From bbd8f8b25e2c48358c671d81a90c40be2f3508cb Mon Sep 17 00:00:00 2001 From: maxim Date: Sun, 12 Jul 2015 13:36:27 +0000 Subject: [PATCH] =?UTF-8?q?Translations:=20Hungarian=20translation=20updat?= =?UTF-8?q?e=20by=20P=C3=A9ter=20G=C3=A1bor,=20bug=20#28393?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit git-svn-id: branches/fixes_1_4@49527 - --- .../languages/anchordockstr.hu.po | 16 +++--- .../ideintf/languages/objinspstrconsts.hu.po | 8 +-- .../lazreport/source/languages/lr_const.hu.po | 16 +++--- .../leakview/languages/heaptrcview.hu.po | 2 +- .../turbopower_ipro/languages/ipconst.hu.po | 30 +++++----- languages/lazaruside.hu.po | 56 +++++++++---------- .../languages/lazdatadesktop.hu.po | 18 +++--- 7 files changed, 73 insertions(+), 73 deletions(-) diff --git a/components/anchordocking/languages/anchordockstr.hu.po b/components/anchordocking/languages/anchordockstr.hu.po index e3b6ce55db..8a8a5f4b55 100644 --- a/components/anchordocking/languages/anchordockstr.hu.po +++ b/components/anchordocking/languages/anchordockstr.hu.po @@ -13,7 +13,7 @@ msgstr "" #: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\"" -msgstr "Egy elválasztó szabad oldalát nem lehet lehorgonyozni: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\"" +msgstr "Egy elválasztó szabad oldala nem rögzíthető: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\"" #: anchordockstr.adrsallfiles msgid "All files" @@ -25,23 +25,23 @@ msgstr "Ennyi képpontot kell mozdulnia az egérnek mielőtt a húzás elkezdőd #: anchordockstr.adrsanchordockinglayout msgid "Anchor Docking Layout" -msgstr "Lehorgonyzás elrendezése" +msgstr "Rögzített ablakelrendezés" #: anchordockstr.adrsanchorisnotsplitternodeanchors msgid "Anchor is not splitter: Node=\"%s\" Anchors[%s]=\"%s\"" -msgstr "A horgony nem elválasztó: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" +msgstr "Rögzítés nem elválasztóhoz: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" #: anchordockstr.adrsanchornotfoundnodeanchors msgid "Anchor not found: Node=\"%s\" Anchors[%s]=\"%s\"" -msgstr "Horgonyzás nincs engedélyezve: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" +msgstr "Rögzítési hely nem található: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" #: anchordockstr.adrsanchortowrongsideofsplitternodeanchors msgid "Anchor to wrong side of splitter: Node=\"%s\" Anchors[%s]=\"%s\"" -msgstr "Horgonyzás az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" +msgstr "Rögzítés az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\"" #: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\"" -msgstr "Egy lapot nem lehet lehorgonyozni: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\"" +msgstr "Egy lap nem rögzíthető: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\"" #: anchordockstr.adrsautomatically msgid "Automatically" @@ -65,7 +65,7 @@ msgstr "Az \"%s\" dokkterület csak egy területet tartalmazhat." #: anchordockstr.adrsdockinganchordocking msgid "Docking / Anchordocking" -msgstr "Dokkolás / Lehorgonyzás" +msgstr "Dokkolás / Ablakok rögzítése" #: anchordockstr.adrsdockingoptions msgid "Docking options" @@ -289,7 +289,7 @@ msgstr "fel" #: anchordockstr.adrstouseanchordockingyoumustfirstuninstall msgid "To use anchordocking you must first uninstall %s" -msgstr "A lehorgonyzás használatához először el kell távolítani ezt: %s" +msgstr "Az ablakok rögzítésének használatához először el kell távolítani ezt: %s" #: anchordockstr.adrsundock msgid "Undock" diff --git a/components/ideintf/languages/objinspstrconsts.hu.po b/components/ideintf/languages/objinspstrconsts.hu.po index d26bb01fc0..4d22368525 100644 --- a/components/ideintf/languages/objinspstrconsts.hu.po +++ b/components/ideintf/languages/objinspstrconsts.hu.po @@ -655,19 +655,19 @@ msgstr "Beállítások" #: objinspstrconsts.oisorderbackone msgid "Back One" -msgstr "Egyet hátra" +msgstr "Hátrább eggyel" #: objinspstrconsts.oisorderforwardone msgid "Forward One" -msgstr "Egyet előre" +msgstr "Előbbre eggyel" #: objinspstrconsts.oisordermovetoback msgid "Move to Back" -msgstr "Háttérbe visz" +msgstr "Háttérbe" #: objinspstrconsts.oisordermovetofront msgid "Move to Front" -msgstr "Előtérbe hoz" +msgstr "Előtérbe" #: objinspstrconsts.oispastecomponents msgctxt "objinspstrconsts.oispastecomponents" diff --git a/components/lazreport/source/languages/lr_const.hu.po b/components/lazreport/source/languages/lr_const.hu.po index 58cb286ab5..8af6cceb0b 100644 --- a/components/lazreport/source/languages/lr_const.hu.po +++ b/components/lazreport/source/languages/lr_const.hu.po @@ -178,7 +178,7 @@ msgstr "Kód" #: lr_const.sbarcodeformdbfld msgctxt "lr_const.sbarcodeformdbfld" msgid "Insert DB field" -msgstr "Adatbázis-mező beszúrása" +msgstr "Adatbázismező beszúrása" #: lr_const.sbarcodeformopts msgctxt "lr_const.sbarcodeformopts" @@ -681,7 +681,7 @@ msgstr "Elérhető adatbázisok" #: lr_const.sfieldsforminsert msgctxt "lr_const.sfieldsforminsert" msgid "Insert DB field" -msgstr "Adatbázis-mező beszúrása" +msgstr "Adatbázismező beszúrása" #: lr_const.sfilenotfound msgid "File not found" @@ -903,7 +903,7 @@ msgstr "Teljes keret" #: lr_const.sfrdesignerformback msgid "Send to back" -msgstr "Háttérbeküldés" +msgstr "Háttérbe helyezés" #: lr_const.sfrdesignerformbackcolor msgid "Background color" @@ -923,7 +923,7 @@ msgstr "Alsó keretvonal" #: lr_const.sfrdesignerformbring msgid "Bring to front" -msgstr "Előtérbehozás" +msgstr "Előtérbe helyezés" #: lr_const.sfrdesignerformcapt msgctxt "lr_const.sfrdesignerformcapt" @@ -1164,7 +1164,7 @@ msgstr "Igazítás" #: lr_const.sfrdesignerform_back msgid "Send to &back" -msgstr "Háttérbeküldés" +msgstr "Háttérbe helyezés" #: lr_const.sfrdesignerform_beforeprintscript msgid "&Before print script ..." @@ -1172,7 +1172,7 @@ msgstr "Nyomtatás előtti szkript ..." #: lr_const.sfrdesignerform_bring msgid "Bring to &front" -msgstr "Előtérbehozás " +msgstr "Előtérbe helyezés" #: lr_const.sfrdesignerform_copy msgid "&Copy" @@ -1362,7 +1362,7 @@ msgstr "Nyújtás" #: lr_const.sgroupeditorformadddbfield msgctxt "lr_const.sgroupeditorformadddbfield" msgid "Insert DB field" -msgstr "Adatbázis-mező beszúrása" +msgstr "Adatbázismező beszúrása" #: lr_const.sgroupeditorformcapt msgid "Group" @@ -1453,7 +1453,7 @@ msgstr "Kifejezés beszúrása" #: lr_const.sinsertfields msgid "Insert DB fields" -msgstr "Adatbázismező beszúrása" +msgstr "Adatbázismezők beszúrása" #: lr_const.sinsertfieldsformaviabledset msgid "&Available datasets" diff --git a/components/leakview/languages/heaptrcview.hu.po b/components/leakview/languages/heaptrcview.hu.po