..."
@@ -14566,7 +14527,7 @@ msgstr "Ostatné"
 
 #: lazarusidestrconsts.lismeprojects
 msgid "Projects"
-msgstr ""
+msgstr "Projekty"
 
 #: lazarusidestrconsts.lismessageseditor
 msgid "Messages Editor"
@@ -14612,7 +14573,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lismissingunitsfordelphi
 msgid "For Delphi only"
-msgstr ""
+msgstr "Len pre Delphi"
 
 #: lazarusidestrconsts.lismissingunitsinfo1
 msgid "1) Comment out the selected units."
@@ -15234,12 +15195,12 @@ msgstr "Dole"
 #: lazarusidestrconsts.lisnotebooktabposleft
 msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
 msgid "Left"
-msgstr "šípka vľavo"
+msgstr "Vľavo"
 
 #: lazarusidestrconsts.lisnotebooktabposright
 msgctxt "lazarusidestrconsts.lisnotebooktabposright"
 msgid "Right"
-msgstr "šípka vpravo"
+msgstr "Vpravo"
 
 #: lazarusidestrconsts.lisnotebooktabpostop
 msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
@@ -15508,7 +15469,7 @@ msgstr "Otvoriť súbor"
 
 #: lazarusidestrconsts.lisopenfileatcursor
 msgid "Open file at cursor"
-msgstr ""
+msgstr "Otvoriť súbor na pozícii kurzora"
 
 #: lazarusidestrconsts.lisopeninfileman
 msgid "Open in file manager"
@@ -16067,10 +16028,9 @@ msgid "Remove Dependency?"
 msgstr "Odstrániť závislosť?"
 
 #: lazarusidestrconsts.lispckeditremovedependencyfrompackage
-#, object-pascal-format, fuzzy, badformat
-#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
+#, object-pascal-format
 msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
-msgstr "Odstrániť závislosť %s%s%s%sz balíčka %s%s%s?"
+msgstr "Odstrániť závislosť \"%s\"%sz balíčka \"%s\"?"
 
 #: lazarusidestrconsts.lispckeditremovedfiles
 msgid "Removed Files"
@@ -16527,16 +16487,14 @@ msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Nam
 msgstr ""
 
 #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
-#, object-pascal-format, fuzzy, badformat
-#| msgid "%sAdding new Dependency for package %s: package %s%s"
+#, object-pascal-format
 msgid "%sAdding new Dependency for package %s: package %s"
-msgstr "%sPridanie novej závislosti balíčka %s: balíček %s%s"
+msgstr "%sPridanie novej závislosti balíčka %s: balíček %s"
 
 #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
-#, object-pascal-format, fuzzy, badformat
-#| msgid "%sAdding new Dependency for project %s: package %s%s"
+#, object-pascal-format
 msgid "%sAdding new Dependency for project %s: package %s"
-msgstr "%sPridanie novej závislosti projektu %s: balíček %s%s"
+msgstr "%sPridanie novej závislosti projektu %s: balíček %s"
 
 #: lazarusidestrconsts.lispkgmangaddunittousesclause
 msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
@@ -17220,7 +17178,7 @@ msgstr ""
 
 #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
 msgid "Please select some code to extract a new procedure/method."
-msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy"
+msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy."
 
 #: lazarusidestrconsts.lisplistall
 msgctxt "lazarusidestrconsts.lisplistall"
@@ -17388,10 +17346,8 @@ msgid "Dependency already exists"
 msgstr "Závislosť už existuje"
 
 #: lazarusidestrconsts.lisprojaddeditorfile
-#, fuzzy
-#| msgid "Add editor files"
 msgid "Add Editor Files"
-msgstr "Pridať súbory editora"
+msgstr "Pridať editované súbory"
 
 #: lazarusidestrconsts.lisprojaddinvalidminmaxversion
 msgid "Invalid Min-Max version"
@@ -17440,10 +17396,9 @@ msgid "Package Type:"
 msgstr ""
 
 #: lazarusidestrconsts.lisprojaddthedependencywasnotfound
-#, object-pascal-format, fuzzy, badformat
-#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
+#, object-pascal-format
 msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
-msgstr "Závislosť %s%s%s nebola nájdená.%sProsím zvoľte existujúci balíček."
+msgstr "Závislosť \"%s\" nebola nájdená.%sProsím zvoľte existujúci balíček."
 
