From c91b1321e09f221a14058050a3d01537ebcaf373 Mon Sep 17 00:00:00 2001 From: maxim Date: Fri, 8 Feb 2019 23:14:55 +0000 Subject: [PATCH] Translations: French translation update by Gilles Vasseur, bug #35034 git-svn-id: trunk@60368 - --- .../languages/anchordockstr.fr.po | 6 +- .../idehelp/languages/lazchmhelp.fr.po | 8 +- .../ide/languages/codystrconsts.fr.po | 36 +-- .../languages/codetoolsstrconsts.fr.po | 60 ++--- .../datadict/languages/ldd_consts.fr.po | 20 +- components/fppkg/languages/fppkg_const.fr.po | 10 +- components/fppkg/languages/lazarusfppkg.fr.po | 17 +- .../fpweb/languages/fpwebstrconsts.fr.po | 42 +-- .../fpweb/languages/frmrpcmoduleoptions.fr.po | 6 +- .../fpweb/languages/weblazideintf.fr.po | 38 +-- .../h2pas/languages/h2passtrconsts.fr.po | 100 +++---- .../ideintf/languages/objinspstrconsts.fr.po | 20 +- .../languages/instantfpcregisterlaz.fr.po | 10 +- .../lazarus/languages/jcfideregister.fr.po | 8 +- .../lazarus/languages/jcfuiconsts.fr.po | 28 +- .../languages/gdbmistringconstants.fr.po | 16 +- .../editor/languages/calleditorwithpkg.fr.po | 18 +- .../languages/le_e_spreadsheet_consts.fr.po | 14 +- .../lazthread/languages/reglazthread.fr.po | 4 +- .../languages/threadoptionsdialog.fr.po | 14 +- .../leakview/languages/heaptrcview.fr.po | 12 +- .../macroscript/languages/emsstrings.fr.po | 10 +- .../memds/languages/frmselectdataset.fr.po | 2 +- .../languages/messagecomposer.fr.po | 12 +- .../languages/opkman_const.fr.po | 58 +---- .../languages/opkman_zip.fr.po | 6 +- .../pochecker/languages/pocheckerconsts.fr.po | 65 ++--- .../languages/projectgroupstrconst.fr.po | 17 +- .../sqlstringspropertyeditordlg.fr.po | 12 +- .../sqlite/languages/sqlitecompstrings.fr.po | 4 +- .../turbopower_ipro/languages/ipconst.fr.po | 74 +++--- languages/debuggerstrconst.fr.po | 2 +- languages/lazaruside.fr.po | 244 +++++------------- tools/glazres/languages/glazres.fr.po | 14 +- tools/jsonviewer/languages/jsonviewer.fr.po | 12 +- .../languages/lazdatadesktop.fr.po | 46 ++-- 36 files changed, 418 insertions(+), 647 deletions(-) diff --git a/components/anchordocking/languages/anchordockstr.fr.po b/components/anchordocking/languages/anchordockstr.fr.po index 1ea4b493df..1978f7274e 100644 --- a/components/anchordocking/languages/anchordockstr.fr.po +++ b/components/anchordocking/languages/anchordockstr.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2018-11-28 17:23+0100\n" +"PO-Revision-Date: 2019-02-07 09:11+0100\n" "Last-Translator: Vasseur Gilles \n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.1.1\n" +"X-Generator: Poedit 2.2.1\n" #: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\"" @@ -37,7 +37,7 @@ msgstr "Ancre du mauvais côté du séparateur : Nœud = \"%s\" Ancres[%s] = \"% #: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\"" -msgstr "Une page doit être ancrée : Nœud = \"%s\" Parent = %s Type du parent = %s Ancres[%s] = \"%s\"" +msgstr "Une page ne doit pas être ancrée : Nœud = \"%s\" Parent = %s Type du parent = %s Ancres[%s] = \"%s\"" #: anchordockstr.adrsautomatically msgid "Automatically" diff --git a/components/chmhelp/packages/idehelp/languages/lazchmhelp.fr.po b/components/chmhelp/packages/idehelp/languages/lazchmhelp.fr.po index 7155d89304..4b5b351ddb 100644 --- a/components/chmhelp/packages/idehelp/languages/lazchmhelp.fr.po +++ b/components/chmhelp/packages/idehelp/languages/lazchmhelp.fr.po @@ -5,11 +5,11 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Vasseur Gilles \n" -"Language-Team: Vasseur Gilles \n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: lazchmhelp.help_category_idecmd msgid "CHM Help" @@ -25,9 +25,9 @@ msgstr "&Aide" #: lazchmhelp.help_missinglhelp msgid "Missing lhelp" -msgstr "\"lhelp\" absent" +msgstr "Lhelp absent" #: lazchmhelp.help_unabletofindthelhelpviewerpleasecompilethelhelppro msgid "Unable to find the lhelp viewer:%s%s%sPlease compile the lhelp project:%s%s" -msgstr "Impossible de trouver l'afficheur d'aide \"lhelp\" :%s%s%sVeuillez compiler le projet \"lhelp\" :%s%s" +msgstr "Impossible de trouver l'afficheur d'aide lhelp :%s%s%sVeuillez compiler le projet lhelp :%s%s" diff --git a/components/codetools/ide/languages/codystrconsts.fr.po b/components/codetools/ide/languages/codystrconsts.fr.po index cc3296784c..590879c86f 100644 --- a/components/codetools/ide/languages/codystrconsts.fr.po +++ b/components/codetools/ide/languages/codystrconsts.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2017-05-24 09:26+0200\n" +"PO-Revision-Date: 2019-02-07 09:32+0100\n" "Last-Translator: Vasseur Gilles \n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.1\n" +"X-Generator: Poedit 2.2.1\n" #: codystrconsts.crsaddassignmethod msgid "Add Assign Method" @@ -62,11 +62,11 @@ msgstr "&OK" #: codystrconsts.crsbyfpccfg msgid "by fpc.cfg" -msgstr "par \"fpc.cfg\"" +msgstr "par fpc.cfg" #: codystrconsts.crscamaddassignmethodtoclass msgid "Add Assign method to class %s" -msgstr "Ajoutez la méthode \"Assign\" à la classe %s" +msgstr "Ajoutez la méthode Assign à la classe %s" #: codystrconsts.crscamcallinherited msgid "Call inherited" @@ -268,11 +268,11 @@ msgstr "Erreur" #: codystrconsts.crscwpleaseplacethecursorofthesourceeditoronawithvariab msgid "Please place the cursor of the source editor on a With variable." -msgstr "Veuillez placer le curseur de l'éditeur de source sur une variable \"Width\"." +msgstr "Veuillez placer le curseur de l'éditeur de source sur une variable With." #: codystrconsts.crsdeclarevariable msgid "Declare Variable" -msgstr "Déclarer la variable :" +msgstr "Déclarer la variable" #: codystrconsts.crsdeclarevariable2 msgid "Declare Variable ..." @@ -280,7 +280,7 @@ msgstr "Déclarer la variable..." #: codystrconsts.crsdeclarevariable3 msgid "Declare variable \"%s\"" -msgstr "Déclarer la variable \"%s\"" +msgstr "Déclarer la variable \"%s\"" #: codystrconsts.crsdeletepackage msgid "Delete package?" @@ -304,7 +304,7 @@ msgstr "Erreur : %s" #: codystrconsts.crserrorcursorisnotinaprojectunit msgid "Error: cursor is not in a project unit" -msgstr "Erreur : le curseur n'est pas une unité de projet" +msgstr "Erreur : le curseur n'est pas dans une unité de projet" #: codystrconsts.crserrorneedsourceeditoratprocedurecallordeclaration msgid "Error: Need source editor at procedure call or declaration" @@ -368,7 +368,7 @@ msgstr "Drapeaux" #: codystrconsts.crsfpcunitwithoutppu msgid "FPC unit without ppu" -msgstr "Unité FPC sans \"PPU\"" +msgstr "Unité FPC sans ppu" #: codystrconsts.crsframeworks msgid "Frameworks" @@ -461,7 +461,7 @@ msgstr "Aller à" #: codystrconsts.crskbytes msgid "kbytes" -msgstr "Kilo-octets" +msgstr "kilo-octets" #: codystrconsts.crslinkedfiles msgid "Linked files" @@ -593,7 +593,7 @@ msgstr "Erreur de lecture" #: codystrconsts.crspastelinesofagdbbacktrace msgid "Paste lines of a gdb backtrace:" -msgstr "Coller les lignes de trace de \"gdb\" :" +msgstr "Coller les lignes de trace de gdb :" #: codystrconsts.crspleaseopenaprojectfirst msgid "Please open a project first." @@ -613,7 +613,7 @@ msgstr "Veuillez sélectionner du code dans l'éditeur de source." #: codystrconsts.crspleaseselectsomecodeinthesourceeditorforanewwithbl msgid "Please select some code in the Source Editor for a new \"With\" block. No