Translations: Hungarian translation update by Péter Gábor, bug #28543

git-svn-id: trunk@49693 -
This commit is contained in:
maxim 2015-08-19 21:54:50 +00:00
parent a4bea16efc
commit b77c1d45bc
9 changed files with 187 additions and 210 deletions

View File

@ -13,7 +13,7 @@ msgstr ""
#: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho #: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho
msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\"" msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\""
msgstr "Egy elválasztó szabad oldalát nem lehet lehorgonyozni: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\"" msgstr "Egy elválasztó szabad oldala nem rögzíthető: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\""
#: anchordockstr.adrsallfiles #: anchordockstr.adrsallfiles
msgid "All files" msgid "All files"
@ -25,23 +25,23 @@ msgstr "Ennyi képpontot kell mozdulnia az egérnek mielőtt a húzás elkezdőd
#: anchordockstr.adrsanchordockinglayout #: anchordockstr.adrsanchordockinglayout
msgid "Anchor Docking Layout" msgid "Anchor Docking Layout"
msgstr "Lehorgonyzás elrendezése" msgstr "Rögzített ablakelrendezés"
#: anchordockstr.adrsanchorisnotsplitternodeanchors #: anchordockstr.adrsanchorisnotsplitternodeanchors
msgid "Anchor is not splitter: Node=\"%s\" Anchors[%s]=\"%s\"" msgid "Anchor is not splitter: Node=\"%s\" Anchors[%s]=\"%s\""
msgstr "A horgony nem elválasztó: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" msgstr "Rögzítés nem elválasztóhoz: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
#: anchordockstr.adrsanchornotfoundnodeanchors #: anchordockstr.adrsanchornotfoundnodeanchors
msgid "Anchor not found: Node=\"%s\" Anchors[%s]=\"%s\"" msgid "Anchor not found: Node=\"%s\" Anchors[%s]=\"%s\""
msgstr "Horgonyzás nincs engedélyezve: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" msgstr "Rögzítési hely nem található: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
#: anchordockstr.adrsanchortowrongsideofsplitternodeanchors #: anchordockstr.adrsanchortowrongsideofsplitternodeanchors
msgid "Anchor to wrong side of splitter: Node=\"%s\" Anchors[%s]=\"%s\"" msgid "Anchor to wrong side of splitter: Node=\"%s\" Anchors[%s]=\"%s\""
msgstr "Horgonyzás az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" msgstr "Rögzítés az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
#: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors #: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors
msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\"" msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\""
msgstr "Egy lapot nem lehet lehorgonyozni: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\"" msgstr "Egy lap nem rögzíthető: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\""
#: anchordockstr.adrsautomatically #: anchordockstr.adrsautomatically
msgid "Automatically" msgid "Automatically"
@ -65,7 +65,7 @@ msgstr "Az \"%s\" dokkterület csak egy területet tartalmazhat."
#: anchordockstr.adrsdockinganchordocking #: anchordockstr.adrsdockinganchordocking
msgid "Docking / Anchordocking" msgid "Docking / Anchordocking"
msgstr "Dokkolás / Lehorgonyzás" msgstr "Dokkolás / Ablakok rögzítése"
#: anchordockstr.adrsdockingoptions #: anchordockstr.adrsdockingoptions
msgid "Docking options" msgid "Docking options"
@ -289,7 +289,7 @@ msgstr "fel"
#: anchordockstr.adrstouseanchordockingyoumustfirstuninstall #: anchordockstr.adrstouseanchordockingyoumustfirstuninstall
msgid "To use anchordocking you must first uninstall %s" msgid "To use anchordocking you must first uninstall %s"
msgstr "A lehorgonyzás használatához először el kell távolítani ezt: %s" msgstr "Az ablakok rögzítésének használatához először el kell távolítani ezt: %s"
#: anchordockstr.adrsundock #: anchordockstr.adrsundock
msgid "Undock" msgid "Undock"

View File

@ -431,7 +431,7 @@ msgstr "Hibás"
#: codetoolsstrconsts.ctshelperisnotallowed #: codetoolsstrconsts.ctshelperisnotallowed
msgid "Helper after %s is not allowed" msgid "Helper after %s is not allowed"
msgstr "" msgstr "A \"helper\" nem következhet %s után"
#: codetoolsstrconsts.ctsidedirectory #: codetoolsstrconsts.ctsidedirectory
msgid "IDE Directory" msgid "IDE Directory"
@ -958,4 +958,3 @@ msgstr "Vezérlőkészlet könyvtára"
#: codetoolsstrconsts.ctswordnotfound #: codetoolsstrconsts.ctswordnotfound
msgid "\"%s\" not found" msgid "\"%s\" not found"
msgstr "\"%s\" nem található" msgstr "\"%s\" nem található"

View File

@ -663,19 +663,19 @@ msgstr "Beállítások"
#: objinspstrconsts.oisorderbackone #: objinspstrconsts.oisorderbackone
msgid "Back One" msgid "Back One"
msgstr "Egyet hátra" msgstr "Hátrább eggyel"
#: objinspstrconsts.oisorderforwardone #: objinspstrconsts.oisorderforwardone
msgid "Forward One" msgid "Forward One"
msgstr "Egyet előre" msgstr "Előbbre eggyel"
#: objinspstrconsts.oisordermovetoback #: objinspstrconsts.oisordermovetoback
msgid "Move to Back" msgid "Move to Back"
msgstr "Háttérbe visz" msgstr "Háttérbe"
#: objinspstrconsts.oisordermovetofront #: objinspstrconsts.oisordermovetofront
msgid "Move to Front" msgid "Move to Front"
msgstr "Előtérbe hoz" msgstr "Előtérbe"
#: objinspstrconsts.oispastecomponents #: objinspstrconsts.oispastecomponents
msgctxt "objinspstrconsts.oispastecomponents" msgctxt "objinspstrconsts.oispastecomponents"

View File

@ -178,7 +178,7 @@ msgstr "Kód"
#: lr_const.sbarcodeformdbfld #: lr_const.sbarcodeformdbfld
msgctxt "lr_const.sbarcodeformdbfld" msgctxt "lr_const.sbarcodeformdbfld"
msgid "Insert DB field" msgid "Insert DB field"
msgstr "Adatbázis-mező beszúrása" msgstr "Adatbázismező beszúrása"
#: lr_const.sbarcodeformopts #: lr_const.sbarcodeformopts
msgctxt "lr_const.sbarcodeformopts" msgctxt "lr_const.sbarcodeformopts"
@ -681,7 +681,7 @@ msgstr "Elérhető adatbázisok"
#: lr_const.sfieldsforminsert #: lr_const.sfieldsforminsert
msgctxt "lr_const.sfieldsforminsert" msgctxt "lr_const.sfieldsforminsert"
msgid "Insert DB field" msgid "Insert DB field"
msgstr "Adatbázis-mező beszúrása" msgstr "Adatbázismező beszúrása"
#: lr_const.sfilenotfound #: lr_const.sfilenotfound
msgid "File not found" msgid "File not found"
@ -903,7 +903,7 @@ msgstr "Teljes keret"
#: lr_const.sfrdesignerformback #: lr_const.sfrdesignerformback
msgid "Send to back" msgid "Send to back"
msgstr "Háttérbeküldés" msgstr "Háttérbe helyezés"
#: lr_const.sfrdesignerformbackcolor #: lr_const.sfrdesignerformbackcolor
msgid "Background color" msgid "Background color"
@ -923,7 +923,7 @@ msgstr "Alsó keretvonal"
#: lr_const.sfrdesignerformbring #: lr_const.sfrdesignerformbring
msgid "Bring to front" msgid "Bring to front"
msgstr "Előtérbehozás" msgstr "Előtérbe helyezés"
#: lr_const.sfrdesignerformcapt #: lr_const.sfrdesignerformcapt
msgctxt "lr_const.sfrdesignerformcapt" msgctxt "lr_const.sfrdesignerformcapt"
@ -1164,7 +1164,7 @@ msgstr "Igazítás"
#: lr_const.sfrdesignerform_back #: lr_const.sfrdesignerform_back
msgid "Send to &back" msgid "Send to &back"
msgstr "Háttérbeküldés" msgstr "Háttérbe helyezés"
#: lr_const.sfrdesignerform_beforeprintscript #: lr_const.sfrdesignerform_beforeprintscript
msgid "&Before print script ..." msgid "&Before print script ..."
@ -1172,7 +1172,7 @@ msgstr "Nyomtatás előtti szkript ..."
#: lr_const.sfrdesignerform_bring #: lr_const.sfrdesignerform_bring
msgid "Bring to &front" msgid "Bring to &front"
msgstr "Előtérbehozás " msgstr "Előtérbe helyezés"
#: lr_const.sfrdesignerform_copy #: lr_const.sfrdesignerform_copy
msgid "&Copy" msgid "&Copy"
@ -1362,7 +1362,7 @@ msgstr "Nyújtás"
#: lr_const.sgroupeditorformadddbfield #: lr_const.sgroupeditorformadddbfield
msgctxt "lr_const.sgroupeditorformadddbfield" msgctxt "lr_const.sgroupeditorformadddbfield"
msgid "Insert DB field" msgid "Insert DB field"
msgstr "Adatbázis-mező beszúrása" msgstr "Adatbázismező beszúrása"
#: lr_const.sgroupeditorformcapt #: lr_const.sgroupeditorformcapt
msgid "Group" msgid "Group"
@ -1453,7 +1453,7 @@ msgstr "Kifejezés beszúrása"
#: lr_const.sinsertfields #: lr_const.sinsertfields
msgid "Insert DB fields" msgid "Insert DB fields"
msgstr "Adatbázismező beszúrása" msgstr "Adatbázismezők beszúrása"
#: lr_const.sinsertfieldsformaviabledset #: lr_const.sinsertfieldsformaviabledset
msgid "&Available datasets" msgid "&Available datasets"

