mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-05-30 19:22:42 +02:00
Translations: Hungarian translation update by Péter Gábor, bug #28543
git-svn-id: trunk@49693 -
This commit is contained in:
maxim
parent
a4bea16efc
commit
b77c1d45bc
@ -13,7 +13,7 @@ msgstr ""
|
||||
|
||||
#: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho
|
||||
msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\""
|
||||
msgstr "Egy elválasztó szabad oldalát nem lehet lehorgonyozni: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\""
|
||||
msgstr "Egy elválasztó szabad oldala nem rögzíthető: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsallfiles
|
||||
msgid "All files"
|
||||
@ -25,23 +25,23 @@ msgstr "Ennyi képpontot kell mozdulnia az egérnek mielőtt a húzás elkezdőd
|
||||
|
||||
#: anchordockstr.adrsanchordockinglayout
|
||||
msgid "Anchor Docking Layout"
|
||||
msgstr "Lehorgonyzás elrendezése"
|
||||
msgstr "Rögzített ablakelrendezés"
|
||||
|
||||
#: anchordockstr.adrsanchorisnotsplitternodeanchors
|
||||
msgid "Anchor is not splitter: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "A horgony nem elválasztó: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítés nem elválasztóhoz: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsanchornotfoundnodeanchors
|
||||
msgid "Anchor not found: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "Horgonyzás nincs engedélyezve: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítési hely nem található: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsanchortowrongsideofsplitternodeanchors
|
||||
msgid "Anchor to wrong side of splitter: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "Horgonyzás az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítés az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors
|
||||
msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\""
|
||||
msgstr "Egy lapot nem lehet lehorgonyozni: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\""
|
||||
msgstr "Egy lap nem rögzíthető: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsautomatically
|
||||
msgid "Automatically"
|
||||
@ -65,7 +65,7 @@ msgstr "Az \"%s\" dokkterület csak egy területet tartalmazhat."
|
||||
|
||||
#: anchordockstr.adrsdockinganchordocking
|
||||
msgid "Docking / Anchordocking"
|
||||
msgstr "Dokkolás / Lehorgonyzás"
|
||||
msgstr "Dokkolás / Ablakok rögzítése"
|
||||
|
||||
#: anchordockstr.adrsdockingoptions
|
||||
msgid "Docking options"
|
||||
@ -289,7 +289,7 @@ msgstr "fel"
|
||||
|
||||
#: anchordockstr.adrstouseanchordockingyoumustfirstuninstall
|
||||
msgid "To use anchordocking you must first uninstall %s"
|
||||
msgstr "A lehorgonyzás használatához először el kell távolítani ezt: %s"
|
||||
msgstr "Az ablakok rögzítésének használatához először el kell távolítani ezt: %s"
|
||||
|
||||
#: anchordockstr.adrsundock
|
||||
msgid "Undock"
|
||||
|
||||
@ -431,7 +431,7 @@ msgstr "Hibás"
|
||||
|
||||
#: codetoolsstrconsts.ctshelperisnotallowed
|
||||
msgid "Helper after %s is not allowed"
|
||||
msgstr ""
|
||||
msgstr "A \"helper\" nem következhet %s után"
|
||||
|
||||
#: codetoolsstrconsts.ctsidedirectory
|
||||
msgid "IDE Directory"
|
||||
@ -958,4 +958,3 @@ msgstr "Vezérlőkészlet könyvtára"
|
||||
#: codetoolsstrconsts.ctswordnotfound
|
||||
msgid "\"%s\" not found"
|
||||
msgstr "\"%s\" nem található"
|
||||
|
||||
|
||||
@ -663,19 +663,19 @@ msgstr "Beállítások"
|
||||
|
||||
#: objinspstrconsts.oisorderbackone
|
||||
msgid "Back One"
|
||||
msgstr "Egyet hátra"
|
||||
msgstr "Hátrább eggyel"
|
||||
|
||||
#: objinspstrconsts.oisorderforwardone
|
||||
msgid "Forward One"
|
||||
msgstr "Egyet előre"
|
||||
msgstr "Előbbre eggyel"
|
||||
|
||||
#: objinspstrconsts.oisordermovetoback
|
||||
msgid "Move to Back"
|
||||
msgstr "Háttérbe visz"
|
||||
msgstr "Háttérbe"
|
||||
|
||||
#: objinspstrconsts.oisordermovetofront
|
||||
msgid "Move to Front"
|
||||
msgstr "Előtérbe hoz"
|
||||
msgstr "Előtérbe"
|
||||
|
||||
#: objinspstrconsts.oispastecomponents
|
||||
msgctxt "objinspstrconsts.oispastecomponents"
|
||||
|
||||
@ -178,7 +178,7 @@ msgstr "Kód"
|
||||
#: lr_const.sbarcodeformdbfld
|
||||
msgctxt "lr_const.sbarcodeformdbfld"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sbarcodeformopts
|
||||
msgctxt "lr_const.sbarcodeformopts"
|
||||
@ -681,7 +681,7 @@ msgstr "Elérhető adatbázisok"
|
||||
#: lr_const.sfieldsforminsert
|
||||
msgctxt "lr_const.sfieldsforminsert"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sfilenotfound
|
||||
msgid "File not found"
|
||||
@ -903,7 +903,7 @@ msgstr "Teljes keret"
|
||||
|
||||
#: lr_const.sfrdesignerformback
|
||||
msgid "Send to back"
|
||||
msgstr "Háttérbeküldés"
|
||||
msgstr "Háttérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerformbackcolor
|
||||
msgid "Background color"
|
||||
@ -923,7 +923,7 @@ msgstr "Alsó keretvonal"
|
||||
|
||||
#: lr_const.sfrdesignerformbring
|
||||
msgid "Bring to front"
|
||||
msgstr "Előtérbehozás"
|
||||
msgstr "Előtérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerformcapt
|
||||
msgctxt "lr_const.sfrdesignerformcapt"
|
||||
@ -1164,7 +1164,7 @@ msgstr "Igazítás"
|
||||
|
||||
#: lr_const.sfrdesignerform_back
|
||||
msgid "Send to &back"
|
||||
msgstr "Háttérbeküldés"
|
||||
msgstr "Háttérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerform_beforeprintscript
|
||||
msgid "&Before print script ..."
|
||||
@ -1172,7 +1172,7 @@ msgstr "Nyomtatás előtti szkript ..."
|
||||
|
||||
#: lr_const.sfrdesignerform_bring
|
||||
msgid "Bring to &front"
|
||||
msgstr "Előtérbehozás "
|
||||
msgstr "Előtérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerform_copy
|
||||
msgid "&Copy"
|
||||
@ -1362,7 +1362,7 @@ msgstr "Nyújtás"
|
||||
#: lr_const.sgroupeditorformadddbfield
|
||||
msgctxt "lr_const.sgroupeditorformadddbfield"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sgroupeditorformcapt
|
||||
msgid "Group"
|
||||
@ -1453,7 +1453,7 @@ msgstr "Kifejezés beszúrása"
|
||||
|
||||
#: lr_const.sinsertfields
|
||||
msgid "Insert DB fields"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
msgstr "Adatbázismezők beszúrása"
|
||||
|
||||
#: lr_const.sinsertfieldsformaviabledset
|
||||
msgid "&Available datasets"
|
||||
|
||||
@ -48,14 +48,12 @@ msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer"
|
||||
msgstr "Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet megjelenítő"
|
||||
|
||||
#: heaptrcview.sfrmselectfilewithdebuginfo
|
||||
#, fuzzy
|
||||
#| msgid "Select File with debug info"
|
||||
msgid "Select file with debug info"
|
||||
msgstr "Válasszon fájlt hibakeresési infókkal!"