 #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
 #, object-pascal-format, fuzzy, badformat
@@ -17465,10 +17420,9 @@ msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor
 msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"
 
 #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
-#, object-pascal-format, fuzzy, badformat
-#| msgid "The project has already a dependency for the package %s%s%s."
+#, object-pascal-format
 msgid "The project has already a dependency for the package \"%s\"."
-msgstr "Projekt už má závislosť na balíčku %s%s%s."
+msgstr "Projekt už má závislosť pre balíček \"%s\"."
 
 #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
 #, object-pascal-format, fuzzy, badformat
@@ -17783,10 +17737,8 @@ msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
 msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"
 
 #: lazarusidestrconsts.lispwconvertproject
-#, fuzzy
-#| msgid "Convert Delphi Project"
 msgid "Convert &Delphi Project"
-msgstr "Konvertovať projekt Delphi"
+msgstr "Konvertovať &Delphi projekt"
 
 #: lazarusidestrconsts.lispwnewproject
 msgid "&New Project"
@@ -17803,7 +17755,7 @@ msgstr "Otvo&riť nedávny projekt"
 
 #: lazarusidestrconsts.lispwviewexampleprojects
 msgid "View &Example Projects"
-msgstr ""
+msgstr "Zobraziť vzorové projekty"
 
 #: lazarusidestrconsts.lisquickfixerror
 msgid "QuickFix error"
@@ -17848,7 +17800,6 @@ msgid "Recent tabs"
 msgstr ""
 
 #: lazarusidestrconsts.lisrecord
-#, fuzzy
 msgctxt "lazarusidestrconsts.lisrecord"
 msgid "Record"
 msgstr "Záznam"
@@ -18136,7 +18087,7 @@ msgstr ""
 #: lazarusidestrconsts.lisright
 msgctxt "lazarusidestrconsts.lisright"
 msgid "Right"
-msgstr "šípka vpravo"
+msgstr "Vpravo"
 
 #: lazarusidestrconsts.lisrightanchoring
 msgid "Right anchoring"
@@ -20928,7 +20879,7 @@ msgstr "Domovský adresár používateľa"
 #: lazarusidestrconsts.lisuseunit
 msgctxt "lazarusidestrconsts.lisuseunit"
 msgid "Add Unit to Uses Section"
-msgstr ""
+msgstr "Pridať jednotku do sekcie Uses"
 
 #: lazarusidestrconsts.lisuseunitinunit
 #, object-pascal-format
@@ -21245,8 +21196,6 @@ msgid "You can download FPC and the FPC sources from http://sourceforge.net/proj
 msgstr ""
 
 #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
-#, fuzzy
-#| msgid "You can not build lazarus while debugging or compiling."
 msgid "You cannot build Lazarus while debugging or compiling."
 msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."
 
@@ -21455,7 +21404,7 @@ msgstr ""
 
 #: lazarusidestrconsts.rsattachto
 msgid "Attach to"
-msgstr ""
+msgstr "Pripojiť k"
 
 #: lazarusidestrconsts.rsattributes
 msgid "Attributes"
@@ -21856,7 +21805,7 @@ msgstr "pridať pozorovanie"
 
 #: lazarusidestrconsts.srkmecattach
 msgid "Attach to program"
-msgstr ""
+msgstr "Pripojiť k programu"
 
 #: lazarusidestrconsts.srkmecautocompletion
 msgid "Code template completion"
@@ -21924,7 +21873,7 @@ msgstr "Vybudovať Lazarus"
 
 #: lazarusidestrconsts.srkmecbuildmanymodes
 msgid "build many modes"
-msgstr ""
+msgstr "vybudovať viacej režimov"
 
 #: lazarusidestrconsts.srkmecchar
 msgid "Char"
@@ -21932,7 +21881,7 @@ msgstr "Znak"
 
 #: lazarusidestrconsts.srkmeccleanupandbuild
 msgid "clean up and build"
-msgstr ""
+msgstr "vyčistiť a vybudovať"
 
 #: lazarusidestrconsts.srkmecclearall
 msgid "Delete whole text"
@@ -22098,7 +22047,7 @@ msgstr "Zmazať do konca slova"
 
 #: lazarusidestrconsts.srkmecdetach
 msgid "Detach from program"
-msgstr ""
+msgstr "Odpojiť od programu"
 
 #: lazarusidestrconsts.srkmecdiff
 msgctxt "lazarusidestrconsts.srkmecdiff"
@@ -22135,7 +22084,7 @@ msgstr ""
 
 #: lazarusidestrconsts.srkmecevaluate
 msgid "evaluate/modify"
-msgstr "vyskúšať/zmeniť"
+msgstr "vyhodnotiť/zmeniť"
 