View File

@ -48,14 +48,12 @@ msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer"
msgstr "Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet megjelenítő" msgstr "Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet megjelenítő"
#: heaptrcview.sfrmselectfilewithdebuginfo #: heaptrcview.sfrmselectfilewithdebuginfo
#, fuzzy
#| msgid "Select File with debug info"
msgid "Select file with debug info" msgid "Select file with debug info"
msgstr "Válasszon fájlt hibakeresési infókkal!" msgstr "Hibakeresési infókat tartalmazó fájl választása"
#: heaptrcview.sfrmselecttrcfile #: heaptrcview.sfrmselecttrcfile
msgid "Select file with trace log" msgid "Select file with trace log"
msgstr "" msgstr "Nyomkövetési naplót tartalmazó fájl választása"
#: heaptrcview.slbltrace #: heaptrcview.slbltrace
msgid ".trc file" msgid ".trc file"
@ -88,4 +86,3 @@ msgstr "Szivárgó memória mérete: %d"
#: heaptrcview.strtotalmemalloc #: heaptrcview.strtotalmemalloc
msgid "Total Mem allocated: %d" msgid "Total Mem allocated: %d"
msgstr "Teljes lefoglalt memória: %d" msgstr "Teljes lefoglalt memória: %d"

View File

@ -13,7 +13,7 @@ msgstr ""
#: todoliststrconsts.dlgfiltercsv #: todoliststrconsts.dlgfiltercsv
msgid "CSV files" msgid "CSV files"
msgstr "" msgstr "CSV fájlok"
#: todoliststrconsts.dlgfropts #: todoliststrconsts.dlgfropts
msgid "Options" msgid "Options"
@ -98,4 +98,3 @@ msgstr "Kategória"
#: todoliststrconsts.lisviewtodolist #: todoliststrconsts.lisviewtodolist
msgid "View ToDo List" msgid "View ToDo List"
msgstr "ToDo lista megjelenítése" msgstr "ToDo lista megjelenítése"