|
||||
msgstr "Hibakeresési infókat tartalmazó fájl választása"
|
||||
|
||||
#: heaptrcview.sfrmselecttrcfile
|
||||
msgid "Select file with trace log"
|
||||
msgstr ""
|
||||
msgstr "Nyomkövetési naplót tartalmazó fájl választása"
|
||||
|
||||
#: heaptrcview.slbltrace
|
||||
msgid ".trc file"
|
||||
@ -88,4 +86,3 @@ msgstr "Szivárgó memória mérete: %d"
|
||||
#: heaptrcview.strtotalmemalloc
|
||||
msgid "Total Mem allocated: %d"
|
||||
msgstr "Teljes lefoglalt memória: %d"
|
||||
|
||||
|
||||
@ -13,7 +13,7 @@ msgstr ""
|
||||
|
||||
#: todoliststrconsts.dlgfiltercsv
|
||||
msgid "CSV files"
|
||||
msgstr ""
|
||||
msgstr "CSV fájlok"
|
||||
|
||||
#: todoliststrconsts.dlgfropts
|
||||
msgid "Options"
|
||||
@ -98,4 +98,3 @@ msgstr "Kategória"
|
||||
#: todoliststrconsts.lisviewtodolist
|
||||
msgid "View ToDo List"
|
||||
msgstr "ToDo lista megjelenítése"
|
||||
|
||||
|
||||
@ -29,7 +29,7 @@ msgstr "Betöltés gyorsítótárból (%s = %s)"
|
||||
|
||||
#: ipconst.httpcantloadgraphic
|
||||
msgid "Unable to load graphic %s"
|
||||
msgstr ""
|
||||
msgstr "Nem lehet betölteni a grafikát: %s"
|
||||
|
||||
#: ipconst.httpconnect
|
||||
msgid "Connected: (%s)"
|
||||
@ -113,7 +113,7 @@ msgstr "Kísérlet az írásra: "
|
||||
|
||||
#: ipconst.sbadframelistobject
|
||||
msgid "Unrecognized object of class %s in GIF Frame List"
|
||||
msgstr ""
|
||||
msgstr "Ismeretlen %s osztályú objektum a GIF képkockalistában"
|
||||
|
||||
#: ipconst.sbadimagelibfileformat
|
||||
msgid "Unrecognized file format"
|
||||
@ -141,7 +141,7 @@ msgstr "Az elérési út nem létezik"
|
||||
|
||||
#: ipconst.sbadseekorigin
|
||||
msgid "Invalid seek origin"
|
||||
msgstr ""
|
||||
msgstr "Érvénytelen kezdőpont a pozicionáláshoz"
|
||||
|
||||
#: ipconst.sbibuffernotassigned
|
||||
msgid "Buffer not assigned"
|
||||
@ -175,11 +175,11 @@ msgstr "Érvénytelen adathosszúság"
|
||||
|
||||
#: ipconst.sbinhexoddchar
|
||||
msgid "One odd character"
|
||||
msgstr ""
|
||||
msgstr "Egy furcsa karakter"
|
||||
|
||||
#: ipconst.sbinhexresourceforkerr
|
||||
msgid "Resource fork present"
|
||||
msgstr ""
|
||||
msgstr "Erőforrás-elágazás"
|
||||
|
||||
#: ipconst.sbrokerdownloadreq
|
||||
msgid "Download %s?"
|
||||
@ -215,7 +215,7 @@ msgstr "%s: az új szám túl kicsi"
|
||||
|
||||
#: ipconst.sdestroying
|
||||
msgid "Destroying"
|
||||
msgstr ""
|
||||
msgstr "Megsemmisítés"
|
||||
|
||||
#: ipconst.seventconnect
|
||||
msgid "Connect: Loc: %s Rem: %s"
|
||||
@ -284,7 +284,7 @@ msgstr "Az átvitelt a felhasználó megszakította"
|
||||
|
||||
#: ipconst.shtmlcharstackoverfl
|
||||
msgid "Character stack overflow"
|
||||
msgstr ""
|
||||
msgstr "Karakter-verem túlcsordulás"
|
||||
|
||||
#: ipconst.shtmldashexp
|
||||
msgid "- expected"
|
||||
@ -316,7 +316,7 @@ msgstr "Belső hiba"
|
||||
|
||||
#: ipconst.shtmlinvalign
|
||||
msgid "Invalid alignment specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott igazítás érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvcolor
|
||||
msgid "Invalid color constant:"
|
||||
@ -324,15 +324,15 @@ msgstr "Érvénytelen szín-konstans:"
|
||||
|
||||
#: ipconst.shtmlinvdir
|
||||
msgid "Invalid dir value specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott irányérték érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvframe
|
||||
msgid "Invalid frame specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott keret érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvgraphic
|
||||
msgid "Invalid graphic returned"
|
||||
msgstr ""
|
||||
msgstr "A visszaadott grafikus objektum érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvint
|
||||
msgid "Invalid integer constant"
|
||||
@ -340,35 +340,35 @@ msgstr "Érvénytelen egész-szám konstans"
|
||||
|
||||
#: ipconst.shtmlinvmethod
|
||||
msgid "Invalid method specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott metódus érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvpicture
|
||||
msgid "Invalid picture returned"
|
||||
msgstr ""
|
||||
msgstr "A visszaadott képobjektum érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvrule
|
||||
msgid "Invalid rule specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott szabály érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvscope
|
||||
msgid "Invalid scope specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott hatókör érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvscroll
|
||||
msgid "Invalid scrolling specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott görgetés érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvshape
|
||||
msgid "Invalid shape specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott alakzat érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvtype
|
||||
msgid "Invalid type specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott típus érvénytelen"
|
||||
|
||||
#: ipconst.shtmlinvvaltype
|
||||
msgid "Invalid value type specified"
|
||||
msgstr ""
|
||||
msgstr "A megadott értéktípus érvénytelen"
|
||||
|
||||
#: ipconst.shtmllineerror
|
||||
msgid "Error \"%s\" at line %d, position %d"
|
||||
@ -384,11 +384,11 @@ msgstr "OnGetImage eseménykezelő nincs hozzárendelve"
|
||||
|
||||
#: ipconst.shtmlnographic
|
||||
msgid "Picture object contains no graphic object"
|
||||
msgstr ""
|
||||
msgstr "A képobjektum nem tartalmaz grafikus elemet"
|
||||
|
||||
#: ipconst.shtmlnotcontainer
|
||||
msgid "Parent is not a container"
|
||||
msgstr ""
|
||||
msgstr "A szülő nem tároló"
|
||||
|
||||
#: ipconst.shtmlresunavail
|
||||
msgid "Resource unavailable:"
|
||||
@ -532,11 +532,11 @@ msgstr "Sikerült"
|
||||
|
||||
#: ipconst.sipicmp_ttl_expired_reassem
|
||||
msgid "Time to live expired during reassembly"
|
||||
msgstr ""
|
||||
msgstr "Élettartam lejárt az újraösszeállítás során"
|
||||
|
||||
#: ipconst.sipicmp_ttl_expired_transit
|
||||
msgid "Time to live expired during transmit"
|
||||
msgstr ""
|
||||
msgstr "Élettartam lejárt az átvitel során"
|
||||
|
||||
#: ipconst.sipicmp_unknown
|
||||
msgid "Unknown status"
|
||||
@ -1067,11 +1067,11 @@ msgstr "Nincs címzett megadva"
|
||||
|
||||
#: ipconst.snoseekforread
|
||||
msgid "No seek for read"
|
||||
msgstr ""
|
||||
msgstr "Nincs pozicionálás az olvasáshoz"
|
||||
|
||||
#: ipconst.snoseekforwrite
|
||||
msgid "No seek for write"
|
||||
msgstr ""
|
||||
msgstr "Nincs pozicionálás az íráshoz"
|
||||
|
||||
#: ipconst.snosockerr
|
||||
msgid "Socket not assigned"
|
||||
@ -1087,7 +1087,7 @@ msgstr "Nincs elegendő adat (%s bájt) az olvasási kérés teljesítéséhez (
|
||||
|
||||
#: ipconst.snotimererr
|
||||
msgid "Not enough system timers available"
|
||||
msgstr ""
|
||||
msgstr "Nincs elég elérhető rendszeridőzítő"
|
||||
|
||||
#: ipconst.snowinsock2err
|
||||
msgid "%s requires WinSock 2, and this system only has WinSock 1"
|
||||
@ -1099,11 +1099,11 @@ msgstr "Cikk lekérése"
|
||||
|
||||
#: ipconst.snsauthpass
|
||||
msgid "Authorizing password"
|
||||
msgstr "Jelszó engedélyezése"
|
||||
msgstr "Engedélyező jelszó"
|
||||
|
||||
#: ipconst.snsauthuser
|
||||
msgid "Authorizing user"
|
||||
msgstr "Felhasználó engedélyezése"
|
||||
msgstr "Engedélyező felhasználó"
|
||||
|
||||
#: ipconst.snsbody
|
||||
msgid "Retrieving body"
|
||||
@ -1238,11 +1238,11 @@ msgstr "Csoport kiválasztása"
|
||||
|
||||
#: ipconst.soriginfrombegin
|
||||
msgid "When origin is soFromBeginning, Offset must be >= 0"
|
||||
msgstr ""
|
||||
msgstr "Amikor a kezdőpont soFromBeginning, az eltolásnak >= 0 kell lennie"
|
||||
|
||||
#: ipconst.soriginfromend
|
||||
msgid "When origin is soFromEnd, Offset must be <= 0"
|
||||
msgstr ""
|
||||
msgstr "Amikor a kezdőpont soFromEnd, az eltolásnak <= 0 kell lennie"
|
||||
|
||||
#: ipconst.spngbadbitdepth
|
||||
msgid "Unsupported Bit Depth of %d"
|
||||
@ -1254,7 +1254,7 @@ msgstr "Ismeretlen adatblokk típus: %s"
|
||||
|
||||
#: ipconst.spngbadcolortype
|
||||
msgid "Unrecognized color type of %d"
|
||||
msgstr ""
|
||||
msgstr "A(z) %d színtípusa ismeretlen"
|
||||
|
||||
#: ipconst.spngbadinterlacemethod
|
||||
msgid "Unrecognized Interlace Method"
|
||||
@ -1306,7 +1306,7 @@ msgstr ""
|
||||
|
||||
#: ipconst.spngeffectivefilter
|
||||
msgid "Effective filter is %s"
|
||||
msgstr ""
|
||||
msgstr "Az alkalmazandó szűrő: %s"
|
||||
|
||||
#: ipconst.spngerrorconstant
|
||||
msgid "**** ERROR ****"
|
||||
@ -1314,7 +1314,7 @@ msgstr "**** HIBA ****"
|
||||
|
||||
#: ipconst.spngfilterchange
|
||||
msgid "Filter changed on Row %d to %x"
|
||||
msgstr ""
|
||||
msgstr "A szűrő a(z) %d. sorban megváltozott erre: %x"
|
||||
|
||||
#: ipconst.spngfiltermethod
|
||||
msgid "Filter Method: %d"
|
||||
@ -1366,7 +1366,7 @@ msgstr "A módosítás dátuma: %s"
|
||||
|
||||
#: ipconst.spngnoclipboard
|
||||
msgid "PNG Clipboard support is not supported."