 #: lazarusidestrconsts.srkmecextractproc
 #, fuzzy
@@ -22732,7 +22681,7 @@ msgstr "Vybrať stranu vľavo"
 
 #: lazarusidestrconsts.srkmecselpageright
 msgid "Select Page Right"
-msgstr "vybrať stranu vpravo"
+msgstr "Vybrať stranu vpravo"
 
 #: lazarusidestrconsts.srkmecselpagetop
 #, fuzzy
@@ -23214,11 +23163,11 @@ msgstr ""
 
 #: lazarusidestrconsts.synfhidecomments
 msgid "Hide comments"
-msgstr ""
+msgstr "Skryť komentáre"
 
 #: lazarusidestrconsts.synfhidecommentsinselection
 msgid "Hide comments in selection"
-msgstr ""
+msgstr "Skryť komentáre vo výbere"
 
 #: lazarusidestrconsts.synfmatchactionbuttonofmousedown
 msgid "Match action button of mouse down"
@@ -23376,7 +23325,7 @@ msgstr "Kódovanie"
 
 #: lazarusidestrconsts.uemevaluatemodify
 msgid "&Evaluate/Modify ..."
-msgstr ""
+msgstr "Vyhodnotiť/Upraviť ..."
 
 #: lazarusidestrconsts.uemfinddeclaration
 msgid "&Find Declaration"
diff --git a/lcl/languages/lclstrconsts.sk.po b/lcl/languages/lclstrconsts.sk.po
index 5fb6021867..f724e42ff1 100644
--- a/lcl/languages/lclstrconsts.sk.po
+++ b/lcl/languages/lclstrconsts.sk.po
@@ -3,7 +3,7 @@ msgstr ""
 "Project-Id-Version: lclstrconsts\n"
 "Report-Msgid-Bugs-To: \n"
 "POT-Creation-Date: 2008-02-02 16:22+0100\n"
-"PO-Revision-Date: 2019-09-30 11:52+0200\n"
+"PO-Revision-Date: 2022-01-07 16:00+0100\n"
 "Last-Translator: Slavo Gbúr <slavusec@azet.sk>\n"
 "Language-Team: Slovenský <sk@li.org>\n"
 "Language: sk\n"
@@ -11,7 +11,7 @@ msgstr ""
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
-"X-Generator: Poedit 2.2.3\n"
+"X-Generator: Poedit 3.0\n"
 
 #: lclstrconsts.hhshelpbrowsernotexecutable
 #, object-pascal-format
@@ -33,9 +33,9 @@ msgid "Unable to find a HTML browser."
 msgstr "Nie je možné nájsť prehliadač HTML."
 
 #: lclstrconsts.hhshelpnohtmlbrowserfoundpleasedefineone
-#, object-pascal-format, fuzzy, badformat
+#, object-pascal-format
 msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help -> Help Options"
-msgstr "HTML prehliadač nebol nájdený.%Prosím zadajte jeden v Nástroje -> Možnosti -> Pomoc -> Možnosti pomoci"
+msgstr "HTML prehliadač nebol nájdený.%sProsím zadajte jeden v Nástroje -> Možnosti -> Pomoc -> Možnosti pomoci"
 
 #: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile
 #, object-pascal-format
@@ -122,7 +122,7 @@ msgstr "Vodná"
 #: lclstrconsts.rsascannothaveasparent
 #, object-pascal-format
 msgid "Class %s cannot have %s as parent."
-msgstr ""
+msgstr "Trieda %s nemôže mať %s ako rodiča."
 
 #: lclstrconsts.rsbackgroundcolorcaption
 msgid "Desktop"
@@ -197,7 +197,7 @@ msgstr "Prvok triedy '%s' nemôže mať prvok triedy '%s' ako dieťa"
 #: lclstrconsts.rscontrolhasnoparentformorframe
 #, object-pascal-format
 msgid "Control '%s' has no parent form or frame"
-msgstr ""
+msgstr "Ovládací prvok '%s' nemá nadradený formulár ani rámec"
 
 #: lclstrconsts.rscontrolisnotaparent
 #, object-pascal-format
@@ -369,11 +369,11 @@ msgstr "Prvý"
 
 #: lclstrconsts.rsfixedcolstoobig
 msgid "FixedCols can't be > ColCount"
-msgstr "FixedCols nemôže byť >= ColCount"
+msgstr "FixedCols nemôže byť > ColCount"
 