View File

@ -29,7 +29,7 @@ msgstr "Betöltés gyorsítótárból (%s = %s)"
#: ipconst.httpcantloadgraphic #: ipconst.httpcantloadgraphic
msgid "Unable to load graphic %s" msgid "Unable to load graphic %s"
msgstr "" msgstr "Nem lehet betölteni a grafikát: %s"
#: ipconst.httpconnect #: ipconst.httpconnect
msgid "Connected: (%s)" msgid "Connected: (%s)"
@ -113,7 +113,7 @@ msgstr "Kísérlet az írásra: "
#: ipconst.sbadframelistobject #: ipconst.sbadframelistobject
msgid "Unrecognized object of class %s in GIF Frame List" msgid "Unrecognized object of class %s in GIF Frame List"
msgstr "" msgstr "Ismeretlen %s osztályú objektum a GIF képkockalistában"
#: ipconst.sbadimagelibfileformat #: ipconst.sbadimagelibfileformat
msgid "Unrecognized file format" msgid "Unrecognized file format"
@ -141,7 +141,7 @@ msgstr "Az elérési út nem létezik"
#: ipconst.sbadseekorigin #: ipconst.sbadseekorigin
msgid "Invalid seek origin" msgid "Invalid seek origin"
msgstr "" msgstr "Érvénytelen kezdőpont a pozicionáláshoz"
#: ipconst.sbibuffernotassigned #: ipconst.sbibuffernotassigned
msgid "Buffer not assigned" msgid "Buffer not assigned"
@ -175,11 +175,11 @@ msgstr "Érvénytelen adathosszúság"
#: ipconst.sbinhexoddchar #: ipconst.sbinhexoddchar
msgid "One odd character" msgid "One odd character"
msgstr "" msgstr "Egy furcsa karakter"
#: ipconst.sbinhexresourceforkerr #: ipconst.sbinhexresourceforkerr
msgid "Resource fork present" msgid "Resource fork present"
msgstr "" msgstr "Erőforrás-elágazás"
#: ipconst.sbrokerdownloadreq #: ipconst.sbrokerdownloadreq
msgid "Download %s?" msgid "Download %s?"
@ -215,7 +215,7 @@ msgstr "%s: az új szám túl kicsi"
#: ipconst.sdestroying #: ipconst.sdestroying
msgid "Destroying" msgid "Destroying"
msgstr "" msgstr "Megsemmisítés"
#: ipconst.seventconnect #: ipconst.seventconnect
msgid "Connect: Loc: %s Rem: %s" msgid "Connect: Loc: %s Rem: %s"
@ -284,7 +284,7 @@ msgstr "Az átvitelt a felhasználó megszakította"
#: ipconst.shtmlcharstackoverfl #: ipconst.shtmlcharstackoverfl
msgid "Character stack overflow" msgid "Character stack overflow"
msgstr "" msgstr "Karakter-verem túlcsordulás"
#: ipconst.shtmldashexp #: ipconst.shtmldashexp
msgid "- expected" msgid "- expected"
@ -316,7 +316,7 @@ msgstr "Belső hiba"
#: ipconst.shtmlinvalign #: ipconst.shtmlinvalign
msgid "Invalid alignment specified" msgid "Invalid alignment specified"
msgstr "" msgstr "A megadott igazítás érvénytelen"
#: ipconst.shtmlinvcolor #: ipconst.shtmlinvcolor
msgid "Invalid color constant:" msgid "Invalid color constant:"
@ -324,15 +324,15 @@ msgstr "Érvénytelen szín-konstans:"
#: ipconst.shtmlinvdir #: ipconst.shtmlinvdir
msgid "Invalid dir value specified" msgid "Invalid dir value specified"
msgstr "" msgstr "A megadott irányérték érvénytelen"
#: ipconst.shtmlinvframe #: ipconst.shtmlinvframe
msgid "Invalid frame specified" msgid "Invalid frame specified"
msgstr "" msgstr "A megadott keret érvénytelen"
#: ipconst.shtmlinvgraphic #: ipconst.shtmlinvgraphic
msgid "Invalid graphic returned" msgid "Invalid graphic returned"
msgstr "" msgstr "A visszaadott grafikus objektum érvénytelen"
#: ipconst.shtmlinvint #: ipconst.shtmlinvint
msgid "Invalid integer constant" msgid "Invalid integer constant"
@ -340,35 +340,35 @@ msgstr "Érvénytelen egész-szám konstans"
#: ipconst.shtmlinvmethod #: ipconst.shtmlinvmethod
msgid "Invalid method specified" msgid "Invalid method specified"
msgstr "" msgstr "A megadott metódus érvénytelen"
#: ipconst.shtmlinvpicture #: ipconst.shtmlinvpicture
msgid "Invalid picture returned" msgid "Invalid picture returned"
msgstr "" msgstr "A visszaadott képobjektum érvénytelen"
#: ipconst.shtmlinvrule #: ipconst.shtmlinvrule
msgid "Invalid rule specified" msgid "Invalid rule specified"
msgstr "" msgstr "A megadott szabály érvénytelen"
#: ipconst.shtmlinvscope #: ipconst.shtmlinvscope
msgid "Invalid scope specified" msgid "Invalid scope specified"
msgstr "" msgstr "A megadott hatókör érvénytelen"
#: ipconst.shtmlinvscroll #: ipconst.shtmlinvscroll
msgid "Invalid scrolling specified" msgid "Invalid scrolling specified"
msgstr "" msgstr "A megadott görgetés érvénytelen"
#: ipconst.shtmlinvshape #: ipconst.shtmlinvshape
msgid "Invalid shape specified" msgid "Invalid shape specified"
msgstr "" msgstr "A megadott alakzat érvénytelen"
#: ipconst.shtmlinvtype #: ipconst.shtmlinvtype
msgid "Invalid type specified" msgid "Invalid type specified"
msgstr "" msgstr "A megadott típus érvénytelen"
#: ipconst.shtmlinvvaltype #: ipconst.shtmlinvvaltype
msgid "Invalid value type specified" msgid "Invalid value type specified"
msgstr "" msgstr "A megadott értéktípus érvénytelen"
#: ipconst.shtmllineerror #: ipconst.shtmllineerror
msgid "Error \"%s\" at line %d, position %d" msgid "Error \"%s\" at line %d, position %d"
@ -384,11 +384,11 @@ msgstr "OnGetImage eseménykezelő nincs hozzárendelve"
#: ipconst.shtmlnographic #: ipconst.shtmlnographic
msgid "Picture object contains no graphic object" msgid "Picture object contains no graphic object"
msgstr "" msgstr "A képobjektum nem tartalmaz grafikus elemet"
#: ipconst.shtmlnotcontainer #: ipconst.shtmlnotcontainer
msgid "Parent is not a container" msgid "Parent is not a container"
msgstr "" msgstr "A szülő nem tároló"
#: ipconst.shtmlresunavail #: ipconst.shtmlresunavail
msgid "Resource unavailable:" msgid "Resource unavailable:"
@ -532,11 +532,11 @@ msgstr "Sikerült"
#: ipconst.sipicmp_ttl_expired_reassem #: ipconst.sipicmp_ttl_expired_reassem
msgid "Time to live expired during reassembly" msgid "Time to live expired during reassembly"
msgstr "" msgstr "Élettartam lejárt az újraösszeállítás során"
#: ipconst.sipicmp_ttl_expired_transit #: ipconst.sipicmp_ttl_expired_transit
msgid "Time to live expired during transmit" msgid "Time to live expired during transmit"
msgstr "" msgstr "Élettartam lejárt az átvitel során"
#: ipconst.sipicmp_unknown #: ipconst.sipicmp_unknown
msgid "Unknown status" msgid "Unknown status"
@ -1067,11 +1067,11 @@ msgstr "Nincs címzett megadva"
#: ipconst.snoseekforread #: ipconst.snoseekforread
msgid "No seek for read" msgid "No seek for read"
msgstr "" msgstr "Nincs pozicionálás az olvasáshoz"
#: ipconst.snoseekforwrite #: ipconst.snoseekforwrite
msgid "No seek for write" msgid "No seek for write"
msgstr "" msgstr "Nincs pozicionálás az íráshoz"
#: ipconst.snosockerr #: ipconst.snosockerr
msgid "Socket not assigned" msgid "Socket not assigned"
@ -1087,7 +1087,7 @@ msgstr "Nincs elegendő adat (%s bájt) az olvasási kérés teljesítéséhez (
#: ipconst.snotimererr #: ipconst.snotimererr
msgid "Not enough system timers available" msgid "Not enough system timers available"
msgstr "" msgstr "Nincs elég elérhető rendszeridőzítő"
#: ipconst.snowinsock2err #: ipconst.snowinsock2err
msgid "%s requires WinSock 2, and this system only has WinSock 1" msgid "%s requires WinSock 2, and this system only has WinSock 1"
@ -1099,11 +1099,11 @@ msgstr "Cikk lekérése"
#: ipconst.snsauthpass #: ipconst.snsauthpass
msgid "Authorizing password" msgid "Authorizing password"
msgstr "Jelszó engedélyezése" msgstr "Engedélyező jelszó"
#: ipconst.snsauthuser #: ipconst.snsauthuser
msgid "Authorizing user" msgid "Authorizing user"
msgstr "Felhasználó engedélyezése" msgstr "Engedélyező felhasználó"
#: ipconst.snsbody #: ipconst.snsbody
msgid "Retrieving body" msgid "Retrieving body"
@ -1238,11 +1238,11 @@ msgstr "Csoport kiválasztása"
#: ipconst.soriginfrombegin #: ipconst.soriginfrombegin
msgid "When origin is soFromBeginning, Offset must be >= 0" msgid "When origin is soFromBeginning, Offset must be >= 0"
msgstr "" msgstr "Amikor a kezdőpont soFromBeginning, az eltolásnak >= 0 kell lennie"
#: ipconst.soriginfromend #: ipconst.soriginfromend
msgid "When origin is soFromEnd, Offset must be <= 0" msgid "When origin is soFromEnd, Offset must be <= 0"
msgstr "" msgstr "Amikor a kezdőpont soFromEnd, az eltolásnak <= 0 kell lennie"
#: ipconst.spngbadbitdepth #: ipconst.spngbadbitdepth
msgid "Unsupported Bit Depth of %d" msgid "Unsupported Bit Depth of %d"