|
||||
msgstr ""
|
||||
msgstr "PNG Vágólap használata nincs támogatva."
|
||||
|
||||
#: ipconst.spngpaletteentry
|
||||
msgid "Palette Entry %d - Red: %d Green: %d Blue: %d"
|
||||
@ -1465,11 +1465,11 @@ msgstr "-ERR"
|
||||
|
||||
#: ipconst.spop3notauthenticating
|
||||
msgid "%s can not be called in transaction state"
|
||||
msgstr ""
|
||||
msgstr "%s nem hívható átviteli közben"
|
||||
|
||||
#: ipconst.spop3nottransacting
|
||||
msgid "%s can not be called in authentication state"
|
||||
msgstr ""
|
||||
msgstr "%s nem hívható hitelesítés közben"
|
||||
|
||||
#: ipconst.spop3okresp
|
||||
msgid "+OK"
|
||||
@ -1477,11 +1477,11 @@ msgstr "+OK"
|
||||
|
||||
#: ipconst.sposreqd
|
||||
msgid "%s: count must be positive"
|
||||
msgstr ""
|
||||
msgstr "%s: számnak pozitívnak kell lennie"
|
||||
|
||||
#: ipconst.spsapop
|
||||
msgid "Logging on with APOP"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés APOP használatával"
|
||||
|
||||
#: ipconst.spsconnect
|
||||
msgid "Connecting to server"
|
||||
@ -1503,7 +1503,7 @@ msgstr "Nincs művelet"
|
||||
|
||||
#: ipconst.spspass
|
||||
msgid "Logging on with Password"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés jelszóval"
|
||||
|
||||
#: ipconst.spsquit
|
||||
msgctxt "ipconst.spsquit"
|
||||
@ -1541,7 +1541,7 @@ msgstr "Ismeretlen állapot"
|
||||
|
||||
#: ipconst.spsuser
|
||||
msgid "Logging on with User"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés felhasználónévvel"
|
||||
|
||||
#: ipconst.spterror
|
||||
msgid "An error occurred with the last task."
|
||||
@ -1555,7 +1555,7 @@ msgstr "Postafióklista lekérése"
|
||||
#: ipconst.sptlogon
|
||||
msgctxt "ipconst.sptlogon"
|
||||
msgid "Logging on"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés"
|
||||
|
||||
#: ipconst.sptnone
|
||||
msgctxt "ipconst.sptnone"
|
||||
@ -1613,11 +1613,11 @@ msgstr "Hitelesítés újrapróbálása"
|
||||
|
||||
#: ipconst.srascallbackcomplete
|
||||
msgid "Callback complete"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás kész"
|
||||
|
||||
#: ipconst.srascallbacksetbycaller
|
||||
msgid "Callback set by caller"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás beállítva a hívó által"
|
||||
|
||||
#: ipconst.srasconnectdevice
|
||||
msgid "Connect device"
|
||||
@ -1638,7 +1638,7 @@ msgstr "Kapcsolat bontva"
|
||||
|
||||
#: ipconst.sraserr
|
||||
msgid "Ras Error (%d): on API '%s'"
|
||||
msgstr "Ras hiba (%d): a következő API-n: '%s'"
|
||||
msgstr "RAS hiba (%d): a következő API-n: '%s'"
|
||||
|
||||
#: ipconst.srasinteractive
|
||||
msgid "Interactive"
|
||||
@ -1646,7 +1646,7 @@ msgstr "Interaktív"
|
||||
|
||||
#: ipconst.sraslogonnetwork
|
||||
msgid "Logon network"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés a hálózatra"
|
||||
|
||||
#: ipconst.srasopenport
|
||||
msgid "Open port"
|
||||
@ -1666,11 +1666,11 @@ msgstr "Port megnyitva"
|
||||
|
||||
#: ipconst.srasprepareforcallback
|
||||
msgid "Prepare for callback"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás előkészítése"
|
||||
|
||||
#: ipconst.srasprojected
|
||||
msgid "Projected"
|
||||
msgstr ""
|
||||
msgstr "Ütemezve"
|
||||
|
||||
#: ipconst.srasreauthenticate
|
||||
msgid "Re-authenticate"
|
||||
@ -1694,7 +1694,7 @@ msgstr ""
|
||||
|
||||
#: ipconst.sraswaitforcallback
|
||||
msgid "Wait for callback"
|
||||
msgstr ""
|
||||
msgstr "Várakozás visszahívásra"
|
||||
|
||||
#: ipconst.sraswaitformodemreset
|
||||
msgid "Wait for modem reset"
|
||||
@ -1722,7 +1722,7 @@ msgstr "TIpTerminalArray.ScrollRows: a kezdő (%d) és befejező (%d) sorszám i
|
||||
|
||||
#: ipconst.sseekingdiskfileto
|
||||
msgid "Seeking disk file to "
|
||||
msgstr ""
|
||||
msgstr "Lemezen lévő fájl pozicionálása: "
|
||||
|
||||
#: ipconst.sslnopremastersecret
|
||||
msgid "No pre-master secret."
|
||||
@ -1734,7 +1734,7 @@ msgstr "Siker,"
|
||||
|
||||
#: ipconst.ssmtpresponse04
|
||||
msgid "Transient, "
|
||||
msgstr ""
|
||||
msgstr "Átmenő, "
|
||||
|
||||
#: ipconst.ssmtpresponse05
|
||||
msgid "Persistent, "
|
||||
@ -1794,7 +1794,7 @@ msgstr "Az üzenet hossza meghaladja az adminisztratív korlátot"
|
||||
|
||||
#: ipconst.ssmtpresponse24
|
||||
msgid "Mailing list expansion problem"
|
||||
msgstr ""
|
||||
msgstr "A levelezési lista bővítése problémás"
|
||||
|
||||
#: ipconst.ssmtpresponse30
|
||||
msgid "Other or undefined mail system status"
|
||||
@ -1838,11 +1838,11 @@ msgstr "Útválasztás nem lehetséges"
|
||||
|
||||
#: ipconst.ssmtpresponse45
|
||||
msgid "Network congestion"
|
||||
msgstr ""
|
||||
msgstr "Hálózati torlódás"
|
||||
|
||||
#: ipconst.ssmtpresponse46
|
||||
msgid "Routing loop detected"
|
||||
msgstr ""
|
||||
msgstr "Útválasztás ismétlődése érzékelve"
|
||||
|
||||
#: ipconst.ssmtpresponse47
|
||||
msgid "Delivery time expired"
|
||||
@ -1882,7 +1882,7 @@ msgstr "A média nincs támogatva"
|
||||
|
||||
#: ipconst.ssmtpresponse62
|
||||
msgid "Conversion required and prohibited"
|
||||
msgstr ""
|
||||
msgstr "Átalakítás szükséges és tilos"
|
||||
|
||||
#: ipconst.ssmtpresponse63
|
||||
msgid "Conversion required but not supported"
|
||||
@ -1890,7 +1890,7 @@ msgstr "Átlakítás szükséges, de nincs támogatva"
|
||||
|
||||
#: ipconst.ssmtpresponse64
|
||||
msgid "Conversion with loss performed"
|
||||
msgstr ""
|
||||
msgstr "Az átalakítás veszteséggel végrehajtva"
|
||||
|
||||
#: ipconst.ssmtpresponse65
|
||||
msgid "Conversion failed"
|
||||
@ -1902,15 +1902,15 @@ msgstr "Egyéb vagy meghatározatlan biztonsági állapot"
|
||||
|
||||
#: ipconst.ssmtpresponse71
|
||||
msgid "Delivery not authorized, message refused"
|
||||
msgstr ""
|
||||
msgstr "Kézbesítés nincs engedélyezve, üzenet elutasítva"
|
||||
|
||||
#: ipconst.ssmtpresponse72
|
||||
msgid "Mailing list expansion prohibited"
|
||||
msgstr ""
|
||||
msgstr "A levelezési lista bővítése tilos"
|
||||
|
||||
#: ipconst.ssmtpresponse73
|
||||
msgid "Security conversion required but not possible"
|
||||
msgstr ""
|
||||
msgstr "Biztonsági átalakítás szükséges, de nem lehetséges"
|
||||
|
||||
#: ipconst.ssmtpresponse74
|
||||
msgid "Security features not supported"
|
||||
@ -1926,7 +1926,7 @@ msgstr "A titkosító eljárás nincs támogatva"
|
||||
|
||||
#: ipconst.ssmtpresponse77
|
||||
msgid "Message integrity failure"
|
||||
msgstr ""
|
||||
msgstr "Az üzenet sérült"
|
||||
|
||||
#: ipconst.ssmtpresponsesubunknown
|
||||
msgid "Unknown subcode"
|
||||
@ -1963,16 +1963,15 @@ msgstr "Adatok küldése"
|
||||
|
||||
#: ipconst.sssehlo
|
||||
msgid "Logging on with EHLO"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés EHLO-val"
|
||||
|
||||
#: ipconst.sssexpand
|
||||
#, fuzzy
|
||||
msgid "Expanding"
|
||||
msgstr "Kiterjesztett"
|
||||
msgstr "Kibővítés"
|
||||
|
||||
#: ipconst.ssshelo
|
||||
msgid "Logging on with HELO"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés HELO-val"
|
||||
|
||||
#: ipconst.ssshelp
|
||||
msgid "Help"
|
||||
@ -1984,11 +1983,11 @@ msgstr "Rossz tanúsítvány."