candidate for a with expression was found." -msgstr "Veuillez sélectionner du code dans l'éditeur de source pour un nouveau bloc \"With\". Aucun candidat pour une expression \"With\" n'a été trouvé." +msgstr "Veuillez sélectionner du code dans l'éditeur de source pour un nouveau bloc With. Aucun candidat pour une expression With n'a été trouvé." #: codystrconsts.crspleasespecifyalocation msgid "Please specify a location" @@ -629,7 +629,7 @@ msgstr "\"PPU\" : %s" #: codystrconsts.crsppufilesofproject msgid "PPU files of project \"%s\"" -msgstr "Fichiers \"PPU\" du projet \"%s\"" +msgstr "Fichiers PPU du projet \"%s\"" #: codystrconsts.crsprivate msgid "Private" @@ -713,7 +713,7 @@ msgstr "Afficher les informations du nœud des outils de code..." #: codystrconsts.crsshowcodydict msgid "Show Cody Dictionary for \"%s\"" -msgstr "Afficher le dictionnaire \"Cody\" pour \"%s\"" +msgstr "Afficher le dictionnaire Cody pour \"%s\"" #: codystrconsts.crsshowonlyidentifierscontainingfiltertext msgid "Show only identifiers containing filter text" @@ -729,15 +729,15 @@ msgstr "Afficher le dictionnaire des unités/identificateurs" #: codystrconsts.crsshowusedppufiles msgid "Show Used .ppu Files ..." -msgstr "Afficher les fichiers \".PPU\" utilisés" +msgstr "Afficher les fichiers .ppu utilisés" #: codystrconsts.crssizeofofile msgid "Size of .o file" -msgstr "Taille du fichier \".o\"" +msgstr "Taille du fichier .o" #: codystrconsts.crssizeofppufile msgid "Size of .ppu file" -msgstr "Taille du fichier \".ppu\"" +msgstr "Taille du fichier .ppu" #: codystrconsts.crssource msgid "Source: %s" @@ -761,7 +761,7 @@ msgstr "L'identificateur \"%s\" déjà défini." #: codystrconsts.crsthereisalreadyanotherpackageloadedwiththesamenameo msgid "There is already another package loaded with the same name.%sOpen package: %s%sNew package: %s%sOnly one package can be loaded at a time." -msgstr "Il y a déjà un paquet chargé portant le même nom.%sPaquet ouvert : %s%sNouveau paquet : %s%sSeul un paquet peut être chargé à un moment donné." +msgstr "Il y a déjà un paquet chargé portant le même nom.%sPaquet ouvert : %s%sNouveau paquet : %s%sUn seul paquet peut être chargé à un moment donné." #: codystrconsts.crsthetargetunithasthesamenameasthecurrentunitfreepas msgid "The target unit has the same name as the current unit.%s Free Pascal does not support that." diff --git a/components/codetools/languages/codetoolsstrconsts.fr.po b/components/codetools/languages/codetoolsstrconsts.fr.po index 66603994eb..89b693c7b4 100644 --- a/components/codetools/languages/codetoolsstrconsts.fr.po +++ b/components/codetools/languages/codetoolsstrconsts.fr.po @@ -3,14 +3,14 @@ msgstr "" "Project-Id-Version: lazaruside\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2017-10-20 16:30+0200\n" +"PO-Revision-Date: 2019-02-07 09:24+0100\n" "Last-Translator: Vasseur Gilles \n" "Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Poedit 2.0.4\n" +"X-Generator: Poedit 2.2.1\n" #: codetoolsstrconsts.crsbracketnotfound msgid "bracket ) not found" @@ -18,7 +18,7 @@ msgstr "parenthèse \")\" introuvable" #: codetoolsstrconsts.crsbracketnotfound2 msgid "bracket ] not found" -msgstr "crochet \"]\" introuvable" +msgstr "crochet ] introuvable" #: codetoolsstrconsts.crsclosingbracketnotfound msgid "closing bracket not found" @@ -34,11 +34,11 @@ msgstr "fin d'enregistrement non trouvée" #: codetoolsstrconsts.ctsaddsdirtoincludepath msgid "adds %s to IncPath" -msgstr "ajoute %s à \"IncPath\"" +msgstr "ajoute %s à IncPath" #: codetoolsstrconsts.ctsaddsdirtosourcepath msgid "adds %s to SrcPath" -msgstr "ajoute %s à \"SrcPath\"" +msgstr "ajoute %s à SrcPath" #: codetoolsstrconsts.ctsancestorisnotproperty msgid "ancestor of untyped property is not a property" @@ -130,7 +130,7 @@ msgstr "Fin de commentaire non trouvée" #: codetoolsstrconsts.ctscompiledsrcpath msgid "Compiled SrcPath" -msgstr "\"SrcPath\" compilé" +msgstr "SrcPath compilé" #: codetoolsstrconsts.ctscompiler msgid "Compiler" @@ -166,7 +166,7 @@ msgstr "ancêtre par défaut %s introuvable" #: codetoolsstrconsts.ctsdefaultclassancestortobjectnotfound msgid "default class ancestor TObject not found" -msgstr "ancêtre de classe par défaut (\"TObject\") non trouvé" +msgstr "ancêtre de classe par défaut (TObject) non trouvé" #: codetoolsstrconsts.ctsdefaultdispinterfaceancestoridispatchnotfound msgid "default dispinterface ancestor IDispatch not found" @@ -194,11 +194,11 @@ msgstr "Processeur cible par défaut de FPC" #: codetoolsstrconsts.ctsdefaultinterfaceancestoriinterfacenotfound msgid "default interface ancestor IInterface not found" -msgstr "ancêtre par défaut d'une interface (\"IInterface\") non trouvé" +msgstr "ancêtre par défaut d'une interface (IInterface) non trouvé" #: codetoolsstrconsts.ctsdefaultjavaclassancestorjlobjectnotfound msgid "default java class ancestor JLObject not found" -msgstr "ancêtre par défaut d'une classe Java (\"JLObkect\") introuvable" +msgstr "ancêtre par défaut d'une classe Java (JLObkect) introuvable" #: codetoolsstrconsts.ctsdefaultparameterexpectedbutatomfound msgid "default parameter expected, but %s found" @@ -214,7 +214,7 @@ msgstr "spécificateur par défaut redéfini" #: codetoolsstrconsts.ctsdefine msgid "Define " -msgstr "Définir" +msgstr "Définir " #: codetoolsstrconsts.ctsdefinelcl msgid "Define LCL" @@ -222,7 +222,7 @@ msgstr "Définir LCL" #: codetoolsstrconsts.ctsdefinelclwidgetset msgid "Define LCLwidgetset, e.g. LCLgtk" -msgstr "Définir les éléments graphiques LCL (par exemple : \"LCLgtk\")" +msgstr "Définir les éléments graphiques LCL (par exemple : LCLgtk)" #: codetoolsstrconsts.ctsdefinemacroname msgid "Define Macro %s" @@ -246,7 +246,7 @@ msgstr "paramètre de \"DISPID\" attendu, mais %s trouvé" #: codetoolsstrconsts.ctsdispidspecifierredefined msgid "dispid specifier redefined" -msgstr "spécificateur de \"DISPID\" redéfini" +msgstr "spécificateur de DISPID redéfini" #: codetoolsstrconsts.ctsdoceditordirectory msgid "Doc Editor Directory" @@ -314,15 +314,15 @@ msgstr "type de méthode attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexpectedbutfound msgid "expected (, but found %s" -msgstr "\"(\" attendu, mais %s trouvé" +msgstr "( attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexpectedbutfound2 msgid "expected ), but found %s" -msgstr "\")\" attendu, mais %s trouvé" +msgstr ") attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexpectedbutfound3 msgid "expected :=, but %s found" -msgstr "\":=\" attendu, mais %s trouvé" +msgstr ":= attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexpectedidentifierbutfound msgid "expected identifier, but found %s" @@ -330,7 +330,7 @@ msgstr "identificateur attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexpectedsemicolonofstatementbutfound msgid "expected ; of statement, but found %s" -msgstr "\";\" de l'instruction attendu, mais %s trouvé" +msgstr "; de l'instruction attendu, mais %s trouvé" #: codetoolsstrconsts.ctsexportsclauseonlyallowedinlibraries msgid "exports clause only allowed in libraries" @@ -354,7 +354,7 @@ msgstr "Définition \"Forward\" de classe non résolue : %s" #: codetoolsstrconsts.ctsfpdocsystemon msgid "enable FPDocSystem" -msgstr "activer \"FPDocSystem\"" +msgstr "activer FPDocSystem" #: codetoolsstrconsts.ctsfreepascalcompilerinitialmacros msgid "Free Pascal Compiler initial macros" @@ -392,7 +392,7 @@ msgstr "Contient une erreur" #: codetoolsstrconsts.ctshelperisnotallowed msgid "Helper after %s is not allowed" -msgstr "\"Helper\" après \"%s\" n'est pas autorisé" +msgstr "\"Helper\" après %s n'est pas autorisé" #: codetoolsstrconsts.ctsidedirectory msgid "IDE Directory" @@ -400,7 +400,7 @@ msgstr "Répertoire de l'EDI" #: codetoolsstrconsts.ctsidentexpectedbutatomfound msgid "identifier expected, but %s found" -msgstr "Identificateur attendu, mais %s trouvé" +msgstr "identificateur attendu, mais %s trouvé" #: codetoolsstrconsts.ctsidentexpectedbuteoffound msgid "unexpected end of file (identifier expected)" @@ -408,7 +408,7 @@ msgstr "fin de fichier inattendue (identificateur attendu)" #: codetoolsstrconsts.ctsidentexpectedbutkeywordfound msgid "identifier expected, but keyword %s found" -msgstr "Identificateur attendu, mais mot-clé %s trouvé" +msgstr "identificateur attendu, mais mot-clé %s trouvé" #: codetoolsstrconsts.ctsidentifier msgid "identifier" @@ -456,7 +456,7 @@ msgstr "utilisation circulaire de l'unité %s non permise" #: codetoolsstrconsts.ctsillegalqualifier msgid "illegal qualifier %s found" -msgstr "Qualificateur illégal %s trouvé" +msgstr "qualificateur illégal %s trouvé" #: codetoolsstrconsts.ctsimplementationnodenotfound msgid "implementation node not found" @@ -472,7 +472,7 @@ msgstr "répertoires d'inclusion : %s" #: codetoolsstrconsts.ctsincludefilenotfound msgid "include file not found \"%s\"" -msgstr "fichier inclus non trouvé \"%s\"" +msgstr "fichier inclus \"%s\" non trouvé" #: codetoolsstrconsts.ctsincompatibletypesgotexpected msgid "incompatibles types: expected \"%s\" but got \"%s\"" @@ -512,15 +512,15 @@ msgstr "nom de classe \"%s\" incorrect" #: codetoolsstrconsts.ctsinvalidflagvaluefordirective msgid "invalid flag value \"%s\" for directive %s" -msgstr "Valeur bascule \"%s\" incorrecte pour la directive %s" +msgstr "valeur bascule \"%s\" incorrecte pour la directive %s" #: codetoolsstrconsts.ctsinvalidmode msgid "invalid mode \"%s\"" -msgstr "Mode \"%s\" incorrect" +msgstr "mode \"%s\" incorrect" #: codetoolsstrconsts.ctsinvalidmodeswitch msgid "invalid mode switch \"%s\"" -msgstr "commutateur de mode incorrect : \"%s\"" +msgstr "commutateur de mode \"%s\" incorrect" #: codetoolsstrconsts.ctsinvalidoperator msgid "invalid operator %s" @@ -584,7 +584,7 @@ msgstr "type de la définition de la méthode non trouvée" #: codetoolsstrconsts.ctsmissing msgid "missing :=" -msgstr "\":=\" manquant" +msgstr ":= manquant" #: codetoolsstrconsts.ctsmissingenumlist msgid "missing enum list" @@ -608,7 +608,7 @@ msgstr "Projet %s" #: codetoolsstrconsts.ctsneededbymode msgid " (needed by mode \"%s\")" -msgstr "(nécessaire au mode \"%s\")" +msgstr " (nécessaire au mode \"%s\")" #: codetoolsstrconsts.ctsnesteddefinitionsarenotallowed msgid "Nested %s definitions are not allowed" @@ -718,7 +718,7 @@ msgstr "type de propriété attendu, mais %s trouvé" #: codetoolsstrconsts.ctspropertycurrentnotfound msgid "property Current not found" -msgstr "propriété \"Current\" non trouvée" +msgstr "propriété Current non trouvée" #: codetoolsstrconsts.ctspropertyspecifieralreadydefined msgid "property specifier already defined: %s" @@ -734,7 +734,7 @@ msgstr "Effacer toutes les définitions" #: codetoolsstrconsts.ctsresulttypeoffunctiongetenumeratornotfound msgid "result type of function GetEnumerator not found" -msgstr "type du résultat de la fonction \"GetEnumerator\" introuvable" +msgstr "type du résultat de la fonction GetEnumerator introuvable" #: codetoolsstrconsts.ctsruntimelibrary msgid "Runtime library" @@ -882,7 +882,7 @@ msgstr "(sous-descripteur %s inconnu)" #: codetoolsstrconsts.ctsunparsed msgid "Unparsed" -msgstr "non analysé" +msgstr "Non analysé" #: codetoolsstrconsts.ctsusedunitisnotapascalunit msgid "used unit is not a pascal unit" diff --git a/components/datadict/languages/ldd_consts.fr.po b/components/datadict/languages/ldd_consts.fr.po index 25e41e3076..363096230c 100644 --- a/components/datadict/languages/ldd_consts.fr.po +++ b/components/datadict/languages/ldd_consts.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2015-12-18 09:45+0100\n" +"PO-Revision-Date: 2019-02-07 11:53+0100\n" "Last-Translator: Vasseur Gilles \n" -"Language-Team: \n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.8.6\n" +"X-Generator: Poedit 2.2.1\n" #: ldd_consts.ldd_availablecodegenerators msgid "Available code generators" @@ -128,28 +128,20 @@ msgid "Applying data dictionary to field %s" msgstr "Application du dictionnaire de données au champ %s" #: ldd_consts.serrnodatadesktopdoselect -#, fuzzy -#| msgid "" -#| "Could not locate the database desktop application.\n" -#| "Would you like to select it ?\n" msgid "" "Could not locate the database desktop application.\n" "Would you like to select it ?" msgstr "" "Impossible de retrouver l'application de base de données pour bureau.\n" -"Voulez-vous la retrouver ?\n" +"Voulez-vous la retrouver ?" #: ldd_consts.serrnodatadictactive -#, fuzzy -#| msgid "" -#| "No datadictionary active.\n" -#| "Please set a data dictionary for the project\n" msgid "" "No datadictionary active.\n" "Please set a data dictionary for the project" msgstr "" "Aucun dictionnaire de données actif.\n" -"Veuillez définir un dictionnaire de données pour ce projet\n" +"Veuillez définir un dictionnaire de données pour ce projet" #: ldd_consts.serrselectdd msgid "Please select a known data dictionary" @@ -213,7 +205,7 @@ msgstr "Pas encore implémenté" #: ldd_consts.swarningnoddforfield msgid "Warning: No definition in data dictionary for field %s" -msgstr "Avertissement :aucune définition dans le dictionnaire de données pour le champ %s" +msgstr "Avertissement : aucune définition dans le dictionnaire de données pour le champ %s" #: ldd_consts.swrongselection msgid "Wrong selection count : %d" diff --git a/components/fppkg/languages/fppkg_const.fr.po b/components/fppkg/languages/fppkg_const.fr.po index aff200d28d..ba5517eef3 100644 --- a/components/fppkg/languages/fppkg_const.fr.po +++ b/components/fppkg/languages/fppkg_const.fr.po @@ -3,7 +3,7 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-16 07:54+0100\n" -"PO-Revision-Date: 2019-02-04 13:12+0100\n" +"PO-Revision-Date: 2019-02-07 09:39+0100\n" "Last-Translator: h.mira@free.fr\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" @@ -41,7 +41,7 @@ msgstr "Version du compilateur" #: fppkg_const.rscustomfpmakeoptions msgid "Custom fpmake options" -msgstr "Options personnalisées de \"fpmake\"" +msgstr "Options personnalisées de fpmake" #: fppkg_const.rsdefaultcompilerconfig msgid "Default compiler config" @@ -53,7 +53,7 @@ msgstr "Téléchargement" #: fppkg_const.rsfpmakecompilerconfig msgid "fpmake compiler config" -msgstr "configuration de \"fpmake\" du compilateur" +msgstr "configuration de fpmake du compilateur" #: fppkg_const.rsfppkgenvironmentoptions msgid "Fppkg" @@ -65,7 +65,7 @@ msgstr "Compilation" #: fppkg_const.rsfppkgoptions msgid "fppkg options" -msgstr "Options de \"fppkg\"" +msgstr "Options de fppkg" #: fppkg_const.rsfppkgsfailedresultds msgid "Fppkg %s failed: Result %d%s%s" @@ -97,7 +97,7 @@ msgstr "Dépôt local" #: fppkg_const.rsnofppkgexecutablefound msgid "No fppkg executable found" -msgstr "Aucun exécutable de \"fppkg\" trouvé" +msgstr "Aucun exécutable de fppkg trouvé" #: fppkg_const.rsoptions msgid "Options" diff --git a/components/fppkg/languages/lazarusfppkg.fr.po b/components/fppkg/languages/lazarusfppkg.fr.po index e4ce051c99..fae5b4d0c2 100644 --- a/components/fppkg/languages/lazarusfppkg.fr.po +++ b/components/fppkg/languages/lazarusfppkg.fr.po @@ -9,7 +9,7 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.2\n" +"X-Generator: Poedit 2.2.1\n" #: fppkg_mainfrm.sactarchivepackages msgid "create archive(s) for package(s)" @@ -37,7 +37,7 @@ msgstr "la réparation des paquets cassés" #: fppkg_mainfrm.sactinitializefppkg msgid "initialize fppkg" -msgstr "l'initialisation de \"fppkg\"" +msgstr "l'initialisation de fppkg" #: fppkg_mainfrm.sactinstallpackages msgid "install package(s)" @@ -52,11 +52,6 @@ msgid "update repository" msgstr "la mise à jour du dépôt" #: fppkg_mainfrm.serractionfailed -#, fuzzy -#| msgid "" -#| "Failed to %s: \n" -#| "\n" -#| "%s\n" msgid "" "Failed to %s: \n" "\n" @@ -64,7 +59,7 @@ msgid "" msgstr "" "%s a échoué :\n" "\n" -"%s\n" +"%s" #: fppkg_mainfrm.smsgactionsucceeded msgid "%s succeeded." @@ -246,7 +241,7 @@ msgstr "&Fermer" #: tinitializeoptionsform.fpcbuttonpanel.okbutton.caption msgctxt "tinitializeoptionsform.fpcbuttonpanel.okbutton.caption" msgid "&Write Fppkg configuration files" -msgstr "&Écrire les fichiers de configuration de \"Fppkg\"" +msgstr "&Écrire les fichiers de configuration de fppkg" #: tinitializeoptionsform.fpcdirectoryedit.texthint msgctxt "tinitializeoptionsform.fpcdirectoryedit.texthint" @@ -255,11 +250,11 @@ msgstr "Cet emplacement contient normalement l’exécutable du compilateur ains #: tinitializeoptionsform.initializefppkglabel.caption msgid "Create new configuration files for fppkg." -msgstr "Créer les fichiers de configuration pour Fppkg." +msgstr "Créer les fichiers de configuration pour fppkg." #: tinitializeoptionsform.initializelazaruslabel.caption msgid "Create new Lazarus configuration file for fppkg." -msgstr "Créer un nouveau fichier de configuration Lazarus pour \"fppkg\"." +msgstr "Créer un nouveau fichier de configuration Lazarus pour fppkg." #: tinitializeoptionsform.label1.caption msgid "Please give the location where FPC is installed." diff --git a/components/fpweb/languages/fpwebstrconsts.fr.po b/components/fpweb/languages/fpwebstrconsts.fr.po index ac656dccb6..7c581a7c00 100644 --- a/components/fpweb/languages/fpwebstrconsts.fr.po +++ b/components/fpweb/languages/fpwebstrconsts.fr.po @@ -5,11 +5,11 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Yann Mérignac \n" -"Language-Team: Vasseur Gilles \n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: fpwebstrconsts.scssfile msgid "CSS file" @@ -77,7 +77,7 @@ msgstr "Alt" #: fpwebstrconsts.shtmlinputformcaption msgid "Tag property: INPUT" -msgstr "Propriétés de balise : INPUT" +msgstr "Propriété de balise : INPUT" #: fpwebstrconsts.shtmlinputformimagesrc msgid "Image src" @@ -97,7 +97,7 @@ msgstr "Taille" #: fpwebstrconsts.shtmlinputformtabindex msgid "Tab Index" -msgstr "N° ordre (\"tabindex\")" +msgstr "N° ordre" #: fpwebstrconsts.shtmlinputformtype msgid "Type" @@ -129,7 +129,7 @@ msgstr "Cell spacing" #: fpwebstrconsts.shtmltableformcolumncount msgid "Column count" -msgstr "Nb colonnes" +msgstr "Nombre de colonnes" #: fpwebstrconsts.shtmltableformheaderbgcolor msgid "Header bg color" @@ -137,7 +137,7 @@ msgstr "Couleur de fond de l'en-tête" #: fpwebstrconsts.shtmltableformrowcount msgid "Row count" -msgstr "Nb lignes" +msgstr "Nombre de lignes" #: fpwebstrconsts.shtmltableformuseheader msgid "Use header row" @@ -157,7 +157,7 @@ msgstr "Soumettre" #: fpwebstrconsts.shtmltagproperty msgid "Tag property: %s" -msgstr "Propriété(s) de balise : %s" +msgstr "Propriété de balise : %s" #: fpwebstrconsts.shtmltitle msgid "Html &title - " @@ -193,11 +193,11 @@ msgstr "Insérer une case à cocher" #: fpwebstrconsts.smihtmlformfieldset msgid "Insert HTML FIELDSET tag" -msgstr "Insérer une balise FIELDSET..." +msgstr "Insérer une balise FIELDSET" #: fpwebstrconsts.smihtmlformlegend msgid "Insert HTML LEGEND tag" -msgstr "Insérer une balise LEGEND..." +msgstr "Insérer une balise LEGEND" #: fpwebstrconsts.smihtmlformradiobtn msgid "Insert RadioBtn control" @@ -213,11 +213,11 @@ msgstr "Insérer une liste déroulante" #: fpwebstrconsts.smihtmlformselectopt msgid "Insert Select options" -msgstr "Insérer une option de liste déroulante" +msgstr "Insérer des options de liste déroulante" #: fpwebstrconsts.smihtmlformselectoptwd msgid "Insert Select options with dialog" -msgstr "Insérer une option de liste déroulante (avec dialogue)" +msgstr "Insérer des options de liste déroulante (avec dialogue)" #: fpwebstrconsts.smihtmlinsertbr msgid "Insert new line" @@ -225,7 +225,7 @@ msgstr "Insérer un saut de ligne" #: fpwebstrconsts.smihtmlinsertcolor msgid "Insert HTML color value" -msgstr "Insérer une couleur HTML..." +msgstr "Insérer une couleur HTML" #: fpwebstrconsts.smihtmlinsertcomment msgid "Insert HTML comment" @@ -237,7 +237,7 @@ msgstr "Insérer une balise DIV" #: fpwebstrconsts.smihtmlinsertform msgid "Insert HTML Form" -msgstr "Insérer un formulaire HTML..." +msgstr "Insérer un formulaire HTML" #: fpwebstrconsts.smihtmlinsertheader1level msgid "Insert HTML level 1 header" @@ -265,11 +265,11 @@ msgstr "Insérer une ligne horizontale" #: fpwebstrconsts.smihtmlinsertimg msgid "Insert image" -msgstr "Insérer une image..." +msgstr "Insérer une image" #: fpwebstrconsts.smihtmlinsertinput msgid "Insert HTML INPUT tag" -msgstr "Insérer une balise INPUT..." +msgstr "Insérer une balise INPUT" #: fpwebstrconsts.smihtmlinsertinputreset msgid "Insert \"Reset\" button" @@ -281,11 +281,11 @@ msgstr "Insérer un bouton \"Soumettre\"..." #: fpwebstrconsts.smihtmlinsertlink msgid "Insert link (HREF)" -msgstr "Insérer un lien (HREF)..." +msgstr "Insérer un lien (HREF)" #: fpwebstrconsts.smihtmlinsertlist msgid "Insert HTML list" -msgstr "Insérer une liste HTML..." +msgstr "Insérer une liste HTML" #: fpwebstrconsts.smihtmlinsertnbsp msgid "Insert Non Breaking Space" @@ -309,7 +309,7 @@ msgstr "Insérer une balise SUP" #: fpwebstrconsts.smihtmlinserttable msgid "Insert HTML table" -msgstr "Insérer un tableau HTML..." +msgstr "Insérer un tableau HTML" #: fpwebstrconsts.smihtmlinserttabledata msgid "Insert HTML table data" @@ -317,7 +317,7 @@ msgstr "Insérer une balise TD" #: fpwebstrconsts.smihtmlinserttabledatawd msgid "Insert HTML table data with dialog" -msgstr "Insérer une balise TD (avec dialogue)..." +msgstr "Insérer une balise TD (avec dialogue)" #: fpwebstrconsts.smihtmlinserttablerow msgid "Insert HTML table row" @@ -325,7 +325,7 @@ msgstr "Insérer une balise TR" #: fpwebstrconsts.smihtmlinserttablerowwd msgid "Insert HTML table row with dialog" -msgstr "Insérer une balise TR (avec dialogue)..." +msgstr "Insérer une balise TR (avec dialogue)" #: fpwebstrconsts.smihtmllists msgid "Lists" @@ -377,7 +377,7 @@ msgstr "Souligné" #: fpwebstrconsts.smiotherinsertfn msgid "Insert file name" -msgstr "Insérer un nom de fichier..." +msgstr "Insérer un nom de fichier" #: fpwebstrconsts.snewhtmlfileprops msgid "New Html file properties" diff --git a/components/fpweb/languages/frmrpcmoduleoptions.fr.po b/components/fpweb/languages/frmrpcmoduleoptions.fr.po index 13f432d6e9..80d24fddc2 100644 --- a/components/fpweb/languages/frmrpcmoduleoptions.fr.po +++ b/components/fpweb/languages/frmrpcmoduleoptions.fr.po @@ -5,11 +5,11 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Yann Mérignac <yann.merignac@laposte.net>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: frmrpcmoduleoptions.scaption msgid "Create a new JSON-RPC module" @@ -29,5 +29,5 @@ msgstr "Enregistrer les gestionnaires JSON-RPC dans la fabrique" #: frmrpcmoduleoptions.sregisterwebm msgid "Register web module" -msgstr "Enregistrer le module WEB" +msgstr "Enregistrer le module Web" diff --git a/components/fpweb/languages/weblazideintf.fr.po b/components/fpweb/languages/weblazideintf.fr.po index 1843be3f0c..9cbe93a8d9 100644 --- a/components/fpweb/languages/weblazideintf.fr.po +++ b/components/fpweb/languages/weblazideintf.fr.po @@ -9,55 +9,55 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: weblazideintf.rsapachemodule msgid "Apache Module" -msgstr "Module \"Apache\"" +msgstr "Module Apache" #: weblazideintf.rsapachemodule2 msgid "Apache module%sAn Apache loadable module in Free Pascal using webmodules. The main library file is automatically maintained by Lazarus." -msgstr "Module \"Apache\"%sUn module \"Apache\" en Free Pascal utilisant les modules Web. Le fichier principal de la bibliothèque est automatiquement géré par Lazarus." +msgstr "Module Apache%sUn module Apache en Free Pascal utilisant les modules Web. Le fichier principal de la bibliothèque est automatiquement géré par Lazarus." #: weblazideintf.rscgiapplicati msgid "CGI Application" -msgstr "Application \"CGI\"" +msgstr "Application CGI" #: weblazideintf.rscgiapplicati2 msgid "CGI Application%sA CGI (Common Gateway Interface) program in Free Pascal using webmodules. The program source is automatically maintained by Lazarus." -msgstr "Application \"CGI\"%sUne application \"CGI\" (\"Common Gateway Interface\") en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." +msgstr "Application CGI%sUne application CGI (Common Gateway Interface) en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." #: weblazideintf.rscustomcgiapp msgid "Custom CGI Application" -msgstr "Application \"CGI\" personnalisée" +msgstr "Application CGI personnalisée" #: weblazideintf.rscustomcgiapp2 msgid "Custom CGI Application%sA CGI (Common Gateway Interface) program in Free Pascal. The program source is automatically maintained by Lazarus." -msgstr "Application \"CGI\"%sUne application \"CGI\" (\"Common Gateway Interface\") en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." +msgstr "Application CGI%sUne application CGI (Common Gateway Interface) en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." #: weblazideintf.rscustomfastcg msgid "Custom FastCGI Application" -msgstr "Application \"FastCGI\" personnalisée" +msgstr "Application FastCGI personnalisée" #: weblazideintf.rscustomfastcg2 msgid "Custom FastCGI Application%sA FastCGI (Common Gateway Interface) program in Free Pascal. The program source is automatically maintained by Lazarus." -msgstr "Application \"FastCGI\" personnalisée%sUn programme \"FastCGI\" (\"Common Gateway Interface\") en Free Pascal. Le code source du programme est automatiquement géré par Lazarus." +msgstr "Application FastCGI personnalisée%sUn programme FastCGI (Common Gateway Interface) en Free Pascal. Le code source du programme est automatiquement géré par Lazarus." #: weblazideintf.rsfastcgiappli msgid "FastCGI Application" -msgstr "Application \"FastCGI\"" +msgstr "Application FastCGI" #: weblazideintf.rsfastcgiappli2 msgid "FastCGI Application%sA FastCGI (Common Gateway Interface) program in Free Pascal using webmodules. The program source is automatically maintained by Lazarus." -msgstr "Application \"FastCGI\"%sUne application \"FastCGI\" (\"Common Gateway Interface\") en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." +msgstr "Application FastCGI%sUne application FastCGI (Common Gateway Interface) en Free Pascal utilisant les modules Web. Le programme source est automatiquement géré par Lazarus." #: weblazideintf.rshtmlwebmodul msgid "HTML Web Module" -msgstr "Module \"Web HTML\"" +msgstr "Module Web HTML" #: weblazideintf.rshtmlwebmodul2 msgid "HTML WEB Module%sA Web datamodule for producing strict HTML." -msgstr "Module \"Web HTML\"%sUn module de données Web pour produire du HTML pur." +msgstr "Module Web HTML%sUn module de données Web pour produire du HTML pur." #: weblazideintf.rshttpappli msgid "HTTP server Application" @@ -69,27 +69,27 @@ msgstr "Serveur HTTP. Un Serveur HTTP complet en Free Pascal utilisant les modul #: weblazideintf.rswebdataprovi msgid "Web DataProvider Module" -msgstr "Module \"Web DataProvider\"" +msgstr "Module Web DataProvider" #: weblazideintf.rswebdataprovi2 msgid "WEB DataProvider Module%sA datamodule to handle data requests for WEB (HTTP) applications using WebDataProvider components." -msgstr "Module \"WEB DataProvider\"%sUn module de données pour manipuler les requêtes des applications WEB (HTTP) qui utilisent les composants \"WebDataProvider\"." +msgstr "Module WEB DataProvider%sUn module de données pour manipuler les requêtes des applications WEB (HTTP) qui utilisent les composants WebDataProvider." #: weblazideintf.rswebextdirect msgid "Web Ext.Direct Module" -msgstr "Module \"Web Ext.Direct\"" +msgstr "Module Web Ext.Direct" #: weblazideintf.rswebextdirect2 msgid "WEB Ext.Direct Module%sA datamodule to dispatch Ext.Direct requests in WEB (HTTP) applications using TJSONRPCHandler components." -msgstr "Module \"Web Ext.Direct\"%sUn module de données pour répartir les requêtes \"Ext.Direct\" des applications WEB (HTTP) applications qui utilisent les composants \"TJSONRPCHandler\"." +msgstr "Module Web Ext.Direct%sUn module de données pour répartir les requêtes Ext.Direct des applications WEB (HTTP) applications qui utilisent les composants TJSONRPCHandler." #: weblazideintf.rswebjsonrpcmo msgid "Web JSON-RPC Module" -msgstr "Module \"Web JSON-RPC\"" +msgstr "Module Web JSON-RPC" #: weblazideintf.rswebjsonrpcmo2 msgid "WEB JSON-RPC Module%sA datamodule to dispatch JSON-RPC requests in WEB (HTTP) applications using TJSONRPCHandler components." -msgstr "Module \"WEB JSON-RPC\" %sUn module de données pour répartir les requêtes \"JSON-RPC\" des applications WEB (HTTP) qui utilisent les composants \"TJSONRPCHandler\"." +msgstr "Module WEB JSON-RPC %sUn module de données pour répartir les requêtes JSON-RPC des applications WEB (HTTP) qui utilisent les composants TJSONRPCHandler." #: weblazideintf.rswebmodule msgid "Web Module" diff --git a/components/h2pas/languages/h2passtrconsts.fr.po b/components/h2pas/languages/h2passtrconsts.fr.po index a616e70175..7b1de86fb8 100644 --- a/components/h2pas/languages/h2passtrconsts.fr.po +++ b/components/h2pas/languages/h2passtrconsts.