@ -1254,7 +1254,7 @@ msgstr "Ismeretlen adatblokk típus: %s"
#: ipconst.spngbadcolortype #: ipconst.spngbadcolortype
msgid "Unrecognized color type of %d" msgid "Unrecognized color type of %d"
msgstr "" msgstr "A(z) %d színtípusa ismeretlen"
#: ipconst.spngbadinterlacemethod #: ipconst.spngbadinterlacemethod
msgid "Unrecognized Interlace Method" msgid "Unrecognized Interlace Method"
@ -1306,7 +1306,7 @@ msgstr ""
#: ipconst.spngeffectivefilter #: ipconst.spngeffectivefilter
msgid "Effective filter is %s" msgid "Effective filter is %s"
msgstr "" msgstr "Az alkalmazandó szűrő: %s"
#: ipconst.spngerrorconstant #: ipconst.spngerrorconstant
msgid "**** ERROR ****" msgid "**** ERROR ****"
@ -1314,7 +1314,7 @@ msgstr "**** HIBA ****"
#: ipconst.spngfilterchange #: ipconst.spngfilterchange
msgid "Filter changed on Row %d to %x" msgid "Filter changed on Row %d to %x"
msgstr "" msgstr "A szűrő a(z) %d. sorban megváltozott erre: %x"
#: ipconst.spngfiltermethod #: ipconst.spngfiltermethod
msgid "Filter Method: %d" msgid "Filter Method: %d"
@ -1366,7 +1366,7 @@ msgstr "A módosítás dátuma: %s"
#: ipconst.spngnoclipboard #: ipconst.spngnoclipboard
msgid "PNG Clipboard support is not supported." msgid "PNG Clipboard support is not supported."
msgstr "" msgstr "PNG Vágólap használata nincs támogatva."
#: ipconst.spngpaletteentry #: ipconst.spngpaletteentry
msgid "Palette Entry %d - Red: %d Green: %d Blue: %d" msgid "Palette Entry %d - Red: %d Green: %d Blue: %d"
@ -1465,11 +1465,11 @@ msgstr "-ERR"
#: ipconst.spop3notauthenticating #: ipconst.spop3notauthenticating
msgid "%s can not be called in transaction state" msgid "%s can not be called in transaction state"
msgstr "" msgstr "%s nem hívható átviteli közben"
#: ipconst.spop3nottransacting #: ipconst.spop3nottransacting
msgid "%s can not be called in authentication state" msgid "%s can not be called in authentication state"
msgstr "" msgstr "%s nem hívható hitelesítés közben"
#: ipconst.spop3okresp #: ipconst.spop3okresp
msgid "+OK" msgid "+OK"
@ -1477,11 +1477,11 @@ msgstr "+OK"
#: ipconst.sposreqd #: ipconst.sposreqd
msgid "%s: count must be positive" msgid "%s: count must be positive"
msgstr "" msgstr "%s: számnak pozitívnak kell lennie"
#: ipconst.spsapop #: ipconst.spsapop
msgid "Logging on with APOP" msgid "Logging on with APOP"
msgstr "" msgstr "Bejelentkezés APOP használatával"
#: ipconst.spsconnect #: ipconst.spsconnect
msgid "Connecting to server" msgid "Connecting to server"
@ -1503,7 +1503,7 @@ msgstr "Nincs művelet"
#: ipconst.spspass #: ipconst.spspass
msgid "Logging on with Password" msgid "Logging on with Password"
msgstr "" msgstr "Bejelentkezés jelszóval"
#: ipconst.spsquit #: ipconst.spsquit
msgctxt "ipconst.spsquit" msgctxt "ipconst.spsquit"
@ -1541,7 +1541,7 @@ msgstr "Ismeretlen állapot"
#: ipconst.spsuser #: ipconst.spsuser
msgid "Logging on with User" msgid "Logging on with User"
msgstr "" msgstr "Bejelentkezés felhasználónévvel"
#: ipconst.spterror #: ipconst.spterror
msgid "An error occurred with the last task." msgid "An error occurred with the last task."
@ -1555,7 +1555,7 @@ msgstr "Postafióklista lekérése"
#: ipconst.sptlogon #: ipconst.sptlogon
msgctxt "ipconst.sptlogon" msgctxt "ipconst.sptlogon"
msgid "Logging on" msgid "Logging on"
msgstr "" msgstr "Bejelentkezés"
#: ipconst.sptnone #: ipconst.sptnone
msgctxt "ipconst.sptnone" msgctxt "ipconst.sptnone"
@ -1613,11 +1613,11 @@ msgstr "Hitelesítés újrapróbálása"
#: ipconst.srascallbackcomplete #: ipconst.srascallbackcomplete
msgid "Callback complete" msgid "Callback complete"
msgstr "" msgstr "Visszahívás kész"
#: ipconst.srascallbacksetbycaller #: ipconst.srascallbacksetbycaller
msgid "Callback set by caller" msgid "Callback set by caller"
msgstr "" msgstr "Visszahívás beállítva a hívó által"
#: ipconst.srasconnectdevice #: ipconst.srasconnectdevice
msgid "Connect device" msgid "Connect device"
@ -1638,7 +1638,7 @@ msgstr "Kapcsolat bontva"
#: ipconst.sraserr #: ipconst.sraserr
msgid "Ras Error (%d): on API '%s'" msgid "Ras Error (%d): on API '%s'"
msgstr "Ras hiba (%d): a következő API-n: '%s'" msgstr "RAS hiba (%d): a következő API-n: '%s'"
#: ipconst.srasinteractive #: ipconst.srasinteractive
msgid "Interactive" msgid "Interactive"
@ -1646,7 +1646,7 @@ msgstr "Interaktív"
#: ipconst.sraslogonnetwork #: ipconst.sraslogonnetwork
msgid "Logon network" msgid "Logon network"
msgstr "" msgstr "Bejelentkezés a hálózatra"
#: ipconst.srasopenport #: ipconst.srasopenport
msgid "Open port" msgid "Open port"
@ -1666,11 +1666,11 @@ msgstr "Port megnyitva"
#: ipconst.srasprepareforcallback #: ipconst.srasprepareforcallback
msgid "Prepare for callback" msgid "Prepare for callback"
msgstr "" msgstr "Visszahívás előkészítése"
#: ipconst.srasprojected #: ipconst.srasprojected
msgid "Projected" msgid "Projected"
msgstr "" msgstr "Ütemezve"
#: ipconst.srasreauthenticate #: ipconst.srasreauthenticate
msgid "Re-authenticate" msgid "Re-authenticate"
@ -1694,7 +1694,7 @@ msgstr ""
#: ipconst.sraswaitforcallback #: ipconst.sraswaitforcallback
msgid "Wait for callback" msgid "Wait for callback"
msgstr "" msgstr "Várakozás visszahívásra"
#: ipconst.sraswaitformodemreset #: ipconst.sraswaitformodemreset
msgid "Wait for modem reset" msgid "Wait for modem reset"
@ -1722,7 +1722,7 @@ msgstr "TIpTerminalArray.ScrollRows: a kezdő (%d) és befejező (%d) sorszám i
#: ipconst.sseekingdiskfileto #: ipconst.sseekingdiskfileto
msgid "Seeking disk file to " msgid "Seeking disk file to "
msgstr "" msgstr "Lemezen lévő fájl pozicionálása: "
#: ipconst.sslnopremastersecret #: ipconst.sslnopremastersecret
msgid "No pre-master secret." msgid "No pre-master secret."
@ -1734,7 +1734,7 @@ msgstr "Siker,"
#: ipconst.ssmtpresponse04 #: ipconst.ssmtpresponse04
msgid "Transient, " msgid "Transient, "
msgstr "" msgstr "Átmenő, "
#: ipconst.ssmtpresponse05 #: ipconst.ssmtpresponse05
msgid "Persistent, " msgid "Persistent, "
@ -1794,7 +1794,7 @@ msgstr "Az üzenet hossza meghaladja az adminisztratív korlátot"
#: ipconst.ssmtpresponse24 #: ipconst.ssmtpresponse24
msgid "Mailing list expansion problem" msgid "Mailing list expansion problem"
msgstr "" msgstr "A levelezési lista bővítése problémás"
#: ipconst.ssmtpresponse30 #: ipconst.ssmtpresponse30
msgid "Other or undefined mail system status" msgid "Other or undefined mail system status"
@ -1838,11 +1838,11 @@ msgstr "Útválasztás nem lehetséges"
#: ipconst.ssmtpresponse45 #: ipconst.ssmtpresponse45
msgid "Network congestion" msgid "Network congestion"
msgstr "" msgstr "Hálózati torlódás"
#: ipconst.ssmtpresponse46 #: ipconst.ssmtpresponse46
msgid "Routing loop detected" msgid "Routing loop detected"
msgstr "" msgstr "Útválasztás ismétlődése érzékelve"
#: ipconst.ssmtpresponse47 #: ipconst.ssmtpresponse47
msgid "Delivery time expired" msgid "Delivery time expired"
@ -1882,7 +1882,7 @@ msgstr "A média nincs támogatva"
#: ipconst.ssmtpresponse62 #: ipconst.ssmtpresponse62
msgid "Conversion required and prohibited" msgid "Conversion required and prohibited"
msgstr "" msgstr "Átalakítás szükséges és tilos"
#: ipconst.ssmtpresponse63 #: ipconst.ssmtpresponse63
msgid "Conversion required but not supported" msgid "Conversion required but not supported"
@ -1890,7 +1890,7 @@ msgstr "Átlakítás szükséges, de nincs támogatva"
#: ipconst.ssmtpresponse64 #: ipconst.ssmtpresponse64
msgid "Conversion with loss performed" msgid "Conversion with loss performed"
msgstr "" msgstr "Az átalakítás veszteséggel végrehajtva"
#: ipconst.ssmtpresponse65 #: ipconst.ssmtpresponse65
msgid "Conversion failed" msgid "Conversion failed"
@ -1902,15 +1902,15 @@ msgstr "Egyéb vagy meghatározatlan biztonsági állapot"
#: ipconst.ssmtpresponse71 #: ipconst.ssmtpresponse71
msgid "Delivery not authorized, message refused" msgid "Delivery not authorized, message refused"
msgstr "" msgstr "Kézbesítés nincs engedélyezve, üzenet elutasítva"
#: ipconst.ssmtpresponse72 #: ipconst.ssmtpresponse72