index 143f60b94f..475fdd883f 100644 --- a/components/leakview/languages/heaptrcview.hu.po +++ b/components/leakview/languages/heaptrcview.hu.po @@ -49,7 +49,7 @@ msgstr "Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet #: heaptrcview.sfrmselectfilewithdebuginfo msgid "Select File with debug info" -msgstr "Válasszon fájlt hibakeresési infókkal!" +msgstr "Hibakeresési infókat tartalmazó fájl választása" #: heaptrcview.slbltrace msgid ".trc file" diff --git a/components/turbopower_ipro/languages/ipconst.hu.po b/components/turbopower_ipro/languages/ipconst.hu.po index 00b4f9082c..8962ec5db7 100644 --- a/components/turbopower_ipro/languages/ipconst.hu.po +++ b/components/turbopower_ipro/languages/ipconst.hu.po @@ -29,7 +29,7 @@ msgstr "Betöltés gyorsítótárból (%s = %s)" #: ipconst.httpcantloadgraphic msgid "Unable to load graphic %s" -msgstr "" +msgstr "Nem lehet betölteni a grafikát: %s" #: ipconst.httpconnect msgid "Connected: (%s)" @@ -284,7 +284,7 @@ msgstr "Az átvitelt a felhasználó megszakította" #: ipconst.shtmlcharstackoverfl msgid "Character stack overflow" -msgstr "" +msgstr "Karakter-verem túlcsordulás" #: ipconst.shtmldashexp msgid "- expected" @@ -1613,11 +1613,11 @@ msgstr "Hitelesítés újrapróbálása" #: ipconst.srascallbackcomplete msgid "Callback complete" -msgstr "" +msgstr "Visszahívás kész" #: ipconst.srascallbacksetbycaller msgid "Callback set by caller" -msgstr "" +msgstr "Visszahívás beállítva a hívó által" #: ipconst.srasconnectdevice msgid "Connect device" @@ -1666,7 +1666,7 @@ msgstr "Port megnyitva" #: ipconst.srasprepareforcallback msgid "Prepare for callback" -msgstr "" +msgstr "Visszahívás előkészítése" #: ipconst.srasprojected msgid "Projected" @@ -1694,7 +1694,7 @@ msgstr "" #: ipconst.sraswaitforcallback msgid "Wait for callback" -msgstr "" +msgstr "Várakozás visszahívásra" #: ipconst.sraswaitformodemreset msgid "Wait for modem reset" @@ -1734,7 +1734,7 @@ msgstr "Siker," #: ipconst.ssmtpresponse04 msgid "Transient, " -msgstr "" +msgstr "Átmenő, " #: ipconst.ssmtpresponse05 msgid "Persistent, " @@ -1842,7 +1842,7 @@ msgstr "" #: ipconst.ssmtpresponse46 msgid "Routing loop detected" -msgstr "" +msgstr "Útválasztás ismétlődése érzékelve" #: ipconst.ssmtpresponse47 msgid "Delivery time expired" @@ -2028,7 +2028,7 @@ msgstr "A puffer mérete nem egyezik." #: ipconst.ssslclosenotify msgid "Server sent close notify." -msgstr "" +msgstr "A kiszolgáló lezárási értesítést küldött." #: ipconst.ssslcompressionfailure msgid "Compression failure." @@ -2255,7 +2255,7 @@ msgstr "%s nem található" #: ipconst.swebimagestreambad msgid "Cannot load image from stream" -msgstr "" +msgstr "Nem lehet képet betölteni az adatfolyamból" #: ipconst.swinsockerr msgid "WinSock Error (%d): %s, on API '%s'" @@ -2263,7 +2263,7 @@ msgstr "WinSock hiba (%d): %s, a következő API-n: '%s'" #: ipconst.swriteafterrename msgid "***Write after rename" -msgstr "" +msgstr "***Írás átnevezés után" #: ipconst.swrongstateerr msgid "Can not comply, wrong state" @@ -2315,7 +2315,7 @@ msgstr "Célcím szükséges" #: ipconst.swsaediscon msgid "Graceful shutdown in progress" -msgstr "" +msgstr "Rendes lekapcsolás folyamatban" #: ipconst.swsaedquot msgid "Disk quota exceeded" @@ -2440,7 +2440,7 @@ msgstr "Elutasítva" #: ipconst.swsaeremote