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2016-01-25 10:12+0100\n" +"PO-Revision-Date: 2019-02-07 10:09+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.8.6\n" +"X-Generator: Poedit 2.2.1\n" #: h2passtrconsts.h2padd msgid "&Add" @@ -21,23 +21,23 @@ msgstr "Ajouter une copie" #: h2passtrconsts.h2paddfromclipboard msgid "Add from clipboard" -msgstr "Coller depuis le presse-papier" +msgstr "Coller depuis le presse-papiers" #: h2passtrconsts.h2paddhfiles msgid "Add .h files ..." -msgstr "Ajouter les fichiers \".h\"..." +msgstr "Ajouter les fichiers .h..." #: h2passtrconsts.h2paddhfiles2 msgid "Add *.h files ..." -msgstr "Ajouter les fichiers \"*.h\"..." +msgstr "Ajouter les fichiers *.h..." #: h2passtrconsts.h2paddhfiles3 msgid "Add .h files?" -msgstr "Voulez-vous ajouter les fichiers \".h\" ?" +msgstr "Voulez-vous ajouter les fichiers .h ?" #: h2passtrconsts.h2paddincludedhfiles msgid "Add included .h files" -msgstr "Ajouter les fichiers inclus \".h\"" +msgstr "Ajouter les fichiers inclus .h" #: h2passtrconsts.h2paddmissingbracketsaroundmacrovalues msgid "Add missing brackets around macro values" @@ -45,11 +45,11 @@ msgstr "Ajouter les parenthèses manquantes autour des valeurs de macros" #: h2passtrconsts.h2paddmissingh2pasifdefsforfunctionbodies msgid "Add missing H2Pas IFDEFs for function bodies" -msgstr "Ajouter les \"IFDEF\" manquants de H2Pas pour les corps de fonctions" +msgstr "Ajouter les IFDEF manquants de H2Pas pour les corps de fonctions" #: h2passtrconsts.h2paddmissingpointertypeslikepppchar msgid "Add missing pointer types like PPPChar" -msgstr "Ajouter les types de pointeurs manquants comme \"PPPChar\"" +msgstr "Ajouter les types de pointeurs manquants comme PPPChar" #: h2passtrconsts.h2paddnewtool msgid "Add new tool" @@ -61,11 +61,11 @@ msgstr "Ajouter l'outil \"chercher et remplacer\" avant H2Pas" #: h2passtrconsts.h2paddthesehfilestoh2pasproject msgid "Add these .h files to H2Pas project?%s%s%s" -msgstr "Voulez-vous ajouter ces fichiers \".h\" au projet H2Pas ?%s%s%s" +msgstr "Voulez-vous ajouter ces fichiers .h au projet H2Pas ?%s%s%s" #: h2passtrconsts.h2paddunitstousessection msgid "Add units to uses section" -msgstr "Ajouter les unités à la clause \"uses\"" +msgstr "Ajouter les unités à la clause uses" #: h2passtrconsts.h2pafterh2pas msgid "After H2Pas" @@ -89,7 +89,7 @@ msgstr "&Annuler" #: h2passtrconsts.h2pccompactoutputmodelessspacesandemptylines msgid "-c Compact outputmode, less spaces and empty lines" -msgstr "-c Mode de production compacté (moins d'espaces et de lignes vides)" +msgstr "-c Mode de production compacté (moins d'espaces et de lignes vides)" #: h2passtrconsts.h2pcheaderfileconverter msgid "C header file converter" @@ -145,7 +145,7 @@ msgstr "La copie du fichier a échoué" #: h2passtrconsts.h2pcopytooltoclipboard msgid "Copy tool to clipboard" -msgstr "Copier l'outil dans le presse-papier" +msgstr "Copier l'outil dans le presse-papiers" #: h2passtrconsts.h2pcreateunitsfromcheaderfiles msgid "Create units from C header files" @@ -153,7 +153,7 @@ msgstr "Créer les unités à partir des fichiers d'en-tête C" #: h2passtrconsts.h2pcusetypesinctypesunit msgid "-C Use types in ctypes unit" -msgstr "-C Utiliser les types dans l'unité ctypes" +msgstr "-C Utiliser les types dans l'unité ctypes" #: h2passtrconsts.h2pdelete msgid "Delete" @@ -161,11 +161,11 @@ msgstr "Supprimer" #: h2passtrconsts.h2pdeleteselectedhfiles msgid "Delete selected .h files" -msgstr "Supprimer les fichiers \".h\" sélectionnés" +msgstr "Supprimer les fichiers .h sélectionnés" #: h2passtrconsts.h2pdeletethesehfilesfromlist msgid "Delete these .h files from list?%s%s%s" -msgstr "Voulez-vous supprimer ces fichiers \".h\" de la liste ?%s%s%s" +msgstr "Voulez-vous supprimer ces fichiers .h de la liste ?%s%s%s" #: h2passtrconsts.h2pdeletetool msgid "Delete tool" @@ -177,7 +177,7 @@ msgstr "la suppression de \"%s\" a échoué" #: h2passtrconsts.h2pdisableallhfiles msgid "Disable all .h files" -msgstr "Désactiver tous les fichiers \".h\"" +msgstr "Désactiver tous les fichiers .h" #: h2passtrconsts.h2pdiscardchangesandexit msgid "Discard changes and exit" @@ -193,19 +193,19 @@ msgstr "Voulez-vous vraiment supprimer \"%s\" ?" #: h2passtrconsts.h2pduseexternalforallprocedures msgid "-d Use external; for all procedures" -msgstr "-d Utiliser \"external\" pour toutes les procédures" +msgstr "-d Utiliser external pour toutes les procédures" #: h2passtrconsts.h2pduseexternallibnamenamefunc__nameforfunctions msgid "-D Use external libname name \"func__name\" for functions" -msgstr "-D Utiliser le nom de \"libname\" externe \"func__name\" pour les fonctions" +msgstr "-D Utiliser le nom de libname externe \"func__name\" pour les fonctions" #: h2passtrconsts.h2peconstantsinsteadofenumerationtypeforcenums msgid "-e constants instead of enumeration type for C enums" -msgstr "-e constantes au lieu de " +msgstr "-e constantes au lieu de" #: h2passtrconsts.h2penableallhfiles msgid "Enable all .h files" -msgstr "Activer tous les fichiers \".h\"" +msgstr "Activer tous les fichiers .h" #: h2passtrconsts.h2perror msgid "Error" @@ -257,15 +257,15 @@ msgstr "Fichier introuvable : \"%s\"" #: h2passtrconsts.h2pfindexplicittypesfailedreadingconstsection msgid "FindExplicitTypes FAILED reading const section" -msgstr "\"FindExplicitTypes\" a échoué en lisant la section \"const\"" +msgstr "FindExplicitTypes a échoué en lisant la section \"const\"" #: h2passtrconsts.h2pfindexplicittypesfailedreadingtypedefinition msgid "FindExplicitTypes FAILED reading type definition %s" -msgstr "\"FindExplicitTypes\" a échoué en lisant la définition de type %s" +msgstr "FindExplicitTypes a échoué en lisant la définition de type %s" #: h2passtrconsts.h2pfindexplicittypesfailedrereadingtypedefinition msgid "FindExplicitTypes FAILED Rereading type definition %s" -msgstr "\"FindExplicitTypes\" a échoué en relisant la définition de type %s" +msgstr "FindExplicitTypes a échoué en relisant la définition de type %s" #: h2passtrconsts.h2pfixessectiontypeofaliasdefinitionsinpascalunitchec msgid "Fixes section type of alias definitions in pascal unit%sChecks all alias definitions of the form%sconst LeftSide = RightSide;%slooks up RightSide in the unit and if RightSide is a type or var, changes the section accordingly" @@ -301,7 +301,7 @@ msgstr "Projet H2Pas" #: h2passtrconsts.h2ph2pasprojecth2ph2pallfiles msgid "H2Pas project (*.h2p)|*.h2p|All files (*.*)|%s" -msgstr "projet H2Pas (*.h2p)|*.h2p|Tous les fichiers(*.*)|%s" +msgstr "Projet H2Pas (*.h2p)|*.h2p|Tous les fichiers(*.