msgid "Mailing list expansion prohibited" msgid "Mailing list expansion prohibited"
msgstr "" msgstr "A levelezési lista bővítése tilos"
#: ipconst.ssmtpresponse73 #: ipconst.ssmtpresponse73
msgid "Security conversion required but not possible" msgid "Security conversion required but not possible"
msgstr "" msgstr "Biztonsági átalakítás szükséges, de nem lehetséges"
#: ipconst.ssmtpresponse74 #: ipconst.ssmtpresponse74
msgid "Security features not supported" msgid "Security features not supported"
@ -1926,7 +1926,7 @@ msgstr "A titkosító eljárás nincs támogatva"
#: ipconst.ssmtpresponse77 #: ipconst.ssmtpresponse77
msgid "Message integrity failure" msgid "Message integrity failure"
msgstr "" msgstr "Az üzenet sérült"
#: ipconst.ssmtpresponsesubunknown #: ipconst.ssmtpresponsesubunknown
msgid "Unknown subcode" msgid "Unknown subcode"
@ -1963,16 +1963,15 @@ msgstr "Adatok küldése"
#: ipconst.sssehlo #: ipconst.sssehlo
msgid "Logging on with EHLO" msgid "Logging on with EHLO"
msgstr "" msgstr "Bejelentkezés EHLO-val"
#: ipconst.sssexpand #: ipconst.sssexpand
#, fuzzy
msgid "Expanding" msgid "Expanding"
msgstr "Kiterjesztett" msgstr "Kibővítés"
#: ipconst.ssshelo #: ipconst.ssshelo
msgid "Logging on with HELO" msgid "Logging on with HELO"
msgstr "" msgstr "Bejelentkezés HELO-val"
#: ipconst.ssshelp #: ipconst.ssshelp
msgid "Help" msgid "Help"
@ -1984,11 +1983,11 @@ msgstr "Rossz tanúsítvány."
#: ipconst.ssslbadcerttype #: ipconst.ssslbadcerttype
msgid "Cert type not found" msgid "Cert type not found"
msgstr "" msgstr "A tanúsítványtípus nem található"
#: ipconst.ssslbadcompressionvalue #: ipconst.ssslbadcompressionvalue
msgid "Compression value is wrong." msgid "Compression value is wrong."
msgstr "" msgstr "A tömörítési érték hibás."
#: ipconst.ssslbadkeyexchangetype #: ipconst.ssslbadkeyexchangetype
msgid "Key exchange message expected but not received" msgid "Key exchange message expected but not received"
@ -2008,7 +2007,7 @@ msgstr "Rossz a nyilvános kódolás típusa."
#: ipconst.ssslbadrecordmac #: ipconst.ssslbadrecordmac
msgid "Server received a bad record MAC." msgid "Server received a bad record MAC."
msgstr "" msgstr "A kiszolgáló rossz MAC rekordot kapott."
#: ipconst.ssslbadsha1hash #: ipconst.ssslbadsha1hash
msgid "SHA1 hash did not match." msgid "SHA1 hash did not match."
@ -2028,7 +2027,7 @@ msgstr "A puffer mérete nem egyezik."
#: ipconst.ssslclosenotify #: ipconst.ssslclosenotify
msgid "Server sent close notify." msgid "Server sent close notify."
msgstr "" msgstr "A kiszolgáló lezárási értesítést küldött."
#: ipconst.ssslcompressionfailure #: ipconst.ssslcompressionfailure
msgid "Compression failure." msgid "Compression failure."
@ -2052,7 +2051,7 @@ msgstr "Lejárt tanúsítvány."
#: ipconst.ssslfailedhelloparse #: ipconst.ssslfailedhelloparse
msgid "Did not parse server hello correctly." msgid "Did not parse server hello correctly."
msgstr "" msgstr "Nem sikerült megfelelően elemezni a kiszolgáló helló-ját."
#: ipconst.ssslhandshakefailure #: ipconst.ssslhandshakefailure
msgid "Handshake failure." msgid "Handshake failure."
@ -2084,11 +2083,11 @@ msgstr "Nincs elég memória az SSL rekord olvasásához."
#: ipconst.ssslnotenoughkeymaterail #: ipconst.ssslnotenoughkeymaterail
msgid "Not enough key material." msgid "Not enough key material."
msgstr "" msgstr "Nincs elegendő kulcsanyag."
#: ipconst.ssslpaddingerror #: ipconst.ssslpaddingerror
msgid "Padding error." msgid "Padding error."
msgstr "" msgstr "Helykitöltés hiba."
#: ipconst.ssslparsererror #: ipconst.ssslparsererror
msgid "Parsing error." msgid "Parsing error."
@ -2219,7 +2218,7 @@ msgstr "Hiba keletkezet ezen feladat közben."
#: ipconst.sstlogon #: ipconst.sstlogon
msgctxt "ipconst.sstlogon" msgctxt "ipconst.sstlogon"
msgid "Logging on" msgid "Logging on"
msgstr "" msgstr "Bejelentkezés"
#: ipconst.sstnotask #: ipconst.sstnotask
msgid "None" msgid "None"
@ -2255,7 +2254,7 @@ msgstr "%s nem található"
#: ipconst.swebimagestreambad #: ipconst.swebimagestreambad
msgid "Cannot load image from stream" msgid "Cannot load image from stream"
msgstr "" msgstr "Nem lehet képet betölteni az adatfolyamból"
#: ipconst.swinsockerr #: ipconst.swinsockerr
msgid "WinSock Error (%d): %s, on API '%s'" msgid "WinSock Error (%d): %s, on API '%s'"
@ -2263,7 +2262,7 @@ msgstr "WinSock hiba (%d): %s, a következő API-n: '%s'"
#: ipconst.swriteafterrename #: ipconst.swriteafterrename
msgid "***Write after rename" msgid "***Write after rename"
msgstr "" msgstr "***Írás átnevezés után"
#: ipconst.swrongstateerr #: ipconst.swrongstateerr
msgid "Can not comply, wrong state" msgid "Can not comply, wrong state"
@ -2315,7 +2314,7 @@ msgstr "Célcím szükséges"
#: ipconst.swsaediscon #: ipconst.swsaediscon
msgid "Graceful shutdown in progress" msgid "Graceful shutdown in progress"
msgstr "" msgstr "Rendes lekapcsolás folyamatban"
#: ipconst.swsaedquot #: ipconst.swsaedquot
msgid "Disk quota exceeded" msgid "Disk quota exceeded"
@ -2347,11 +2346,11 @@ msgstr "Érvénytelen argumentum"
#: ipconst.swsaeinvalidproctable #: ipconst.swsaeinvalidproctable
msgid "Invalid procedure table from service provider" msgid "Invalid procedure table from service provider"
msgstr "" msgstr "Érvénytelen éljáráslista a szolgáltatótól"
#: ipconst.swsaeinvalidprovider #: ipconst.swsaeinvalidprovider
msgid "Invalid service provider version number" msgid "Invalid service provider version number"
msgstr "" msgstr "Érvénytelen a szolgáltató változatszáma"
#: ipconst.swsaeisconn #: ipconst.swsaeisconn
msgid "Socket is already connected" msgid "Socket is already connected"
@ -2432,7 +2431,7 @@ msgstr "A protokoll típusa nem megfelelő a szoftvercsatornához"
#: ipconst.swsaeproviderfailedinit #: ipconst.swsaeproviderfailedinit
msgid "Unable to initialize a service provider" msgid "Unable to initialize a service provider"
msgstr "" msgstr "Nem sikerült a szolgáltató előkészítése"
#: ipconst.swsaerefused #: ipconst.swsaerefused
msgid "Refused" msgid "Refused"
@ -2440,7 +2439,7 @@ msgstr "Elutasítva"
#: ipconst.swsaeremote #: ipconst.swsaeremote
msgid "Too many levels of remote in path" msgid "Too many levels of remote in path"
msgstr "" msgstr "Túl sok szint a távoli útvonalban"
#: ipconst.swsaeshutdown #: ipconst.swsaeshutdown
msgid "Cannot send after socket shutdown" msgid "Cannot send after socket shutdown"
@ -2480,7 +2479,7 @@ msgstr "Sikeres WSAStartup még nem lett végrehajtva"
#: ipconst.swsano_data #: ipconst.swsano_data
msgid "Valid name, no data record of requested type" msgid "Valid name, no data record of requested type"
msgstr "" msgstr "Érvényes név, nincs adatrekord a kért típussal"
#: ipconst.swsano_recovery #: ipconst.swsano_recovery
msgid "This is a nonrecoverable error" msgid "This is a nonrecoverable error"
@ -2500,11 +2499,11 @@ msgstr "A hálózati alrendszer nem érhető el"
#: ipconst.swsatry_again #: ipconst.swsatry_again
msgid "Non-authoritative host not found" msgid "Non-authoritative host not found"
msgstr "" msgstr "A nem hiteles állomás nem található"
#: ipconst.swsatype_not_found #: ipconst.swsatype_not_found
msgid "Type not found" msgid "Type not found"
msgstr "" msgstr "Típus nem található"
#: ipconst.swsavernotsupported #: ipconst.swsavernotsupported
msgid "WinSock DLL version not supported" msgid "WinSock DLL version not supported"
@ -2525,7 +2524,7 @@ msgstr "Hiba erőforráshiány miatt"
#: ipconst.swsa_qos_bad_object #: ipconst.swsa_qos_bad_object
msgid "Problem filterspec or provider specific buffer" msgid "Problem filterspec or provider specific buffer"
msgstr "" msgstr "Problémás szűrőleírás vagy szolgáltatói puffer"
#: ipconst.swsa_qos_bad_style #: ipconst.swsa_qos_bad_style
msgid "Unknown or conflicting style" msgid "Unknown or conflicting style"
@ -2561,4 +2560,4 @@ msgstr ""
#: ipconst.swsa_qos_traffic_ctrl_error #: ipconst.swsa_qos_traffic_ctrl_error
msgid "Problem with some part of the flowspec" msgid "Problem with some part of the flowspec"
msgstr "" msgstr "Probléma van az adatfolyam-leírás egy részével"