msgid "Too many levels of remote in path" -msgstr "" +msgstr "Túl sok szint a távoli útvonalban" #: ipconst.swsaeshutdown msgid "Cannot send after socket shutdown" @@ -2480,7 +2480,7 @@ msgstr "Sikeres WSAStartup még nem lett végrehajtva" #: ipconst.swsano_data msgid "Valid name, no data record of requested type" -msgstr "" +msgstr "Érvényes név, nincs adatrekord a kért típussal" #: ipconst.swsano_recovery msgid "This is a nonrecoverable error" @@ -2504,7 +2504,7 @@ msgstr "" #: ipconst.swsatype_not_found msgid "Type not found" -msgstr "" +msgstr "Típus nem található" #: ipconst.swsavernotsupported msgid "WinSock DLL version not supported" diff --git a/languages/lazaruside.hu.po b/languages/lazaruside.hu.po index b6f14421a3..13a9e819af 100644 --- a/languages/lazaruside.hu.po +++ b/languages/lazaruside.hu.po @@ -442,7 +442,7 @@ msgstr "Szinkron szerkesztés" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" -msgstr "Sablon szerkesztés" +msgstr "Sablon szerkesztése" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" @@ -692,7 +692,7 @@ msgstr "Blokk behúzás (tab-ok)" #: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0." -msgstr "A keret-térköz beállítható a Horgony szerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0." +msgstr "A keret-térköz beállítható a Horgonyszerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0." #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" @@ -814,7 +814,7 @@ msgstr "A form csomagokat igényelhet a működéshez. Az ilyen csomagok automat #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" -msgstr "Válasszon kódsablon fájlt! (*.dcl)" +msgstr "Kódsablon fájl választása (*.dci)" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" @@ -3383,11 +3383,11 @@ msgstr "Tükrözés függőlegesen" #: lazarusidestrconsts.fdmorderbackone msgid "Back One" -msgstr "Egyet hátra" +msgstr "Hátrább eggyel" #: lazarusidestrconsts.fdmorderforwardone msgid "Forward One" -msgstr "Egyet előre" +msgstr "Előbbre eggyel" #: lazarusidestrconsts.fdmordermovetoback msgid "Move to Back" @@ -5114,7 +5114,7 @@ msgstr "%s Ellenőrizze a célt (OS, CPU, LCL vezérlőkészlet típusa)! Talán #: lazarusidestrconsts.lischeckuncheckall msgid "Check/uncheck all" -msgstr "" +msgstr "Minden/Semmi kijelölése" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" @@ -5549,7 +5549,7 @@ msgstr "Konstansok kihagyása a következő függvényekben" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" -msgstr "Meg nem nevezett karakter konstansok megkeresése" +msgstr "Névtelen karakter konstansok megkeresése" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" @@ -5567,7 +5567,7 @@ msgstr "Sablon hozzáadása" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" -msgstr "Kód sablon hozzáadása" +msgstr "Kódsablon hozzáadása" #: lazarusidestrconsts.liscodetemplatokenalreadyexists msgid " A token \"%s\" already exists! " @@ -5588,7 +5588,7 @@ msgstr "Megjegyzés:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" -msgstr "Kód sablon szerkesztése" +msgstr "Kódsablon szerkesztése" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" @@ -5991,7 +5991,7 @@ msgstr "Szimbólum" #: lazarusidestrconsts.liscodetoolstemplatefile msgid "CodeTools template file" -msgstr "CodeTools sablon fájl" +msgstr "CodeTools