*)|%s" #: h2passtrconsts.h2ph2pastool msgid "H2PasTool" @@ -309,7 +309,7 @@ msgstr "H2PasTool" #: h2passtrconsts.h2picreateanincludefileinsteadofaunit msgid "-i Create an include file instead of a unit" -msgstr "-i Créer un fichier inclus au lieu d'une unité" +msgstr "-i Créer un fichier inclus au lieu d'une unité" #: h2passtrconsts.h2pincludedby msgid "Included by:" @@ -369,7 +369,7 @@ msgstr "Aucun fichier sélectionné." #: h2passtrconsts.h2pnotatcustomtextconvertertool msgid "not a TCustomTextConverterTool" -msgstr "pas un \"TCustomTextConverterTool\"" +msgstr "pas un TCustomTextConverterTool" #: h2passtrconsts.h2pnothingtodo msgid "Nothing to do" @@ -381,7 +381,7 @@ msgstr "Ouvrir les derniers paramètres au démarrage" #: h2passtrconsts.h2popenprojecth2p msgid "Open project (*.h2p) ..." -msgstr "Ouvrir un projet (\"*.h2p\")..." +msgstr "Ouvrir un projet (*.h2p)..." #: h2passtrconsts.h2popensettings msgid "&Open Settings" @@ -413,11 +413,11 @@ msgstr "Veuillez activer au moins un fichier d'en-tête C qui n'est pas fusionn #: h2passtrconsts.h2pposth2pasasetofcommontoolstorunafterh2pasphreplace msgid "Post H2Pas - a set of common tools to run after H2Pas%sphReplaceUnitFilenameWithUnitName - Replace \"unit filename;\" with \"unit name;\"%sphRemoveIncludeDirectives - Remove include directives%sphRemoveSystemTypes - Remove type redefinitons like PLongint%sphFixH2PasMissingIFDEFsInUnit - Add missing IFDEFs for function bodies%sphReduceCompilerDirectivesInUnit - Removes unneeded directives%sphRemoveRedefinedPointerTypes - Remove redefined pointer types%sphRemoveEmptyTypeVarConstSections - Remove empty type/var/const sections%sphReplaceImplicitTypes - Search implicit types in parameters and add types for them%sphFixArrayOfParameterType - Replace \"array of )\" with \"array of const)\"%sphRemoveRedefinitionsInUnit - Removes redefinitions of types, variables, constants and resourcestrings%sphFixAliasDefinitionsInUnit - Fix section type of alias definitions%sphReplaceConstFunctionsInUnit - Replace simple assignment functions with constants%sphReplaceTypeCastFunctionsInUnit - Replace simple type cast functions with types%sphFixForwardDefinitions - Fix forward definitions by reordering%sphAddUnitsToUsesSection - Add units to uses section%s" -msgstr "Après H2Pas - Un ensemble d'outils à utiliser après H2Pas%sphReplaceUnitFilenameWithUnitName - Remplacement de \"unit filename;\" par \"unit name;\"%sphRemoveIncludeDirectives - Suppression des directives incluses%sphRemoveSystemTypes - Suppression des redéfinitions de types comme PLongint%sphFixH2PasMissingIFDEFsInUnit - Ajout des \"IFDEF\" aux corps des fonctions%sphReduceCompilerDirectivesInUnit - Suppression des directives superflues%sphRemoveRedefinedPointerTypes - Suppression des types de pointeurs redéfinis%sphRemoveEmptyTypeVarConstSections - Suppression des sections type/var/const vides%sphReplaceImplicitTypes - Recherche des types implicites dans les paramètres et attribution d'un type%sphFixArrayOfParameterType - Remplacement de \"array of )\" par \"array of const)\"%sphRemoveRedefinitionsInUnit - Suppression des redéfinitions de types, variables, constantes et chaînes de ressources%sphFixAliasDefinitionsInUnit - Correction du type de section des définitions d'alias%sphReplaceConstFunctionsInUnit - Remplacement des fonctions simples par des constantes%sphReplaceTypeCastFunctionsInUnit - Remplacement des fonctions de transtypage simple par des types%sphFixForwardDefinitions - Correction des définitions anticipées (\"forward\") par un réarrangement%sphAddUnitsToUsesSection - Ajout des unités à la section \"uses\"%s" +msgstr "Après H2Pas - Un ensemble d'outils à utiliser après H2Pas%sphReplaceUnitFilenameWithUnitName - Remplacement de \"unit filename;\" par \"unit name;\"%sphRemoveIncludeDirectives - Suppression des directives incluses%sphRemoveSystemTypes - Suppression des redéfinitions de types comme PLongint%sphFixH2PasMissingIFDEFsInUnit - Ajout des IFDEF aux corps des fonctions%sphReduceCompilerDirectivesInUnit - Suppression des directives superflues%sphRemoveRedefinedPointerTypes - Suppression des types de pointeurs redéfinis%sphRemoveEmptyTypeVarConstSections - Suppression des sections type/var/const vides%sphReplaceImplicitTypes - Recherche des types implicites dans les paramètres et attribution d'un type%sphFixArrayOfParameterType - Remplacement de \"array of )\" par \"array of const)\"%sphRemoveRedefinitionsInUnit - Suppression des redéfinitions de types, variables, constantes et chaînes de ressources%sphFixAliasDefinitionsInUnit - Correction du type de section des définitions d'alias%sphReplaceConstFunctionsInUnit - Remplacement des fonctions simples par des constantes%sphReplaceTypeCastFunctionsInUnit - Remplacement des fonctions de transtypage simple par des types%sphFixForwardDefinitions - Correction des définitions anticipées (\"forward\") par un réarrangement%sphAddUnitsToUsesSection - Ajout des unités à la section uses%s" #: h2passtrconsts.h2ppreh2pasasetofcommontoolstorunbeforeh2pasphremovec msgid "Pre H2Pas - a set of common tools to run before H2Pas%sphRemoveCPlusPlusExternCTool - Remove C++ 'extern \"C\"' lines%sphRemoveEmptyCMacrosTool - Remove empty C macros%sphReplaceEdgedBracketPairWithStar - Replace [] with *%sphReplace0PointerWithNULL - Replace macro values 0 pointer like (char *)0%sphConvertFunctionTypesToPointers - Convert function types to pointers%sphConvertEnumsToTypeDef - Convert anonymous enums to typedef enums%sphCommentComplexCMacros - Comment macros too complex for H2Pas%sphCommentComplexCFunctions - Comment functions too complex for H2Pas%s" -msgstr "Avant H2Pas - Un ensemble d'outils à utiliser avant H2Pas%sphRemoveCPlusPlusExternCTool - Suppression des lignes C++ 'extern \"C\"'%sphRemoveEmptyCMacrosTool - Suppression des macros C vides%sphReplaceEdgedBracketPairWithStar - Remplacement des \"[]\" par des \"*\"%sphReplace0PointerWithNULL - Remplacement des pointeurs 0 comme (char *)0%sphConvertFunctionTypesToPointers - Conversion des types de fonctions par des pointeurs%sphConvertEnumsToTypeDef - Conversion des énumérations anonymes par des énumérations d'un type défini%sphCommentComplexCMacros - Mise en commentaire des macros trop complexes pour H2Pas%sphCommentComplexCFunctions - Mise en commentaire des fonctions trop complexes pour H2Pas%s" +msgstr "Avant H2Pas - Un ensemble d'outils à utiliser avant H2Pas%sphRemoveCPlusPlusExternCTool - Suppression des lignes C++ 'extern \"C\"'%sphRemoveEmptyCMacrosTool - Suppression des macros C vides%sphReplaceEdgedBracketPairWithStar - Remplacement des [] par des *%sphReplace0PointerWithNULL - Remplacement des pointeurs 0 comme (char *)0%sphConvertFunctionTypesToPointers - Conversion des types de fonctions par des pointeurs%sphConvertEnumsToTypeDef - Conversion des énumérations anonymes par des énumérations d'un type défini%sphCommentComplexCMacros - Mise en commentaire des macros trop complexes pour H2Pas%sphCommentComplexCFunctions - Mise en commentaire des fonctions trop complexes pour H2Pas%s" #: h2passtrconsts.h2pprpackallrecords1bytealignment msgid "-pr Pack all records (1 byte alignment)" @@ -425,11 +425,11 @@ msgstr "-pr Compresser tous les enregistrements (alignement sur 1 octet)" #: h2passtrconsts.h2ppuseletterpforpointertypesinsteadof msgid "-p Use letter P for pointer types instead of \"^\"" -msgstr "-p Utiliser la lettre \"P\" pour les pointeurs au lieu de \"^\"" +msgstr "-p Utiliser la lettre P pour les pointeurs au lieu de \"^\"" #: h2passtrconsts.h2ppuseprocvarsforimports msgid "-P use proc. vars for imports" -msgstr "-P Utiliser les variables procédurales pour les importations" +msgstr "-P Utiliser les variables procédurales pour les importations" #: h2passtrconsts.h2preaderror msgid "Read error" @@ -437,7 +437,7 @@ msgstr "Erreur de lecture" #: h2passtrconsts.h2preducecompilerdirectivesinpascalfileshortensexpres msgid "Reduce compiler directives in pascal file%sShortens expressions in $IF directives%sand removes unneeded $IFDEF and $DEFINE directives." -msgstr "Réduire les directives de compilation dans les fichiers Pascal%sRaccourcit les