|
||||
|
||||
#: ipconst.ssslbadcerttype
|
||||
msgid "Cert type not found"
|
||||
msgstr ""
|
||||
msgstr "A tanúsítványtípus nem található"
|
||||
|
||||
#: ipconst.ssslbadcompressionvalue
|
||||
msgid "Compression value is wrong."
|
||||
msgstr ""
|
||||
msgstr "A tömörítési érték hibás."
|
||||
|
||||
#: ipconst.ssslbadkeyexchangetype
|
||||
msgid "Key exchange message expected but not received"
|
||||
@ -2008,7 +2007,7 @@ msgstr "Rossz a nyilvános kódolás típusa."
|
||||
|
||||
#: ipconst.ssslbadrecordmac
|
||||
msgid "Server received a bad record MAC."
|
||||
msgstr ""
|
||||
msgstr "A kiszolgáló rossz MAC rekordot kapott."
|
||||
|
||||
#: ipconst.ssslbadsha1hash
|
||||
msgid "SHA1 hash did not match."
|
||||
@ -2028,7 +2027,7 @@ msgstr "A puffer mérete nem egyezik."
|
||||
|
||||
#: ipconst.ssslclosenotify
|
||||
msgid "Server sent close notify."
|
||||
msgstr ""
|
||||
msgstr "A kiszolgáló lezárási értesítést küldött."
|
||||
|
||||
#: ipconst.ssslcompressionfailure
|
||||
msgid "Compression failure."
|
||||
@ -2052,7 +2051,7 @@ msgstr "Lejárt tanúsítvány."
|
||||
|
||||
#: ipconst.ssslfailedhelloparse
|
||||
msgid "Did not parse server hello correctly."
|
||||
msgstr ""
|
||||
msgstr "Nem sikerült megfelelően elemezni a kiszolgáló helló-ját."
|
||||
|
||||
#: ipconst.ssslhandshakefailure
|
||||
msgid "Handshake failure."
|
||||
@ -2084,11 +2083,11 @@ msgstr "Nincs elég memória az SSL rekord olvasásához."
|
||||
|
||||
#: ipconst.ssslnotenoughkeymaterail
|
||||
msgid "Not enough key material."
|
||||
msgstr ""
|
||||
msgstr "Nincs elegendő kulcsanyag."
|
||||
|
||||
#: ipconst.ssslpaddingerror
|
||||
msgid "Padding error."
|
||||
msgstr ""
|
||||
msgstr "Helykitöltés hiba."
|
||||
|
||||
#: ipconst.ssslparsererror
|
||||
msgid "Parsing error."
|
||||
@ -2219,7 +2218,7 @@ msgstr "Hiba keletkezet ezen feladat közben."
|
||||
#: ipconst.sstlogon
|
||||
msgctxt "ipconst.sstlogon"
|
||||
msgid "Logging on"
|
||||
msgstr ""
|
||||
msgstr "Bejelentkezés"
|
||||
|
||||
#: ipconst.sstnotask
|
||||
msgid "None"
|
||||
@ -2255,7 +2254,7 @@ msgstr "%s nem található"
|
||||
|
||||
#: ipconst.swebimagestreambad
|
||||
msgid "Cannot load image from stream"
|
||||
msgstr ""
|
||||
msgstr "Nem lehet képet betölteni az adatfolyamból"
|
||||
|
||||
#: ipconst.swinsockerr
|
||||
msgid "WinSock Error (%d): %s, on API '%s'"
|
||||
@ -2263,7 +2262,7 @@ msgstr "WinSock hiba (%d): %s, a következő API-n: '%s'"
|
||||
|
||||
#: ipconst.swriteafterrename
|
||||
msgid "***Write after rename"
|
||||
msgstr ""
|
||||
msgstr "***Írás átnevezés után"
|
||||
|
||||
#: ipconst.swrongstateerr
|
||||
msgid "Can not comply, wrong state"
|
||||
@ -2315,7 +2314,7 @@ msgstr "Célcím szükséges"
|
||||
|
||||
#: ipconst.swsaediscon
|
||||
msgid "Graceful shutdown in progress"
|
||||
msgstr ""
|
||||
msgstr "Rendes lekapcsolás folyamatban"
|
||||
|
||||
#: ipconst.swsaedquot
|
||||
msgid "Disk quota exceeded"
|
||||
@ -2347,11 +2346,11 @@ msgstr "Érvénytelen argumentum"
|
||||
|
||||
#: ipconst.swsaeinvalidproctable
|
||||
msgid "Invalid procedure table from service provider"
|
||||
msgstr ""
|
||||
msgstr "Érvénytelen éljáráslista a szolgáltatótól"
|
||||
|
||||
#: ipconst.swsaeinvalidprovider
|
||||
msgid "Invalid service provider version number"
|
||||
msgstr ""
|
||||
msgstr "Érvénytelen a szolgáltató változatszáma"
|
||||
|
||||
#: ipconst.swsaeisconn
|
||||
msgid "Socket is already connected"
|
||||
@ -2432,7 +2431,7 @@ msgstr "A protokoll típusa nem megfelelő a szoftvercsatornához"
|
||||
|
||||
#: ipconst.swsaeproviderfailedinit
|
||||
msgid "Unable to initialize a service provider"
|
||||
msgstr ""
|
||||
msgstr "Nem sikerült a szolgáltató előkészítése"
|
||||
|
||||
#: ipconst.swsaerefused
|
||||
msgid "Refused"
|
||||
@ -2440,7 +2439,7 @@ msgstr "Elutasítva"
|
||||
|
||||
#: ipconst.swsaeremote
|
||||
msgid "Too many levels of remote in path"
|
||||
msgstr ""
|
||||
msgstr "Túl sok szint a távoli útvonalban"
|
||||
|
||||
#: ipconst.swsaeshutdown
|
||||
msgid "Cannot send after socket shutdown"
|
||||
@ -2480,7 +2479,7 @@ msgstr "Sikeres WSAStartup még nem lett végrehajtva"
|
||||
|
||||
#: ipconst.swsano_data
|
||||
msgid "Valid name, no data record of requested type"
|
||||
msgstr ""
|
||||
msgstr "Érvényes név, nincs adatrekord a kért típussal"
|
||||
|
||||
#: ipconst.swsano_recovery
|
||||
msgid "This is a nonrecoverable error"
|
||||
@ -2500,11 +2499,11 @@ msgstr "A hálózati alrendszer nem érhető el"
|
||||
|
||||
#: ipconst.swsatry_again
|
||||
msgid "Non-authoritative host not found"
|
||||
msgstr ""
|
||||
msgstr "A nem hiteles állomás nem található"
|
||||
|
||||
#: ipconst.swsatype_not_found
|
||||
msgid "Type not found"
|
||||
msgstr ""
|
||||
msgstr "Típus nem található"
|
||||
|
||||
#: ipconst.swsavernotsupported
|
||||
msgid "WinSock DLL version not supported"
|
||||
@ -2525,7 +2524,7 @@ msgstr "Hiba erőforráshiány miatt"
|
||||
|
||||
#: ipconst.swsa_qos_bad_object
|
||||
msgid "Problem filterspec or provider specific buffer"
|
||||
msgstr ""
|
||||
msgstr "Problémás szűrőleírás vagy szolgáltatói puffer"
|
||||
|
||||
#: ipconst.swsa_qos_bad_style
|
||||
msgid "Unknown or conflicting style"
|
||||
@ -2561,4 +2560,4 @@ msgstr ""
|
||||
|
||||
#: ipconst.swsa_qos_traffic_ctrl_error
|
||||
msgid "Problem with some part of the flowspec"
|
||||
msgstr ""
|
||||
msgstr "Probléma van az adatfolyam-leírás egy részével"
|
||||
|
||||
@ -454,7 +454,7 @@ msgstr "Szinkron szerkesztés"
|
||||
|
||||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||||
msgid "Template Edit"
|
||||
msgstr "Sablon szerkesztés"
|
||||
msgstr "Sablon szerkesztése"
|
||||
|
||||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||||
@ -700,7 +700,7 @@ msgstr "Blokk behúzás (tab-ok)"
|
||||
|
||||
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
||||
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
||||
msgstr "A keret-térköz beállítható a Horgony szerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."