View File

@ -454,7 +454,7 @@ msgstr "Szinkron szerkesztés"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit" msgid "Template Edit"
msgstr "Sablon szerkesztés" msgstr "Sablon szerkesztése"
#: lazarusidestrconsts.dlgaddhiattrgrouptext #: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
@ -700,7 +700,7 @@ msgstr "Blokk behúzás (tab-ok)"
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor #: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0." msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr "A keret-térköz beállítható a Horgony szerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0." msgstr "A keret-térköz beállítható a Horgonyszerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."
#: lazarusidestrconsts.dlgbrackethighlight #: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight" msgid "Bracket highlight"
@ -822,11 +822,11 @@ msgstr "A form csomagokat igényelhet a működéshez. Az ilyen csomagok automat
#: lazarusidestrconsts.dlgchscodetempl #: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)" msgid "Choose code template file (*.dci)"
msgstr "Válasszon kódsablon fájlt! (*.dcl)" msgstr "Kódsablon fájl választása (*.dci)"
#: lazarusidestrconsts.dlgcloseanduseselecteddesktop #: lazarusidestrconsts.dlgcloseanduseselecteddesktop
msgid "Close and use selected desktop" msgid "Close and use selected desktop"
msgstr "" msgstr "Bezárás és a kiválasztott felület használata"
#: lazarusidestrconsts.dlgclosebuttonsnotebook #: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook" msgid "Show close buttons in notebook"
@ -1191,7 +1191,7 @@ msgstr "Felhasználó által megadott kiterjesztés (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop #: lazarusidestrconsts.dlgdebugdesktop
msgid "debug desktop" msgid "debug desktop"
msgstr "" msgstr "hibakereső felület"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor" msgid "Path Editor"
@ -1227,7 +1227,7 @@ msgstr "Menükben: "
#: lazarusidestrconsts.dlgdesktopname #: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name:" msgid "Desktop name:"
msgstr "" msgstr "Felület neve:"
#: lazarusidestrconsts.dlgdirection #: lazarusidestrconsts.dlgdirection
msgid "Direction" msgid "Direction"
@ -1549,7 +1549,7 @@ msgstr "Minden fájl"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile #: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile" msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file" msgid "CodeTools template file"
msgstr "CodeTools sablon fájl" msgstr "CodeTools sablonfájl"
#: lazarusidestrconsts.dlgfilterdcifile #: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file" msgid "DCI file"
@ -1590,15 +1590,15 @@ msgstr "HTML fájlok"
#: lazarusidestrconsts.dlgfilterimagesbitmap #: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images" msgid "Bitmap images"
msgstr "" msgstr "Bitmap képek"
#: lazarusidestrconsts.dlgfilterimagespixmap #: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images" msgid "Pixmap images"
msgstr "" msgstr "Pixmap képek"
#: lazarusidestrconsts.dlgfilterimagespng #: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images" msgid "PNG images"
msgstr "" msgstr "PNG képek"
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings #: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings" msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
@ -2031,7 +2031,7 @@ msgstr "Külső alkalmazás"
#: lazarusidestrconsts.dlgidentifiercompletion #: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion" msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion" msgid "Identifier Completion"
msgstr "Azonosító kiegészítés" msgstr "Azonosítók kiegészítése"
#: lazarusidestrconsts.dlgidentifierpolicy #: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy" msgid "Identifier policy"
@ -2217,7 +2217,7 @@ msgstr "\"Make\" program"
#: lazarusidestrconsts.dlgmanagedesktops #: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops" msgid "Manage desktops"
msgstr "" msgstr "Felületek kezelése"
#: lazarusidestrconsts.dlgmargingutter #: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter" msgid "Margin and gutter"
@ -2817,6 +2817,8 @@ msgid ""
"Desktop with the name \"%s\" was found.\n" "Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n" "Should the old desktop be overwritten?\n"
msgstr "" msgstr ""
"Létezik \"%s\" nevű felület.\n"
"Felülírható a régi felület?\n"
#: lazarusidestrconsts.dlgpalhints #: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette" msgid "Hints for component palette"
@ -2993,7 +2995,7 @@ msgstr "Kérdés felülírásnál"
#: lazarusidestrconsts.dlgpropertycompletion #: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion" msgid "Property completion"
msgstr "Tulajdonság kiegészítés" msgstr "Tulajdonságok kiegészítése"
#: lazarusidestrconsts.dlgpropnamecolor #: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name" msgid "Property Name"
@ -3017,7 +3019,7 @@ msgstr "Rácshoz igazítás"
#: lazarusidestrconsts.dlgreallydeletedesktop #: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?" msgid "Really delete desktop \"%s\"?"
msgstr "" msgstr "Valóban törölhető a(z) \"%s\" felület?"
#: lazarusidestrconsts.dlgreferencecolor #: lazarusidestrconsts.dlgreferencecolor
msgid "Reference" msgid "Reference"
@ -3029,7 +3031,7 @@ msgstr "Reguláris kifejerések"
#: lazarusidestrconsts.dlgrenamedesktop #: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop" msgid "Rename desktop"
msgstr "" msgstr "Felület átnevezése"
#: lazarusidestrconsts.dlgreplaceall #: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All" msgid "Replace &All"
@ -3103,7 +3105,7 @@ msgstr "Futtatási paraméterek"
#: lazarusidestrconsts.dlgsavecurrentdesktop #: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop" msgid "Save current desktop"
msgstr "" msgstr "A jelenlegi felület mentése"
#: lazarusidestrconsts.dlgsavedlinecolor #: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line" msgid "Saved line"
@ -3172,7 +3174,7 @@ msgstr "Az összes gyermek-vezérlő kijelölése a szülővel együtt."
#: lazarusidestrconsts.dlgselecteddesktop #: lazarusidestrconsts.dlgselecteddesktop
msgid "Selected desktop:" msgid "Selected desktop:"
msgstr "" msgstr "Kiválasztott velület:"
#: lazarusidestrconsts.dlgselectedtext #: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text" msgid "&Selected text"
@ -3420,7 +3422,7 @@ msgstr "Keresendő szöveg"
#: lazarusidestrconsts.dlgtoggleselecteddebugdesktop #: lazarusidestrconsts.dlgtoggleselecteddebugdesktop
msgid "Toggle as debug desktop" msgid "Toggle as debug desktop"
msgstr "" msgstr "Hibakereső felület ki-/bekapcsolása"
#: lazarusidestrconsts.dlgtopinfohint #: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint" msgid "Current Class/Proc Hint"
@ -3610,11 +3612,11 @@ msgstr "Tükrözés függőlegesen"
#: lazarusidestrconsts.fdmorderbackone #: lazarusidestrconsts.fdmorderbackone
msgid "Back One" msgid "Back One"
msgstr "Egyet hátra" msgstr "Hátrább eggyel"
#: lazarusidestrconsts.fdmorderforwardone #: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One" msgid "Forward One"
msgstr "Egyet előre" msgstr "Előbbre eggyel"
#: lazarusidestrconsts.fdmordermovetoback #: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back" msgid "Move to Back"
@ -3846,7 +3848,7 @@ msgstr "Nem található csomag a(z) \"%s\" függőséghez.%sVálasszon egy léte
#: lazarusidestrconsts.lisa2ppackageorproject #: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project" msgid "Package/Project"
msgstr "" msgstr "Csomag/Projekt"
#: lazarusidestrconsts.lisa2ppagenametoolong #: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long" msgid "Page Name too long"
@ -3977,7 +3979,6 @@ msgid "Abandon changes?"
msgstr "Változások elvetése?" msgstr "Változások elvetése?"
#: lazarusidestrconsts.lisabort #: lazarusidestrconsts.lisabort
#, fuzzy
msgctxt "lazarusidestrconsts.lisabort" msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort" msgid "Abort"
msgstr "Megszakítás" msgstr "Megszakítás"
@ -4594,7 +4595,6 @@ msgid "Border space"
msgstr "Keret-térköz" msgstr "Keret-térköz"
#: lazarusidestrconsts.lisbottom #: lazarusidestrconsts.lisbottom
#, fuzzy
msgctxt "lazarusidestrconsts.lisbottom" msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom" msgid "Bottom"
msgstr "Lent" msgstr "Lent"
@ -4711,7 +4711,7 @@ msgstr "A Lazarus építése nem sikerült"
#: lazarusidestrconsts.lisbuildmode #: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s" msgid "Build Mode: %s"
msgstr "" msgstr "Építési mód: %s"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes #: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes" msgid "Differences between build modes"
@ -5378,7 +5378,7 @@ msgstr "%s Ellenőrizze a célt (OS, CPU, LCL vezérlőkészlet típusa)! Talán
#: lazarusidestrconsts.lischeckuncheckall #: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all" msgid "Check/uncheck all"
msgstr "" msgstr "Minden/Semmi kijelölése"
#: lazarusidestrconsts.lischooseadifferentname #: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name" msgid "Choose a different name"
@ -5442,7 +5442,7 @@ msgstr "Válasszon könyvtárat!"
#: lazarusidestrconsts.lischooseexecutable #: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable" msgid "Choose an executable"
msgstr "" msgstr "Válasszon egy programot!"
#: lazarusidestrconsts.lischoosefpcsourcedir #: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory" msgid "Choose FPC source directory"
@ -5671,7 +5671,7 @@ msgstr "Lapok"
#: lazarusidestrconsts.liscmppalettevisible #: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible" msgid "Palette is &visible"
msgstr "" msgstr "A paletta látható"
#: lazarusidestrconsts.liscmprestoredefaults #: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults" msgid "&Restore defaults"
@ -5821,7 +5821,7 @@ msgstr "Konstansok kihagyása a következő függvényekben"
#: lazarusidestrconsts.liscodeobscharconst #: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst" msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants" msgid "Search for unnamed char constants"
msgstr "Meg nem nevezett karakter konstansok megkeresése" msgstr "Névtelen karakter konstansok megkeresése"
#: lazarusidestrconsts.liscodeobserver #: lazarusidestrconsts.liscodeobserver
msgid "Code Observer" msgid "Code Observer"
@ -6453,7 +6453,7 @@ msgstr "\"Lazarus építés\" beállítása"
#: lazarusidestrconsts.lisconfigureeditortoolbar #: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar" msgid "Configure Toolbar"
msgstr "" msgstr "Eszköztár beállítása"
#: lazarusidestrconsts.lisconfigurelazaruside #: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE" msgid "Configure Lazarus IDE"
@ -7203,7 +7203,7 @@ msgstr "Először hozzon létre projektet!"
#: lazarusidestrconsts.liscreatedebugandreleasemodesnewproj #: lazarusidestrconsts.liscreatedebugandreleasemodesnewproj
msgid "Create Debug and Release modes for new projects" msgid "Create Debug and Release modes for new projects"
msgstr "" msgstr "Hibakereső és kiadási módok létrehozása új projektekhez"
#: lazarusidestrconsts.liscreatedirectory #: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?" msgid "Create directory?"
@ -7243,7 +7243,7 @@ msgstr "Új csomag-komponens létrehozása"
#: lazarusidestrconsts.liscreatenowforthisproject #: lazarusidestrconsts.liscreatenowforthisproject
msgid "Create now for this project" msgid "Create now for this project"
msgstr "" msgstr "Létrehozás e projekthez most"
#: lazarusidestrconsts.liscreateproject #: lazarusidestrconsts.liscreateproject
msgid "Create project" msgid "Create project"
@ -7462,7 +7462,7 @@ msgstr "Alapértelmezett szín"
#: lazarusidestrconsts.lisdbgenexceptionraised #: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised" msgid "Exception Raised"
msgstr "Kivétel Keletkezett" msgstr "Kivétel keletkezett"
#: lazarusidestrconsts.lisdbgenmoduleload #: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load" msgid "Module Load"
@ -7494,11 +7494,11 @@ msgstr "Szál indítása"
#: lazarusidestrconsts.lisdbgenwindowsmessageposted #: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted" msgid "Windows Message Posted"
msgstr "Windows üzenet küldése" msgstr "Küldött Windows üzenet"
#: lazarusidestrconsts.lisdbgenwindowsmessagesent #: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent" msgid "Windows Message Sent"
msgstr "Küldött Windows üzenet" msgstr "Windows üzenet elküldve"
#: lazarusidestrconsts.lisdbgitemdeletehint #: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
@ -7859,7 +7859,7 @@ msgstr "A \"tervezési\" csomagok komponenseket és menübejegyzéseket adnak az
#: lazarusidestrconsts.lisdesktops #: lazarusidestrconsts.lisdesktops
msgid "Desktops ..." msgid "Desktops ..."
msgstr "" msgstr "Felületek ..."
#: lazarusidestrconsts.lisdestinationdirectory #: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory" msgid "Destination directory"
@ -8083,7 +8083,6 @@ msgid "Import ..."
msgstr "Importálás ..." msgstr "Importálás ..."
#: lazarusidestrconsts.lisdlgmore #: lazarusidestrconsts.lisdlgmore
#, fuzzy
msgctxt "lazarusidestrconsts.lisdlgmore" msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..." msgid "More ..."
msgstr "Továbbiak ..." msgstr "Továbbiak ..."