 #: lclstrconsts.rsfixedrowstoobig
 msgid "FixedRows can't be > RowCount"
-msgstr "FixedRows nemôže byť >= RowCount"
+msgstr "FixedRows nemôže byť > RowCount"
 
 #: lclstrconsts.rsformcolorcaption
 msgid "Form"
@@ -616,10 +616,8 @@ msgid "Hot Light"
 msgstr "Hot Light"
 
 #: lclstrconsts.rsicns
-#, fuzzy
-#| msgid "Mac OS X Icon"
 msgid "macOS Icon"
-msgstr "Mac OS X Iikony"
+msgstr "macOS Ikona"
 
 #: lclstrconsts.rsicon
 msgid "Icon"
@@ -732,29 +730,29 @@ msgstr "Index zoznamu prekračuje hranice (%d)"
 
 #: lclstrconsts.rsmacosfileformat
 msgid "File Format:"
-msgstr ""
+msgstr "Formát súboru:"
 
 #: lclstrconsts.rsmacosmenuhide
 #, object-pascal-format
 msgid "Hide %s"
-msgstr ""
+msgstr "Skryť %s"
 
 #: lclstrconsts.rsmacosmenuhideothers
 msgid "Hide Others"
-msgstr ""
+msgstr "Skryť ostatných"
 
 #: lclstrconsts.rsmacosmenuquit
 #, object-pascal-format
 msgid "Quit %s"
-msgstr ""
+msgstr "Skončiť %s"
 
 #: lclstrconsts.rsmacosmenuservices
 msgid "Services"
-msgstr ""
+msgstr "Služby"
 
 #: lclstrconsts.rsmacosmenushowall
 msgid "Show All"
-msgstr ""
+msgstr "Zobraziť všetko"
 
 #: lclstrconsts.rsmarooncolorcaption
 msgid "Maroon"
@@ -931,7 +929,7 @@ msgstr "Odoslať (pošta)"
 #: lclstrconsts.rspressoktoignoreandriskdatacorruptionpressaborttok
 #, object-pascal-format
 msgid "%s%sPress OK to ignore and risk data corruption.%sPress Abort to kill the program."
-msgstr ""
+msgstr "%s%sStlačte tlačítko OK, ak chcete ignorovať a riskovať poškodenie dát.%sStlačte tlačítko Prerušiť, ak chcete ukončiť program."
 
 #: lclstrconsts.rspriorrecordhint
 msgctxt "lclstrconsts.rspriorrecordhint"
@@ -953,7 +951,7 @@ msgstr "Fialová"
 
 #: lclstrconsts.rsqtoptiondisableaccurateframe
 msgid "-disableaccurateframe, disables fully accurate window frame under X11. This feature is implemented for Qt, Qt5 and Gtk2 interfaces and used mostly by GetWindowRect()."
-msgstr ""
+msgstr "-disableaccurateframe, deaktivuje úplne presný rám okna pod X11. Táto funkcia je implementovaná pre rozhrania Qt, Qt5 a Gtk2 a väčšinou ju používa GetWindowRect()."
 
 #: lclstrconsts.rsqtoptiondograb
 msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG."
@@ -972,9 +970,8 @@ msgid "-reverse, sets the application's layout direction to Qt::RightToLeft."
 msgstr "-reverse, nastavuje smer rozloženia aplikácie na Qt::RightToLeft."
 
 #: lclstrconsts.rsqtoptionsession
-#, fuzzy
 msgid "-session session, restores the application from an earlier session."
-msgstr "-session session - obnovuje aplikáciu z skoršieho posedenia"
+msgstr "-session session, obnoví aplikáciu zo skoršej relácie."
 
 #: lclstrconsts.rsqtoptionstyle
 msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style  command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)."
@@ -1120,7 +1117,7 @@ msgstr "Text"
 
 #: lclstrconsts.rsthebuiltinurlisreadonlychangethebaseurlinstead
 msgid "The built-in URL is read only. Change the BaseURL instead."
-msgstr ""
+msgstr "Vstavaná adresa URL je len na čítanie. Namiesto toho zmeňte BaseURL."
 
 #: lclstrconsts.rstiff
 msgid "Tagged Image File Format"
@@ -1361,7 +1358,7 @@ msgstr "Nie sú dostupné žiadne časovače"
 #: lclstrconsts.sparentrequired
 #, object-pascal-format
 msgid "Control \"%s\" has no parent window."
-msgstr "Kontrola \"%s\" nemá nadradené okno."
+msgstr "Ovládací prvok \"%s\" nemá nadradené okno."
 
 #: lclstrconsts.sparexpected
 #, object-pascal-format