|
||||
msgstr "A keret-térköz beállítható a Horgonyszerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."
|
||||
|
||||
#: lazarusidestrconsts.dlgbrackethighlight
|
||||
msgid "Bracket highlight"
|
||||
@ -822,11 +822,11 @@ msgstr "A form csomagokat igényelhet a működéshez. Az ilyen csomagok automat
|
||||
|
||||
#: lazarusidestrconsts.dlgchscodetempl
|
||||
msgid "Choose code template file (*.dci)"
|
||||
msgstr "Válasszon kódsablon fájlt! (*.dcl)"
|
||||
msgstr "Kódsablon fájl választása (*.dci)"
|
||||
|
||||
#: lazarusidestrconsts.dlgcloseanduseselecteddesktop
|
||||
msgid "Close and use selected desktop"
|
||||
msgstr ""
|
||||
msgstr "Bezárás és a kiválasztott felület használata"
|
||||
|
||||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||||
msgid "Show close buttons in notebook"
|
||||
@ -1191,7 +1191,7 @@ msgstr "Felhasználó által megadott kiterjesztés (.pp.xxx)"
|
||||
|
||||
#: lazarusidestrconsts.dlgdebugdesktop
|
||||
msgid "debug desktop"
|
||||
msgstr ""
|
||||
msgstr "hibakereső felület"
|
||||
|
||||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||||
msgid "Path Editor"
|
||||
@ -1227,7 +1227,7 @@ msgstr "Menükben: "
|
||||
|
||||
#: lazarusidestrconsts.dlgdesktopname
|
||||
msgid "Desktop name:"
|
||||
msgstr ""
|
||||
msgstr "Felület neve:"
|
||||
|
||||
#: lazarusidestrconsts.dlgdirection
|
||||
msgid "Direction"
|
||||
@ -1549,7 +1549,7 @@ msgstr "Minden fájl"
|
||||
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
||||
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
||||
msgid "CodeTools template file"
|
||||
msgstr "CodeTools sablon fájl"
|
||||
msgstr "CodeTools sablonfájl"
|
||||
|
||||
#: lazarusidestrconsts.dlgfilterdcifile
|
||||
msgid "DCI file"
|
||||
@ -1590,15 +1590,15 @@ msgstr "HTML fájlok"
|
||||
|
||||
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
||||
msgid "Bitmap images"
|
||||
msgstr ""
|
||||
msgstr "Bitmap képek"
|
||||
|
||||
#: lazarusidestrconsts.dlgfilterimagespixmap
|
||||
msgid "Pixmap images"
|
||||
msgstr ""
|
||||
msgstr "Pixmap képek"
|
||||
|
||||
#: lazarusidestrconsts.dlgfilterimagespng
|
||||
msgid "PNG images"
|
||||
msgstr ""
|
||||
msgstr "PNG képek"
|
||||
|
||||
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
||||
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
||||
@ -2031,7 +2031,7 @@ msgstr "Külső alkalmazás"
|
||||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||||
msgid "Identifier Completion"
|
||||
msgstr "Azonosító kiegészítés"
|
||||
msgstr "Azonosítók kiegészítése"
|
||||
|
||||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||||
msgid "Identifier policy"
|
||||
@ -2217,7 +2217,7 @@ msgstr "\"Make\" program"
|
||||
|
||||
#: lazarusidestrconsts.dlgmanagedesktops
|
||||
msgid "Manage desktops"
|
||||
msgstr ""
|
||||
msgstr "Felületek kezelése"
|
||||
|
||||
#: lazarusidestrconsts.dlgmargingutter
|
||||
msgid "Margin and gutter"
|
||||
@ -2817,6 +2817,8 @@ msgid ""
|
||||
"Desktop with the name \"%s\" was found.\n"
|
||||
"Should the old desktop be overwritten?\n"
|
||||
msgstr ""
|
||||
"Létezik \"%s\" nevű felület.\n"
|
||||
"Felülírható a régi felület?\n"
|
||||
|
||||
#: lazarusidestrconsts.dlgpalhints
|
||||
msgid "Hints for component palette"
|
||||
@ -2993,7 +2995,7 @@ msgstr "Kérdés felülírásnál"
|
||||
|
||||
#: lazarusidestrconsts.dlgpropertycompletion
|
||||
msgid "Property completion"
|
||||
msgstr "Tulajdonság kiegészítés"
|
||||
msgstr "Tulajdonságok kiegészítése"
|
||||
|
||||
#: lazarusidestrconsts.dlgpropnamecolor
|
||||
msgid "Property Name"
|
||||
@ -3017,7 +3019,7 @@ msgstr "Rácshoz igazítás"
|
||||
|
||||
#: lazarusidestrconsts.dlgreallydeletedesktop
|
||||
msgid "Really delete desktop \"%s\"?"
|
||||
msgstr ""
|
||||
msgstr "Valóban törölhető a(z) \"%s\" felület?"
|
||||
|
||||
#: lazarusidestrconsts.dlgreferencecolor
|
||||
msgid "Reference"
|
||||
@ -3029,7 +3031,7 @@ msgstr "Reguláris kifejerések"
|
||||
|
||||
#: lazarusidestrconsts.dlgrenamedesktop
|
||||
msgid "Rename desktop"
|
||||
msgstr ""
|
||||
msgstr "Felület átnevezése"
|
||||
|
||||
#: lazarusidestrconsts.dlgreplaceall
|
||||
msgid "Replace &All"
|
||||
@ -3103,7 +3105,7 @@ msgstr "Futtatási paraméterek"
|
||||
|
||||
#: lazarusidestrconsts.dlgsavecurrentdesktop
|
||||
msgid "Save current desktop"
|
||||
msgstr ""
|
||||
msgstr "A jelenlegi felület mentése"
|
||||
|
||||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||||
msgid "Saved line"
|
||||
@ -3172,7 +3174,7 @@ msgstr "Az összes gyermek-vezérlő kijelölése a szülővel együtt."
|
||||
|
||||
#: lazarusidestrconsts.dlgselecteddesktop
|
||||
msgid "Selected desktop:"
|
||||
msgstr ""
|
||||
msgstr "Kiválasztott velület:"
|
||||
|
||||
#: lazarusidestrconsts.dlgselectedtext
|
||||
msgid "&Selected text"
|
||||
@ -3420,7 +3422,7 @@ msgstr "Keresendő szöveg"
|
||||
|
||||
#: lazarusidestrconsts.dlgtoggleselecteddebugdesktop
|
||||
msgid "Toggle as debug desktop"
|
||||
msgstr ""
|
||||
msgstr "Hibakereső felület ki-/bekapcsolása"
|
||||
|
||||
#: lazarusidestrconsts.dlgtopinfohint
|
||||
msgid "Current Class/Proc Hint"
|
||||
@ -3610,11 +3612,11 @@ msgstr "Tükrözés függőlegesen"
|
||||
|
||||
#: lazarusidestrconsts.fdmorderbackone
|
||||
msgid "Back One"
|
||||
msgstr "Egyet hátra"
|
||||
msgstr "Hátrább eggyel"
|
||||
|
||||
#: lazarusidestrconsts.fdmorderforwardone
|
||||
msgid "Forward One"
|
||||
msgstr "Egyet előre"
|
||||
msgstr "Előbbre eggyel"
|
||||
|
||||
#: lazarusidestrconsts.fdmordermovetoback
|
||||
msgid "Move to Back"
|
||||
@ -3846,7 +3848,7 @@ msgstr "Nem található csomag a(z) \"%s\" függőséghez.%sVálasszon egy léte
|
||||
|
||||
#: lazarusidestrconsts.lisa2ppackageorproject
|
||||
msgid "Package/Project"
|
||||
msgstr ""
|
||||
msgstr "Csomag/Projekt"
|
||||
|
||||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||||
msgid "Page Name too long"
|
||||
@ -3977,7 +3979,6 @@ msgid "Abandon changes?"