@ -8169,15 +8168,15 @@ msgstr "Kijelölt komponensek kivágása a vágólapra"
#: lazarusidestrconsts.lisdsgorderbackone #: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back" msgid "Move component one back"
msgstr "Komponens eggyel hátra" msgstr "Komponens mozgatása eggyel hátrább"
#: lazarusidestrconsts.lisdsgorderforwardone #: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward" msgid "Move component one forward"
msgstr "Komponens eggyel előre" msgstr "Komponens mozgatása eggyel előbbre"
#: lazarusidestrconsts.lisdsgordermovetoback #: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back" msgid "Move component to back"
msgstr "Komponens háttérbe rakása" msgstr "Komponens háttérbe küldése"
#: lazarusidestrconsts.lisdsgordermovetofront #: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front" msgid "Move component to front"
@ -8266,15 +8265,15 @@ msgstr "Szerkesztő makrók"
#: lazarusidestrconsts.liseditortoolbar #: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar" msgid "Editor ToolBar"
msgstr "" msgstr "Szerkesztő eszköztára"
#: lazarusidestrconsts.liseditortoolbarhint #: lazarusidestrconsts.liseditortoolbarhint
msgid "You may add here your favorite commands" msgid "You may add here your favorite commands"
msgstr "" msgstr "Itt adhatja hozzá kedvenc parancsait"
#: lazarusidestrconsts.liseditortoolbarvisible #: lazarusidestrconsts.liseditortoolbarvisible
msgid "EditorToolbar is &visible" msgid "EditorToolbar is &visible"
msgstr "" msgstr "A szerkesztő eszköztára látható"
#: lazarusidestrconsts.lisedoptsloadascheme #: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme" msgid "Load a scheme"
@ -8714,7 +8713,7 @@ msgstr "Példák:%sAzonosító%sTMyEnum.Enum%sUnitnév.Azonosító%s#Csomagnév.
#: lazarusidestrconsts.lisexamplesopenfirstselected #: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected" msgid "Open first selected"
msgstr "Első kijelölt megynitása" msgstr "Első kijelölt megnyitása"
#: lazarusidestrconsts.lisexceptiondialog #: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification" msgid "Debugger Exception Notification"
@ -8789,7 +8788,7 @@ msgstr "Minden elem exportálása fájlba"
#: lazarusidestrconsts.lisexportenvironmentoptions #: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options" msgid "Export environment options"
msgstr "" msgstr "Környezet beállításainak exportálása"
#: lazarusidestrconsts.lisexporthtml #: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML" msgid "Export as HTML"
@ -8797,7 +8796,7 @@ msgstr "Exportálás HTML-ként"
#: lazarusidestrconsts.lisexportimport #: lazarusidestrconsts.lisexportimport
msgid "Export / Import" msgid "Export / Import"
msgstr "" msgstr "Exportálás / Importálás"
#: lazarusidestrconsts.lisexportlist #: lazarusidestrconsts.lisexportlist
msgid "Export list" msgid "Export list"
@ -9386,7 +9385,7 @@ msgstr "Ugrás adott sorra"
#: lazarusidestrconsts.lisgotoselected #: lazarusidestrconsts.lisgotoselected
msgid "Goto selected" msgid "Goto selected"
msgstr "" msgstr "Ugrás a kijelöltre"
#: lazarusidestrconsts.lisgplnotice #: lazarusidestrconsts.lisgplnotice
msgid "" msgid ""
@ -9603,11 +9602,11 @@ msgstr "ID"
#: lazarusidestrconsts.lisidcaddition #: lazarusidestrconsts.lisidcaddition
msgid "Addition" msgid "Addition"
msgstr "" msgstr "Kiegészítés"
#: lazarusidestrconsts.lisidcopening #: lazarusidestrconsts.lisidcopening
msgid "Opening" msgid "Opening"
msgstr "" msgstr "Megnyitás"
#: lazarusidestrconsts.liside #: lazarusidestrconsts.liside
msgid "IDE" msgid "IDE"
@ -9742,7 +9741,6 @@ msgid "If you want to use two different Lazarus versions you must start the seco
msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%sPéldául:" msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%sPéldául:"
#: lazarusidestrconsts.lisignore #: lazarusidestrconsts.lisignore
#, fuzzy
msgctxt "lazarusidestrconsts.lisignore" msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore" msgid "Ignore"
msgstr "Kihagyás" msgstr "Kihagyás"
@ -9788,7 +9786,7 @@ msgstr "Fontos"
#: lazarusidestrconsts.lisimportenvironmentoptions #: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options" msgid "Import environment options"
msgstr "" msgstr "Környezet beállításainak importálása"
#: lazarusidestrconsts.lisimportfromfile #: lazarusidestrconsts.lisimportfromfile
msgid "Import from File" msgid "Import from File"
@ -10056,11 +10054,11 @@ msgstr "Érvénytelen törlés"
#: lazarusidestrconsts.lisinvalidexecutable #: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable" msgid "Invalid Executable"
msgstr "" msgstr "Érvénytelen futtatható állomány"
#: lazarusidestrconsts.lisinvalidexecutablemessagetext #: lazarusidestrconsts.lisinvalidexecutablemessagetext
msgid "The file \"%s\" is not executable." msgid "The file \"%s\" is not executable."
msgstr "" msgstr "A(z) \"%s\" fájl nem futtatható állomány."
#: lazarusidestrconsts.lisinvalidexpression #: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s" msgid "Invalid expression:%s%s%s%s"
@ -10164,11 +10162,11 @@ msgstr "Kiadások"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:" msgid "I wonder how you did that. Error in the %s:"
msgstr "Hát, ez nagyon furcsa. Hiba itt: %s:" msgstr "Nahát, ez nagyon furcsa. Hiba itt: %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:" msgid "I wonder how you did that: Error in the base directory:"
msgstr "Hát, ez nagyon furcsa: Hiba az alapkönyvtárban:" msgstr "Nahát, ez nagyon furcsa: Hiba az alapkönyvtárban:"
#: lazarusidestrconsts.lisjhjumphistory #: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory" msgctxt "lazarusidestrconsts.lisjhjumphistory"
@ -10177,11 +10175,11 @@ msgstr "Ugrási előzmények"
#: lazarusidestrconsts.lisjumptoerror #: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error" msgid "Jump to error"
msgstr "" msgstr "Ugrás a hibára"
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion #: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it." msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "" msgstr "Ha egy azonosító kiegészítésekor hiba kerül elő a forrásban, ugrás oda."
#: lazarusidestrconsts.lisjumptoprocedure #: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s" msgid "Jump to procedure %s"
@ -11463,7 +11461,7 @@ msgstr "Sz&erkesztés"
#: lazarusidestrconsts.lismenueditcodetemplates #: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..." msgid "Code Templates ..."
msgstr "Kód sablonok ..." msgstr "Kódsablonok ..."
#: lazarusidestrconsts.lismenueditcontexthelp #: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help" msgid "Edit context sensitive Help"
@ -11531,11 +11529,11 @@ msgstr "Válasszon menüt:"
#: lazarusidestrconsts.lismenueditorselecttemplate #: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:" msgid "Select Template:"
msgstr "Válasszon sablont:" msgstr "Sablon választása:"
#: lazarusidestrconsts.lismenueditortemplatepreview #: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview" msgid "Template Preview"
msgstr "Sablon előnézet" msgstr "Sablon előnézete"
#: lazarusidestrconsts.lismenuencloseinifdef #: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..." msgid "Enclose in $IFDEF ..."
@ -11588,7 +11586,7 @@ msgstr "Azonosító hivatkozásainak megkeresése ..."
#: lazarusidestrconsts.lismenufindinfiles #: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..." msgid "Find &in Files ..."
msgstr "Keresés fájlokban ..." msgstr "Keresés a fájlokban ..."
#: lazarusidestrconsts.lismenufindnext #: lazarusidestrconsts.lismenufindnext
msgid "Find &Next" msgid "Find &Next"
@ -11829,7 +11827,7 @@ msgstr "Projekt megnyitása ..."
#: lazarusidestrconsts.lismenuopenrecent #: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent" msgid "Open &Recent"
msgstr "Legutóbbi megynyitása" msgstr "Legutóbbi megnyitása"
#: lazarusidestrconsts.lismenuopenrecentpkg #: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package" msgid "Open Recent Package"
@ -14573,7 +14571,7 @@ msgstr "Az .lpi a projekt fő információs fájlja, az .lps egy különálló f
#: lazarusidestrconsts.lisposition #: lazarusidestrconsts.lisposition
msgid "Position" msgid "Position"
msgstr "" msgstr "Elhelyezés"
#: lazarusidestrconsts.lispositionoutsideofsource #: lazarusidestrconsts.lispositionoutsideofsource
msgid "%s (position outside of source)" msgid "%s (position outside of source)"
@ -15781,7 +15779,7 @@ msgstr "Üres unit-ok/csomagok megjelenítése"
#: lazarusidestrconsts.lisshowglyphsfor #: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for" msgid "Show Glyphs for"
msgstr "Ikonok megjelenítése:" msgstr "Ikonok megjelenítése"
#: lazarusidestrconsts.lisshowgutterinobjectinspector #: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter" msgid "Show gutter"
@ -15826,7 +15824,7 @@ msgstr "Csomagok megjelenítése"
#: lazarusidestrconsts.lisshowpositionofsourceeditor #: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor" msgid "Show position of source editor"
msgstr "Váltás a forráskódbeli helyére" msgstr "Váltás a forráskódbeli helyzetére"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop #: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top" msgid "Show recently used identifiers at top"
@ -15942,7 +15940,7 @@ msgstr "Rendezés hatókör alapján"
#: lazarusidestrconsts.lissorting #: lazarusidestrconsts.lissorting
msgid "Sorting" msgid "Sorting"
msgstr "" msgstr "Rendezés"
#: lazarusidestrconsts.lissortselascending #: lazarusidestrconsts.lissortselascending
msgid "Ascending" msgid "Ascending"
@ -16269,7 +16267,7 @@ msgstr "Szerkeszthető cella beszúrása. A cellák között a TAB billenytűvel
#: lazarusidestrconsts.listemplatefile #: lazarusidestrconsts.listemplatefile
msgid "Template file" msgid "Template file"
msgstr "Sablon fájl" msgstr "Sablonfájl"
#: lazarusidestrconsts.listestdirectory #: lazarusidestrconsts.listestdirectory
msgid "Test directory" msgid "Test directory"
@ -16871,7 +16869,7 @@ msgstr "Cím (üres = alapértelmezett)"
#: lazarusidestrconsts.listitleopencomponenticon24x24 #: lazarusidestrconsts.listitleopencomponenticon24x24
msgid "Choose a component icon 24x24" msgid "Choose a component icon 24x24"
msgstr "" msgstr "Ikon választása a komponenshez (24x24)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter #: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter" msgid "Function: append path delimiter"
@ -16962,7 +16960,6 @@ msgid "tool stopped with exit code %s. Use context menu to get more information.
msgstr "az eszköz kilépési kóddal állt le: %s. A helyi menüből további információ érhető el." msgstr "az eszköz kilépési kóddal állt le: %s. A helyi menüből további információ érhető el."
#: lazarusidestrconsts.listop #: lazarusidestrconsts.listop
#, fuzzy
msgctxt "lazarusidestrconsts.listop" msgctxt "lazarusidestrconsts.listop"
msgid "Top" msgid "Top"
msgstr "Fent" msgstr "Fent"
@ -18049,7 +18046,7 @@ msgstr "XML elemző hiba a(z) %s%s fájlban. Hiba: %s"
#: lazarusidestrconsts.lisyes #: lazarusidestrconsts.lisyes
msgid "Yes" msgid "Yes"
msgstr "" msgstr "Igen"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor" msgid "You can disable this for individual forms via the package editor"
@ -18511,11 +18508,11 @@ msgstr "Egyidejű szerkesztés (kijelölés közben)"
#: lazarusidestrconsts.srkmcattemplateedit #: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing" msgid "Template Editing"
msgstr "Sablon szerkesztés" msgstr "Sablon szerkesztése"
#: lazarusidestrconsts.srkmcattemplateeditoff #: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)" msgid "Template Editing (not in Cell)"
msgstr "Sablon szerkesztés (kurzor cellán kívül)" msgstr "Sablon szerkesztése (kurzor cellán kívül)"
#: lazarusidestrconsts.srkmcattoolmenu #: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands" msgid "Tools menu commands"
@ -18568,7 +18565,7 @@ msgstr "Csatolás programhoz "
#: lazarusidestrconsts.srkmecautocompletion #: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion" msgid "Code template completion"
msgstr "Kód sablon kiegészítés" msgstr "Kódsablon kiegészítése"
#: lazarusidestrconsts.srkmecblockcopy #: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block" msgid "Copy Block"
@ -18847,7 +18844,7 @@ msgstr "Azonosító hivatkozásainak megkeresése"
#: lazarusidestrconsts.srkmecfindinfiles #: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files" msgid "Find in Files"
msgstr "Keresés fájlokban" msgstr "Keresés a fájlokban"
#: lazarusidestrconsts.srkmecfindnext #: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext" msgctxt "lazarusidestrconsts.srkmecfindnext"
@ -19032,13 +19029,11 @@ msgid "Invert Assignment"
msgstr "Hozzárendelés megfordítása" msgstr "Hozzárendelés megfordítása"
#: lazarusidestrconsts.srkmeckeymapleft #: lazarusidestrconsts.srkmeckeymapleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapleft" msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left" msgid "Left"
msgstr "Balra" msgstr "Balra"
#: lazarusidestrconsts.srkmeckeymapright #: lazarusidestrconsts.srkmeckeymapright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapright" msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right" msgid "Right"
msgstr "Jobbra" msgstr "Jobbra"