sablonfájl" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" @@ -7010,7 +7010,7 @@ msgstr "Alapértelmezett szín" #: lazarusidestrconsts.lisdbgenexceptionraised msgid "Exception Raised" -msgstr "Kivétel Keletkezett" +msgstr "Kivétel keletkezett" #: lazarusidestrconsts.lisdbgenmoduleload msgid "Module Load" @@ -7042,11 +7042,11 @@ msgstr "Szál indítása" #: lazarusidestrconsts.lisdbgenwindowsmessageposted msgid "Windows Message Posted" -msgstr "Windows üzenet küldése" +msgstr "Küldött Windows üzenet" #: lazarusidestrconsts.lisdbgenwindowsmessagesent msgid "Windows Message Sent" -msgstr "Küldött Windows üzenet" +msgstr "Windows üzenet elküldve" #: lazarusidestrconsts.lisdbgitemdeletehint msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" @@ -7719,15 +7719,15 @@ msgstr "Kijelölt komponensek kivágása a vágólapra" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" -msgstr "Komponens eggyel hátra" +msgstr "Komponens mozgatása eggyel hátrább" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" -msgstr "Komponens eggyel előre" +msgstr "Komponens mozgatása eggyel előbbre" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" -msgstr "Komponens háttérbe rakása" +msgstr "Komponens háttérbe küldése" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" @@ -8252,7 +8252,7 @@ msgstr "Példák:%sAzonosító%sTMyEnum.Enum%sUnitnév.Azonosító%s#Csomagnév. #: lazarusidestrconsts.lisexamplesopenfirstselected msgid "Open first selected" -msgstr "Első kijelölt megynitása" +msgstr "Első kijelölt megnyitása" #: lazarusidestrconsts.lisexceptiondialog msgid "Debugger Exception Notification" @@ -8926,7 +8926,7 @@ msgstr "Ugrás adott sorra" #: lazarusidestrconsts.lisgotoselected msgid "Goto selected" -msgstr "" +msgstr "Ugrás a kijelöltre" #: lazarusidestrconsts.lisgplnotice msgid "" @@ -9677,11 +9677,11 @@ msgstr "Kiadások" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe msgid "I wonder how you did that. Error in the %s:" -msgstr "Hát, ez nagyon furcsa. Hiba itt: %s:" +msgstr "Nahát, ez nagyon furcsa. Hiba itt: %s:" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory msgid "I wonder how you did that: Error in the base directory:" -msgstr "Hát, ez nagyon furcsa: Hiba az alapkönyvtárban:" +msgstr "Nahát, ez nagyon furcsa: Hiba az alapkönyvtárban:" #: lazarusidestrconsts.lisjhjumphistory msgctxt "lazarusidestrconsts.lisjhjumphistory" @@ -11008,7 +11008,7 @@ msgstr "Sz&erkesztés" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." -msgstr "Kód sablonok ..." +msgstr "Kódsablonok ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" @@ -11133,7 +11133,7 @@ msgstr "Azonosító hivatkozásainak megkeresése ..." #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in Files ..." -msgstr "Keresés fájlokban ..." +msgstr "Keresés a fájlokban ..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" @@ -11358,7 +11358,7 @@ msgstr "Projekt megnyitása ..." #: lazarusidestrconsts.lismenuopenrecent msgid "Open &Recent" -msgstr "Legutóbbi megynyitása" +msgstr "Legutóbbi megnyitása" #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open Recent Package" @@ -15344,7 +15344,7 @@ msgstr "Csomagok megjelenítése" #: lazarusidestrconsts.lisshowpositionofsourceeditor msgid "Show position of source editor" -msgstr "Váltás a forráskódbeli helyére" +msgstr "Váltás a forráskódbeli