|
||||
msgstr "Változások elvetése?"
|
||||
|
||||
#: lazarusidestrconsts.lisabort
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.lisabort"
|
||||
msgid "Abort"
|
||||
msgstr "Megszakítás"
|
||||
@ -4594,7 +4595,6 @@ msgid "Border space"
|
||||
msgstr "Keret-térköz"
|
||||
|
||||
#: lazarusidestrconsts.lisbottom
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.lisbottom"
|
||||
msgid "Bottom"
|
||||
msgstr "Lent"
|
||||
@ -4711,7 +4711,7 @@ msgstr "A Lazarus építése nem sikerült"
|
||||
|
||||
#: lazarusidestrconsts.lisbuildmode
|
||||
msgid "Build Mode: %s"
|
||||
msgstr ""
|
||||
msgstr "Építési mód: %s"
|
||||
|
||||
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
||||
msgid "Differences between build modes"
|
||||
@ -5378,7 +5378,7 @@ msgstr "%s Ellenőrizze a célt (OS, CPU, LCL vezérlőkészlet típusa)! Talán
|
||||
|
||||
#: lazarusidestrconsts.lischeckuncheckall
|
||||
msgid "Check/uncheck all"
|
||||
msgstr ""
|
||||
msgstr "Minden/Semmi kijelölése"
|
||||
|
||||
#: lazarusidestrconsts.lischooseadifferentname
|
||||
msgid "Choose a different name"
|
||||
@ -5442,7 +5442,7 @@ msgstr "Válasszon könyvtárat!"
|
||||
|
||||
#: lazarusidestrconsts.lischooseexecutable
|
||||
msgid "Choose an executable"
|
||||
msgstr ""
|
||||
msgstr "Válasszon egy programot!"
|
||||
|
||||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||||
msgid "Choose FPC source directory"
|
||||
@ -5671,7 +5671,7 @@ msgstr "Lapok"
|
||||
|
||||
#: lazarusidestrconsts.liscmppalettevisible
|
||||
msgid "Palette is &visible"
|
||||
msgstr ""
|
||||
msgstr "A paletta látható"
|
||||
|
||||
#: lazarusidestrconsts.liscmprestoredefaults
|
||||
msgid "&Restore defaults"
|
||||
@ -5821,7 +5821,7 @@ msgstr "Konstansok kihagyása a következő függvényekben"
|
||||
#: lazarusidestrconsts.liscodeobscharconst
|
||||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||||
msgid "Search for unnamed char constants"
|
||||
msgstr "Meg nem nevezett karakter konstansok megkeresése"
|
||||
msgstr "Névtelen karakter konstansok megkeresése"
|
||||
|
||||
#: lazarusidestrconsts.liscodeobserver
|
||||
msgid "Code Observer"
|
||||
@ -6453,7 +6453,7 @@ msgstr "\"Lazarus építés\" beállítása"
|
||||
|
||||
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
||||
msgid "Configure Toolbar"
|
||||
msgstr ""
|
||||
msgstr "Eszköztár beállítása"
|
||||
|
||||
#: lazarusidestrconsts.lisconfigurelazaruside
|
||||
msgid "Configure Lazarus IDE"
|
||||
@ -7203,7 +7203,7 @@ msgstr "Először hozzon létre projektet!"
|
||||
|
||||
#: lazarusidestrconsts.liscreatedebugandreleasemodesnewproj
|
||||
msgid "Create Debug and Release modes for new projects"
|
||||
msgstr ""
|
||||
msgstr "Hibakereső és kiadási módok létrehozása új projektekhez"
|
||||
|
||||
#: lazarusidestrconsts.liscreatedirectory
|
||||
msgid "Create directory?"
|
||||
@ -7243,7 +7243,7 @@ msgstr "Új csomag-komponens létrehozása"
|
||||
|
||||
#: lazarusidestrconsts.liscreatenowforthisproject
|
||||
msgid "Create now for this project"
|
||||
msgstr ""
|
||||
msgstr "Létrehozás e projekthez most"
|
||||
|
||||
#: lazarusidestrconsts.liscreateproject
|
||||
msgid "Create project"
|
||||
@ -7462,7 +7462,7 @@ msgstr "Alapértelmezett szín"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||||
msgid "Exception Raised"
|
||||
msgstr "Kivétel Keletkezett"
|
||||
msgstr "Kivétel keletkezett"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||||
msgid "Module Load"
|
||||
@ -7494,11 +7494,11 @@ msgstr "Szál indítása"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||||
msgid "Windows Message Posted"
|
||||
msgstr "Windows üzenet küldése"
|
||||
msgstr "Küldött Windows üzenet"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||||
msgid "Windows Message Sent"
|
||||
msgstr "Küldött Windows üzenet"
|
||||
msgstr "Windows üzenet elküldve"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgitemdeletehint
|
||||
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
||||
@ -7859,7 +7859,7 @@ msgstr "A \"tervezési\" csomagok komponenseket és menübejegyzéseket adnak az
|
||||
|
||||
#: lazarusidestrconsts.lisdesktops
|
||||
msgid "Desktops ..."
|
||||
msgstr ""
|
||||
msgstr "Felületek ..."
|
||||
|
||||
#: lazarusidestrconsts.lisdestinationdirectory
|
||||
msgid "Destination directory"
|
||||
@ -8083,7 +8083,6 @@ msgid "Import ..."
|
||||
msgstr "Importálás ..."
|
||||
|
||||
#: lazarusidestrconsts.lisdlgmore
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.lisdlgmore"
|
||||
msgid "More ..."
|
||||
msgstr "Továbbiak ..."
|
||||
@ -8169,15 +8168,15 @@ msgstr "Kijelölt komponensek kivágása a vágólapra"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgorderbackone
|
||||
msgid "Move component one back"
|
||||
msgstr "Komponens eggyel hátra"
|
||||
msgstr "Komponens mozgatása eggyel hátrább"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||||
msgid "Move component one forward"
|
||||
msgstr "Komponens eggyel előre"
|
||||
msgstr "Komponens mozgatása eggyel előbbre"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||||
msgid "Move component to back"
|
||||
msgstr "Komponens háttérbe rakása"
|
||||
msgstr "Komponens háttérbe küldése"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||||
msgid "Move component to front"
|
||||
@ -8266,15 +8265,15 @@ msgstr "Szerkesztő makrók"
|
||||
|
||||
#: lazarusidestrconsts.liseditortoolbar
|
||||
msgid "Editor ToolBar"
|
||||
msgstr ""
|
||||
msgstr "Szerkesztő eszköztára"
|
||||
|
||||
#: lazarusidestrconsts.liseditortoolbarhint
|
||||
msgid "You may add here your favorite commands"
|
||||
msgstr ""
|
||||
msgstr "Itt adhatja hozzá kedvenc parancsait"
|
||||
|
||||
#: lazarusidestrconsts.liseditortoolbarvisible
|
||||
msgid "EditorToolbar is &visible"
|
||||
msgstr ""
|
||||
msgstr "A szerkesztő eszköztára látható"
|
||||
|
||||
#: lazarusidestrconsts.lisedoptsloadascheme
|
||||
msgid "Load a scheme"
|
||||
@ -8714,7 +8713,7 @@ msgstr "Példák:%sAzonosító%sTMyEnum.Enum%sUnitnév.Azonosító%s#Csomagnév.