View File

@ -188,8 +188,6 @@ msgid "Save SQL statement to file"
msgstr "SQL állomány mentése fájlba" msgstr "SQL állomány mentése fájlba"
#: lazdatadeskstr.simportdictinto #: lazdatadeskstr.simportdictinto
#, fuzzy
#| msgid "Import datadictionary"
msgid "Import data dictionary" msgid "Import data dictionary"
msgstr "Adatszótár importálása" msgstr "Adatszótár importálása"
@ -215,11 +213,11 @@ msgstr "Külső kulcs hozzáadása a táblához"
#: lazdatadeskstr.sld_actionaddsequence #: lazdatadeskstr.sld_actionaddsequence
msgid "New sequence" msgid "New sequence"
msgstr "Új sorrend" msgstr "Új sorozat"
#: lazdatadeskstr.sld_actionaddsequenceh #: lazdatadeskstr.sld_actionaddsequenceh
msgid "Add a sequence" msgid "Add a sequence"
msgstr "Sorrend hozzáadása" msgstr "Sorozat hozzáadása"
#: lazdatadeskstr.sld_actionclose #: lazdatadeskstr.sld_actionclose
msgid "&Close" msgid "&Close"
@ -348,15 +346,13 @@ msgstr "A kiválasztott legutóbbi kapcsolat megnyitása"
#: lazdatadeskstr.sld_actionopenh #: lazdatadeskstr.sld_actionopenh
msgid "Open a new Data Dictionary" msgid "Open a new Data Dictionary"
msgstr "Új adatszótár megnyitása" msgstr "Egy új adatszótár megnyitása"
#: lazdatadeskstr.sld_actionopenrecentdatadict #: lazdatadeskstr.sld_actionopenrecentdatadict
msgid "Open" msgid "Open"
msgstr "Megnyitás" msgstr "Megnyitás"
#: lazdatadeskstr.sld_actionopenrecentdatadicth #: lazdatadeskstr.sld_actionopenrecentdatadicth
#, fuzzy
#| msgid "Open selected recent datadictionary"
msgid "Open selected recent data dictionary" msgid "Open selected recent data dictionary"
msgstr "A kiválasztott legutóbbi adatszótár megnyitása" msgstr "A kiválasztott legutóbbi adatszótár megnyitása"
@ -377,8 +373,6 @@ msgid "Save &as"
msgstr "Mentés másként" msgstr "Mentés másként"
#: lazdatadeskstr.sld_actionsaveash #: lazdatadeskstr.sld_actionsaveash
#, fuzzy
#| msgid "Save datadictionary as"
msgid "Save data dictionary as" msgid "Save data dictionary as"
msgstr "Adatszótár mentése másként" msgstr "Adatszótár mentése másként"
@ -405,7 +399,7 @@ msgstr "Meghajtó"
#: lazdatadeskstr.sld_connectionlv3 #: lazdatadeskstr.sld_connectionlv3
msgid "Last used" msgid "Last used"
msgstr "Legutóbb használt" msgstr "Utolsó használat"
#: lazdatadeskstr.sld_connectionlv4 #: lazdatadeskstr.sld_connectionlv4
msgctxt "lazdatadeskstr.sld_connectionlv4" msgctxt "lazdatadeskstr.sld_connectionlv4"
@ -460,8 +454,6 @@ msgid "Host"
msgstr "Kiszolgáló" msgstr "Kiszolgáló"
#: lazdatadeskstr.sld_importupdatedatadictionary #: lazdatadeskstr.sld_importupdatedatadictionary
#, fuzzy
#| msgid "Import/Update datadictionary"
msgid "Import/Update data dictionary" msgid "Import/Update data dictionary"
msgstr "Adatszótár importálása/frissítése" msgstr "Adatszótár importálása/frissítése"
@ -539,7 +531,7 @@ msgstr "Fájlnév"
#: lazdatadeskstr.sld_recentlv3 #: lazdatadeskstr.sld_recentlv3
msgid "Last used on" msgid "Last used on"
msgstr "Utolsó használat:" msgstr "Utolsó használat"
#: lazdatadeskstr.sld_savefileasfilter #: lazdatadeskstr.sld_savefileasfilter
msgctxt "lazdatadeskstr.sld_savefileasfilter" msgctxt "lazdatadeskstr.sld_savefileasfilter"
@ -611,10 +603,8 @@ msgid "New connection"
msgstr "Ú&j kapcsolat" msgstr "Ú&j kapcsolat"
#: lazdatadeskstr.snewdictionary #: lazdatadeskstr.snewdictionary
#, fuzzy
#| msgid "New database"
msgid "New data dictionary" msgid "New data dictionary"
msgstr "Új adatbázis" msgstr "Új adatszótár"
#: lazdatadeskstr.snewdomain #: lazdatadeskstr.snewdomain
msgid "Create new domain" msgid "Create new domain"
@ -654,7 +644,7 @@ msgstr "Új %s létrehozása"
#: lazdatadeskstr.snewsequence #: lazdatadeskstr.snewsequence
msgid "Create new sequence" msgid "Create new sequence"
msgstr "Új sorozat étrehozása" msgstr "Új sorozat létrehozása"
#: lazdatadeskstr.snewsequencename #: lazdatadeskstr.snewsequencename
msgid "Enter a name for the new sequence:" msgid "Enter a name for the new sequence:"
@ -678,8 +668,6 @@ msgid "Database"
msgstr "Adatbázis" msgstr "Adatbázis"
#: lazdatadeskstr.snodedatadictionary #: lazdatadeskstr.snodedatadictionary
#, fuzzy
#| msgid "Datadictionary"
msgid "Data dictionary" msgid "Data dictionary"
msgstr "Adatszótár" msgstr "Adatszótár"
@ -710,7 +698,7 @@ msgstr "Index beállítások:"
#: lazdatadeskstr.snodesequences #: lazdatadeskstr.snodesequences
msgid "Sequences" msgid "Sequences"
msgstr "Sorrendek" msgstr "Sorozatok"
#: lazdatadeskstr.snodetabledata #: lazdatadeskstr.snodetabledata
msgid "Table Data" msgid "Table Data"
@ -750,7 +738,7 @@ msgstr "Változások mentése"
#: lazdatadeskstr.sselectdbfdir #: lazdatadeskstr.sselectdbfdir
msgid "Select a directory with DBF files" msgid "Select a directory with DBF files"
msgstr "Válasszon könyvtárat a DBF fájlok számára!" msgstr "Könyvtár választása a DBF fájlok számára"
#: lazdatadeskstr.sselectedobject #: lazdatadeskstr.sselectedobject
msgid "Selected object" msgid "Selected object"
@ -758,7 +746,7 @@ msgstr "Kiválasztott objektum"
#: lazdatadeskstr.ssequence #: lazdatadeskstr.ssequence
msgid "Sequence" msgid "Sequence"
msgstr "Sorrend" msgstr "Sorozat"
#: lazdatadeskstr.ssqlfilters #: lazdatadeskstr.ssqlfilters
msgid "SQL files|*.sql|All files|*.*" msgid "SQL files|*.sql|All files|*.*"
@ -778,7 +766,7 @@ msgstr "Ismeretlen adatszótár: %s"
#: lazdatadeskstr.susecurrentdict #: lazdatadeskstr.susecurrentdict
msgid "Yes, use the active dictionary" msgid "Yes, use the active dictionary"
msgstr "Igen, az aktív szótáratt használva" msgstr "Igen, az aktív szótárat használva"
#: lazdatadeskstr.susenewdict #: lazdatadeskstr.susenewdict
msgid "No, import in a new dictionary" msgid "No, import in a new dictionary"