helyzetére" #: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop msgid "Show recently used identifiers at top" @@ -17986,11 +17986,11 @@ msgstr "Egyidejű szerkesztés (kijelölés közben)" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" -msgstr "Sablon szerkesztés" +msgstr "Sablon szerkesztése" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" -msgstr "Sablon szerkesztés (kurzor cellán kívül)" +msgstr "Sablon szerkesztése (kurzor cellán kívül)" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" @@ -18043,7 +18043,7 @@ msgstr "Csatolás programhoz " #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" -msgstr "Kód sablon kiegészítés" +msgstr "Kódsablon kiegészítése" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" @@ -18322,7 +18322,7 @@ msgstr "Azonosító hivatkozásainak megkeresése" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in Files" -msgstr "Keresés fájlokban" +msgstr "Keresés a fájlokban" #: lazarusidestrconsts.srkmecfindnext msgctxt "lazarusidestrconsts.srkmecfindnext" diff --git a/tools/lazdatadesktop/languages/lazdatadesktop.hu.po b/tools/lazdatadesktop/languages/lazdatadesktop.hu.po index 07c8c59c9c..2d804d34cb 100644 --- a/tools/lazdatadesktop/languages/lazdatadesktop.hu.po +++ b/tools/lazdatadesktop/languages/lazdatadesktop.hu.po @@ -213,11 +213,11 @@ msgstr "Külső kulcs hozzáadása a táblához" #: lazdatadeskstr.sld_actionaddsequence msgid "New sequence" -msgstr "Új sorrend" +msgstr "Új sorozat" #: lazdatadeskstr.sld_actionaddsequenceh msgid "Add a sequence" -msgstr "Sorrend hozzáadása" +msgstr "Sorozat hozzáadása" #: lazdatadeskstr.sld_actionclose msgid "&Close" @@ -346,7 +346,7 @@ msgstr "A kiválasztott legutóbbi kapcsolat megnyitása" #: lazdatadeskstr.sld_actionopenh msgid "Open a new Data Dictionary" -msgstr "Új adatszótár megnyitása" +msgstr "Egy új adatszótár megnyitása" #: lazdatadeskstr.sld_actionopenrecentdatadict msgid "Open" @@ -399,7 +399,7 @@ msgstr "Meghajtó" #: lazdatadeskstr.sld_connectionlv3 msgid "Last used" -msgstr "Legutóbb használt" +msgstr "Utolsó használat" #: lazdatadeskstr.sld_connectionlv4 msgctxt "lazdatadeskstr.sld_connectionlv4" @@ -531,7 +531,7 @@ msgstr "Fájlnév" #: lazdatadeskstr.sld_recentlv3 msgid "Last used on" -msgstr "Utolsó használat:" +msgstr "Utolsó használat" #: lazdatadeskstr.sld_savefileasfilter msgctxt "lazdatadeskstr.sld_savefileasfilter" @@ -644,7 +644,7 @@ msgstr "Új %s létrehozása" #: lazdatadeskstr.snewsequence msgid "Create new sequence" -msgstr "Új sorozat étrehozása" +msgstr "Új sorozat létrehozása" #: lazdatadeskstr.snewsequencename msgid "Enter a name for the new sequence:" @@ -698,7 +698,7 @@ msgstr "Index beállítások:" #: lazdatadeskstr.snodesequences msgid "Sequences" -msgstr "Sorrendek" +msgstr "Sorozatok" #: lazdatadeskstr.snodetabledata msgid "Table Data" @@ -738,7 +738,7 @@ msgstr "Változások mentése" #: lazdatadeskstr.sselectdbfdir msgid "Select a directory with DBF files" -msgstr "Válasszon könyvtárat a DBF fájlok számára!" +msgstr "Könyvtár választása a DBF fájlok számára" #: lazdatadeskstr.sselectedobject msgid "Selected object" @@ -746,7 +746,7 @@ msgstr "Kiválasztott objektum" #: lazdatadeskstr.ssequence msgid "Sequence" -msgstr "Sorrend" +msgstr "Sorozat" #: lazdatadeskstr.ssqlfilters msgid "SQL files|*.sql|All files|*.*"