|
||||
|
||||
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
||||
msgid "Open first selected"
|
||||
msgstr "Első kijelölt megynitása"
|
||||
msgstr "Első kijelölt megnyitása"
|
||||
|
||||
#: lazarusidestrconsts.lisexceptiondialog
|
||||
msgid "Debugger Exception Notification"
|
||||
@ -8789,7 +8788,7 @@ msgstr "Minden elem exportálása fájlba"
|
||||
#: lazarusidestrconsts.lisexportenvironmentoptions
|
||||
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
||||
msgid "Export environment options"
|
||||
msgstr ""
|
||||
msgstr "Környezet beállításainak exportálása"
|
||||
|
||||
#: lazarusidestrconsts.lisexporthtml
|
||||
msgid "Export as HTML"
|
||||
@ -8797,7 +8796,7 @@ msgstr "Exportálás HTML-ként"
|
||||
|
||||
#: lazarusidestrconsts.lisexportimport
|
||||
msgid "Export / Import"
|
||||
msgstr ""
|
||||
msgstr "Exportálás / Importálás"
|
||||
|
||||
#: lazarusidestrconsts.lisexportlist
|
||||
msgid "Export list"
|
||||
@ -9386,7 +9385,7 @@ msgstr "Ugrás adott sorra"
|
||||
|
||||
#: lazarusidestrconsts.lisgotoselected
|
||||
msgid "Goto selected"
|
||||
msgstr ""
|
||||
msgstr "Ugrás a kijelöltre"
|
||||
|
||||
#: lazarusidestrconsts.lisgplnotice
|
||||
msgid ""
|
||||
@ -9603,11 +9602,11 @@ msgstr "ID"
|
||||
|
||||
#: lazarusidestrconsts.lisidcaddition
|
||||
msgid "Addition"
|
||||
msgstr ""
|
||||
msgstr "Kiegészítés"
|
||||
|
||||
#: lazarusidestrconsts.lisidcopening
|
||||
msgid "Opening"
|
||||
msgstr ""
|
||||
msgstr "Megnyitás"
|
||||
|
||||
#: lazarusidestrconsts.liside
|
||||
msgid "IDE"
|
||||
@ -9742,7 +9741,6 @@ msgid "If you want to use two different Lazarus versions you must start the seco
|
||||
msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%sPéldául:"
|
||||
|
||||
#: lazarusidestrconsts.lisignore
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.lisignore"
|
||||
msgid "Ignore"
|
||||
msgstr "Kihagyás"
|
||||
@ -9788,7 +9786,7 @@ msgstr "Fontos"
|
||||
#: lazarusidestrconsts.lisimportenvironmentoptions
|
||||
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
||||
msgid "Import environment options"
|
||||
msgstr ""
|
||||
msgstr "Környezet beállításainak importálása"
|
||||
|
||||
#: lazarusidestrconsts.lisimportfromfile
|
||||
msgid "Import from File"
|
||||
@ -10056,11 +10054,11 @@ msgstr "Érvénytelen törlés"
|
||||
|
||||
#: lazarusidestrconsts.lisinvalidexecutable
|
||||
msgid "Invalid Executable"
|
||||
msgstr ""
|
||||
msgstr "Érvénytelen futtatható állomány"
|
||||
|
||||
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
||||
msgid "The file \"%s\" is not executable."
|
||||
msgstr ""
|
||||
msgstr "A(z) \"%s\" fájl nem futtatható állomány."
|
||||
|
||||
#: lazarusidestrconsts.lisinvalidexpression
|
||||
msgid "Invalid expression:%s%s%s%s"
|
||||
@ -10164,11 +10162,11 @@ msgstr "Kiadások"
|
||||
|
||||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||||
msgid "I wonder how you did that. Error in the %s:"
|
||||
msgstr "Hát, ez nagyon furcsa. Hiba itt: %s:"
|
||||
msgstr "Nahát, ez nagyon furcsa. Hiba itt: %s:"
|
||||
|
||||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||||
msgid "I wonder how you did that: Error in the base directory:"
|
||||
msgstr "Hát, ez nagyon furcsa: Hiba az alapkönyvtárban:"
|
||||
msgstr "Nahát, ez nagyon furcsa: Hiba az alapkönyvtárban:"
|
||||
|
||||
#: lazarusidestrconsts.lisjhjumphistory
|
||||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||||
@ -10177,11 +10175,11 @@ msgstr "Ugrási előzmények"
|
||||
|
||||
#: lazarusidestrconsts.lisjumptoerror
|
||||
msgid "Jump to error"
|
||||
msgstr ""
|
||||
msgstr "Ugrás a hibára"
|
||||
|
||||
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
||||
msgid "When an error in the sources is found at identifier completion, jump to it."
|
||||
msgstr ""
|
||||
msgstr "Ha egy azonosító kiegészítésekor hiba kerül elő a forrásban, ugrás oda."
|
||||
|
||||
#: lazarusidestrconsts.lisjumptoprocedure
|
||||
msgid "Jump to procedure %s"
|
||||
@ -11463,7 +11461,7 @@ msgstr "Sz&erkesztés"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||||
msgid "Code Templates ..."
|
||||
msgstr "Kód sablonok ..."
|
||||
msgstr "Kódsablonok ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||||
msgid "Edit context sensitive Help"
|
||||
@ -11531,11 +11529,11 @@ msgstr "Válasszon menüt:"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditorselecttemplate
|
||||
msgid "Select Template:"
|
||||
msgstr "Válasszon sablont:"
|
||||
msgstr "Sablon választása:"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditortemplatepreview
|
||||
msgid "Template Preview"
|
||||
msgstr "Sablon előnézet"
|
||||
msgstr "Sablon előnézete"
|
||||
|
||||
#: lazarusidestrconsts.lismenuencloseinifdef
|
||||
msgid "Enclose in $IFDEF ..."
|
||||
@ -11588,7 +11586,7 @@ msgstr "Azonosító hivatkozásainak megkeresése ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenufindinfiles
|
||||
msgid "Find &in Files ..."
|
||||
msgstr "Keresés fájlokban ..."
|
||||
msgstr "Keresés a fájlokban ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenufindnext
|
||||
msgid "Find &Next"
|
||||
@ -11829,7 +11827,7 @@ msgstr "Projekt megnyitása ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenuopenrecent
|
||||
msgid "Open &Recent"
|
||||
msgstr "Legutóbbi megynyitása"
|
||||
msgstr "Legutóbbi megnyitása"
|
||||
|
||||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||||
msgid "Open Recent Package"
|
||||
@ -14573,7 +14571,7 @@ msgstr "Az .lpi a projekt fő információs fájlja, az .lps egy különálló f
|
||||
|
||||
#: lazarusidestrconsts.lisposition
|
||||
msgid "Position"
|
||||
msgstr ""
|
||||
msgstr "Elhelyezés"
|
||||
|
||||
#: lazarusidestrconsts.lispositionoutsideofsource
|
||||
msgid "%s (position outside of source)"
|
||||
@ -15781,7 +15779,7 @@ msgstr "Üres unit-ok/csomagok megjelenítése"
|
||||
|
||||
#: lazarusidestrconsts.lisshowglyphsfor
|
||||
msgid "Show Glyphs for"
|
||||
msgstr "Ikonok megjelenítése:"
|
||||
msgstr "Ikonok megjelenítése"
|
||||
|
||||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||||
msgid "Show gutter"
|
||||
@ -15826,7 +15824,7 @@ msgstr "Csomagok megjelenítése"
|
||||
|
||||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||||
msgid "Show position of source editor"
|
||||
msgstr "Váltás a forráskódbeli helyére"
|
||||
msgstr "Váltás a forráskódbeli helyzetére"
|
||||
|
||||
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
||||
msgid "Show recently used identifiers at top"
|
||||
@ -15942,7 +15940,7 @@ msgstr "Rendezés hatókör alapján"
|
||||
|
||||
#: lazarusidestrconsts.lissorting
|
||||
msgid "Sorting"
|
||||
msgstr ""
|
||||
msgstr "Rendezés"
|
||||
|
||||
#: lazarusidestrconsts.lissortselascending
|
||||
msgid "Ascending"
|
||||
@ -16269,7 +16267,7 @@ msgstr "Szerkeszthető cella beszúrása. A cellák között a TAB billenytűvel
|
||||
|
||||
#: lazarusidestrconsts.listemplatefile
|
||||
msgid "Template file"
|
||||
msgstr "Sablon fájl"
|
||||
msgstr "Sablonfájl"
|
||||
|
||||
#: lazarusidestrconsts.listestdirectory
|
||||
msgid "Test directory"
|
||||
@ -16871,7 +16869,7 @@ msgstr "Cím (üres = alapértelmezett)"
|
||||
|
||||
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
||||
msgid "Choose a component icon 24x24"
|
||||
msgstr ""
|
||||
msgstr "Ikon választása a komponenshez (24x24)"
|
||||
|
||||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||||
msgid "Function: append path delimiter"
|
||||
@ -16962,7 +16960,6 @@ msgid "tool stopped with exit code %s. Use context menu to get more information.
|
||||
msgstr "az eszköz kilépési kóddal állt le: %s. A helyi menüből további információ érhető el."
|
||||
|
||||
#: lazarusidestrconsts.listop
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.listop"
|
||||
msgid "Top"
|
||||
msgstr "Fent"
|
||||
@ -18049,7 +18046,7 @@ msgstr "XML elemző hiba a(z) %s%s fájlban. Hiba: %s"
|
||||
|
||||
#: lazarusidestrconsts.lisyes
|
||||
msgid "Yes"
|
||||
msgstr ""
|
||||
msgstr "Igen"
|
||||
|
||||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
||||
msgid "You can disable this for individual forms via the package editor"
|
||||
@ -18511,11 +18508,11 @@ msgstr "Egyidejű szerkesztés (kijelölés közben)"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattemplateedit
|
||||
msgid "Template Editing"
|
||||
msgstr "Sablon szerkesztés"
|
||||
msgstr "Sablon szerkesztése"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||||
msgid "Template Editing (not in Cell)"
|
||||
msgstr "Sablon szerkesztés (kurzor cellán kívül)"
|
||||
msgstr "Sablon szerkesztése (kurzor cellán kívül)"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattoolmenu
|
||||
msgid "Tools menu commands"
|
||||
@ -18568,7 +18565,7 @@ msgstr "Csatolás programhoz "
|
||||
|
||||
#: lazarusidestrconsts.srkmecautocompletion
|
||||
msgid "Code template completion"
|
||||
msgstr "Kód sablon kiegészítés"
|
||||
msgstr "Kódsablon kiegészítése"
|
||||
|
||||
#: lazarusidestrconsts.srkmecblockcopy
|
||||
msgid "Copy Block"
|
||||
@ -18847,7 +18844,7 @@ msgstr "Azonosító hivatkozásainak megkeresése"
|
||||
|
||||
#: lazarusidestrconsts.srkmecfindinfiles
|
||||
msgid "Find in Files"
|
||||
msgstr "Keresés fájlokban"
|
||||
msgstr "Keresés a fájlokban"
|
||||
|
||||
#: lazarusidestrconsts.srkmecfindnext
|
||||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||||
@ -19032,13 +19029,11 @@ msgid "Invert Assignment"
|
||||
msgstr "Hozzárendelés megfordítása"
|
||||
|
||||
#: lazarusidestrconsts.srkmeckeymapleft
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
||||
msgid "Left"
|
||||
msgstr "Balra"
|
||||
|
||||
#: lazarusidestrconsts.srkmeckeymapright
|
||||
#, fuzzy
|
||||
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
||||
msgid "Right"
|
||||
msgstr "Jobbra"
|
||||
|
||||
@ -188,8 +188,6 @@ msgid "Save SQL statement to file"
|
||||
msgstr "SQL állomány mentése fájlba"
|
||||
|
||||
#: lazdatadeskstr.simportdictinto
|
||||
#, fuzzy
|
||||
#| msgid "Import datadictionary"
|
||||
msgid "Import data dictionary"
|
||||
msgstr "Adatszótár importálása"
|
||||
|
||||
@ -215,11 +213,11 @@ msgstr "Külső kulcs hozzáadása a táblához"
|
||||
|
||||
#: lazdatadeskstr.sld_actionaddsequence
|
||||
msgid "New sequence"
|
||||
msgstr "Új sorrend"
|
||||
msgstr "Új sorozat"
|
||||
|
||||
#: lazdatadeskstr.sld_actionaddsequenceh
|
||||
msgid "Add a sequence"
|
||||
msgstr "Sorrend hozzáadása"
|
||||
msgstr "Sorozat hozzáadása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionclose
|
||||
msgid "&Close"
|
||||
@ -348,15 +346,13 @@ msgstr "A kiválasztott legutóbbi kapcsolat megnyitása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionopenh
|
||||
msgid "Open a new Data Dictionary"
|
||||
msgstr "Új adatszótár megnyitása"
|
||||
msgstr "Egy új adatszótár megnyitása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionopenrecentdatadict
|
||||
msgid "Open"
|
||||
msgstr "Megnyitás"
|
||||
|
||||
#: lazdatadeskstr.sld_actionopenrecentdatadicth
|
||||
#, fuzzy
|
||||
#| msgid "Open selected recent datadictionary"
|
||||
msgid "Open selected recent data dictionary"
|
||||
msgstr "A kiválasztott legutóbbi adatszótár megnyitása"
|
||||
|
||||
@ -377,8 +373,6 @@ msgid "Save &as"
|
||||
msgstr "Mentés másként"
|
||||
|
||||
#: lazdatadeskstr.sld_actionsaveash
|
||||
#, fuzzy
|
||||
#| msgid "Save datadictionary as"
|
||||
msgid "Save data dictionary as"
|
||||
msgstr "Adatszótár mentése másként"
|
||||
|
||||
@ -405,7 +399,7 @@ msgstr "Meghajtó"
|
||||
|
||||
#: lazdatadeskstr.sld_connectionlv3
|
||||
msgid "Last used"
|
||||
msgstr "Legutóbb használt"
|
||||
msgstr "Utolsó használat"
|
||||
|
||||
#: lazdatadeskstr.sld_connectionlv4
|
||||
msgctxt "lazdatadeskstr.sld_connectionlv4"
|
||||
@ -460,8 +454,6 @@ msgid "Host"
|
||||
msgstr "Kiszolgáló"
|
||||
|
||||
#: lazdatadeskstr.sld_importupdatedatadictionary
|
||||
#, fuzzy
|
||||
#| msgid "Import/Update datadictionary"
|
||||
msgid "Import/Update data dictionary"
|
||||
msgstr "Adatszótár importálása/frissítése"
|
||||
|
||||
@ -539,7 +531,7 @@ msgstr "Fájlnév"
|
||||
|
||||
#: lazdatadeskstr.sld_recentlv3
|
||||
msgid "Last used on"
|
||||
msgstr "Utolsó használat:"
|
||||
msgstr "Utolsó használat"
|
||||
|
||||
#: lazdatadeskstr.sld_savefileasfilter
|
||||
msgctxt "lazdatadeskstr.sld_savefileasfilter"
|
||||
@ -611,10 +603,8 @@ msgid "New connection"
|
||||
msgstr "Ú&j kapcsolat"
|
||||
|
||||
#: lazdatadeskstr.snewdictionary
|
||||
#, fuzzy
|
||||
#| msgid "New database"
|
||||
msgid "New data dictionary"
|
||||
msgstr "Új adatbázis"
|
||||
msgstr "Új adatszótár"
|
||||
|
||||
#: lazdatadeskstr.snewdomain
|
||||
msgid "Create new domain"
|
||||
@ -654,7 +644,7 @@ msgstr "Új %s létrehozása"
|
||||
|
||||
#: lazdatadeskstr.snewsequence
|
||||
msgid "Create new sequence"
|
||||
msgstr "Új sorozat étrehozása"
|
||||
msgstr "Új sorozat létrehozása"
|
||||
|
||||
#: lazdatadeskstr.snewsequencename
|
||||
msgid "Enter a name for the new sequence:"
|
||||
@ -678,8 +668,6 @@ msgid "Database"
|
||||
msgstr "Adatbázis"
|
||||
|
||||
#: lazdatadeskstr.snodedatadictionary
|
||||
#, fuzzy
|
||||
#| msgid "Datadictionary"
|
||||
msgid "Data dictionary"
|
||||
msgstr "Adatszótár"
|
||||
|
||||
@ -710,7 +698,7 @@ msgstr "Index beállítások:"
|
||||
|
||||
#: lazdatadeskstr.snodesequences
|
||||
msgid "Sequences"
|
||||
msgstr "Sorrendek"
|
||||
msgstr "Sorozatok"
|
||||
|
||||
#: lazdatadeskstr.snodetabledata
|
||||
msgid "Table Data"
|
||||
@ -750,7 +738,7 @@ msgstr "Változások mentése"
|
||||
|
||||
#: lazdatadeskstr.sselectdbfdir
|
||||
msgid "Select a directory with DBF files"
|
||||
msgstr "Válasszon könyvtárat a DBF fájlok számára!"
|
||||
msgstr "Könyvtár választása a DBF fájlok számára"
|
||||
|
||||
#: lazdatadeskstr.sselectedobject
|
||||
msgid "Selected object"
|
||||
@ -758,7 +746,7 @@ msgstr "Kiválasztott objektum"
|
||||
|
||||
#: lazdatadeskstr.ssequence
|
||||
msgid "Sequence"
|
||||
msgstr "Sorrend"
|
||||
msgstr "Sorozat"
|
||||
|
||||
#: lazdatadeskstr.ssqlfilters
|
||||
msgid "SQL files|*.sql|All files|*.*"
|
||||
@ -778,7 +766,7 @@ msgstr "Ismeretlen adatszótár: %s"
|
||||
|
||||
#: lazdatadeskstr.susecurrentdict
|
||||
msgid "Yes, use the active dictionary"
|
||||
msgstr "Igen, az aktív szótáratt használva"
|
||||
msgstr "Igen, az aktív szótárat használva"
|
||||
|
||||
#: lazdatadeskstr.susenewdict
|
||||
msgid "No, import in a new dictionary"
|
||||
|
||||
Loading…
Reference in New Issue
Block a user