expressions des directives \"$IF\"%set élimine les \"$IFDEF\" et \"$DEFINE\" inutiles." +msgstr "Réduire les directives de compilation dans les fichiers Pascal%sRaccourcit les expressions des directives $IF%set élimine les $IFDEF et $DEFINE inutiles." #: h2passtrconsts.h2premoveallfiles msgid "Remove all files" @@ -473,7 +473,7 @@ msgstr "Supprimer les redéfinitions dans l'unité Pascal" #: h2passtrconsts.h2premovetyperedefinitionslikeplongint msgid "Remove type redefinitions like PLongint" -msgstr "Supprimer les redéfinitions de type comme \"PLongint\"" +msgstr "Supprimer les redéfinitions de type comme PLongint" #: h2passtrconsts.h2preplacefile msgid "Replace file?" @@ -481,11 +481,11 @@ msgstr "Voulez-vous remplacer le fichier ?" #: h2passtrconsts.h2preplaceimplicittypesforexampleprocedureprocnameaar msgid "Replace implicit types%sFor example:%s procedure ProcName(a: array[0..2] of char)%s is replaced with%s procedure ProcName(a: Tarray_0to2_of_char)%s and a new type is added%s Tarray_0to2_of_char = array[0..2] of char" -msgstr "Remplacer les types implicites%sPar exemple :%s procedure ProcName(a: array[0..2] of char)%s sera remplacé par%s procedure ProcName(a: Tarray_0to2_of_char)%s tandis que seraajouté un nouveau type%s Tarray_0to2_of_char = array[0..2] of char" +msgstr "Remplacer les types implicites%sPar exemple :%s procedure ProcName(a: array[0..2] of char)%s sera remplacé par%s procedure ProcName(a: Tarray_0to2_of_char)%s tandis que sera ajouté un nouveau type%s Tarray_0to2_of_char = array[0..2] of char" #: h2passtrconsts.h2preplacemacrovalues0pointerlikechar0withnull msgid "Replace macro values 0 pointer like (char *)0 with NULL" -msgstr "Remplacer les macros pointeurs valant 0 comme \"(char *)0\" par \"NULL\"" +msgstr "Remplacer les macros pointeurs valant 0 comme (char *)0 par NULL" #: h2passtrconsts.h2preplacesimplefunctionswithconstants msgid "Replace simple functions with constants" @@ -497,7 +497,7 @@ msgstr "Remplacer les fonctions simples par des conversions de types" #: h2passtrconsts.h2preplaceunitfilenamewithunitname msgid "Replace \"unit filename;\" with \"unit name;\"" -msgstr "Remplacer 'unit NomDeFichier;\" par \"unit Nom;\"" +msgstr "Remplacer \"unit NomDeFichier;\" par \"unit Nom;\"" #: h2passtrconsts.h2preplacewith msgid "Replace [] with *" @@ -505,7 +505,7 @@ msgstr "Remplacer [] par *" #: h2passtrconsts.h2preplacingofnullwithnilfailed msgid "replacing of NULL with nil failed" -msgstr "Le remplacement de \"NULL\" par \"nil\" a échoué" +msgstr "le remplacement de NULL par nil a échoué" #: h2passtrconsts.h2prunh2pas msgid "Run H2Pas" @@ -549,19 +549,19 @@ msgstr "Paramètres" #: h2passtrconsts.h2psstripcomments msgid "-s Strip comments" -msgstr "-s Enlever les commentaires" +msgstr "-s Enlever les commentaires" #: h2passtrconsts.h2psstripcommentsandinfo msgid "-S Strip comments and info" -msgstr "-S Enlever les commentaires et les informations" +msgstr "-S Enlever les commentaires et les informations" #: h2passtrconsts.h2ptaddtousessectionexecutefileisnotpascal msgid "TAddToUsesSection.Execute file is not pascal: " -msgstr "Le fichier pour \"TAddToUsesSection.Execute\" n'est pas du Pascal : " +msgstr "Le fichier pour TAddToUsesSection.Execute n'est pas du Pascal : " #: h2passtrconsts.h2ptaddtousessectionexecuteinvalidunitname msgid "TAddToUsesSection.Execute invalid unitname \"%s\"" -msgstr "Le nom d'unité \"%s\" pour \"TAddToUsesSection.Execute\" est incorrect" +msgstr "Le nom d'unité \"%s\" pour TAddToUsesSection.Execute est incorrect" #: h2passtrconsts.h2ptextconversiontoolseditor msgid "Text conversion tools editor" @@ -569,7 +569,7 @@ msgstr "Éditeur d'outils de conversion de texte" #: h2passtrconsts.h2pth2pasdialogh2pasoptionscheckgroupitemclickunknown msgid "TH2PasDialog.h2pasOptionsCheckGroupItemClick: Unknown option %s" -msgstr "\"TH2PasDialog.h2pasOptionsCheckGroupItemClick\" : option inconnue %s" +msgstr "TH2PasDialog.h2pasOptionsCheckGroupItemClick : option inconnue %s" #: h2passtrconsts.h2pthefilealreadyexists msgid "The file \"%s\"%salready exists." @@ -581,15 +581,15 @@ msgstr "Outils :" #: h2passtrconsts.h2ptposth2pastoolsexecuteaddtousessectioninvalidunitn msgid "TPostH2PasTools.Execute.AddToUsesSection invalid unitname \"%s\"" -msgstr "\"TPostH2PasTools.Execute.AddToUsesSection\" : nom d'unité incorrect \"%s\"" +msgstr "TPostH2PasTools.Execute.AddToUsesSection : nom d'unité incorrect \"%s\"" #: h2passtrconsts.h2ptprependtypedeftypeswitht msgid "-t Prepend typedef types with T" -msgstr "-t Préfixer les définitions de types avec \"T\"" +msgstr "-t Préfixer les définitions de types avec T" #: h2passtrconsts.h2ptprependtypedeftypeswithtandremove__ msgid "-T Prepend typedef types with T, and remove __" -msgstr "-T Préfixer les définitions de types avec \"T\" et supprimez les \"_\"" +msgstr "-T Préfixer les définitions de types avec T et supprimez les _" #: h2passtrconsts.h2punabletocopyfileto msgid "Unable to copy file \"%s\"%sto \"%s\"" @@ -601,7 +601,7 @@ msgstr "Impossible de fusionner le fichier \"%s\" avec \"%s\"" #: h2passtrconsts.h2pvreplacepointerparametersbyvar msgid "-v Replace pointer parameters by var" -msgstr "-v Remplacer les paramètres de pointeurs par des variables" +msgstr "-v Remplacer les paramètres de pointeurs par des variables" #: h2passtrconsts.h2pwarning msgid "Warning" @@ -613,7 +613,7 @@ msgstr "%sAvertissement : le fichier \"%s\"%ssera unifié dans plusieurs fichier #: h2passtrconsts.h2pwhandlespecialwin32macros msgid "-w Handle special win32 macros" -msgstr "-w Gérer les macros win32 spéciales" +msgstr "-w Gérer les macros win32 spéciales" #: h2passtrconsts.h2pwriteerror msgid "Write error" @@ -621,5 +621,5 @@ msgstr "Erreur d'écriture" #: h2passtrconsts.h2pxhandlesys__trapofthepalmosheaderfiles msgid "-x Handle SYS__TRAP of the PalmOS header files" -msgstr "-x Gérer SYS-TRAP des fichiers d'en-tête de PalmOS" +msgstr "-x Gérer SYS-TRAP des fichiers d'en-tête de PalmOS" diff --git a/components/ideintf/languages/objinspstrconsts.fr.po b/components/ideintf/languages/objinspstrconsts.fr.po index bddfccacd6..b0356fbe89 100644 --- a/components/ideintf/languages/objinspstrconsts.fr.po +++ b/components/ideintf/languages/objinspstrconsts.fr.po @@ -2,7 +2,7 @@ msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2018-11-28 17:27+0100\n" +"PO-Revision-Date: 2019-02-07 12:06+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" @@ -10,7 +10,7 @@ msgstr "" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Poedit-SourceCharset: utf-8\n" -"X-Generator: Poedit 2.1.1\n" +"X-Generator: Poedit 2.2.1\n" #: objinspstrconsts.cactionlisteditorallcategory msgid "(All)" @@ -212,7 +212,7 @@ msgstr "Champs de &clé :" #: objinspstrconsts.feslookup msgid "&Lookup" -msgstr "&Chercher (\"Lookup\")" +msgstr "&Chercher" #: objinspstrconsts.feslookupdef msgid "Lookup definition" @@ -606,7 +606,7 @@ msgstr "Interface" #: objinspstrconsts.oisinvalid msgid "(Invalid)" -msgstr "(Invalide)" +msgstr "(Incorrect)" #: objinspstrconsts.oisinvalidpropertyvalue msgid "Invalid property value" @@ -638,7 +638,7 @@ msgstr "Charger une image" #: objinspstrconsts.oismasks msgid "Masks ..." -msgstr "Masques." +msgstr "Masques..." #: objinspstrconsts.oismethod msgid "Method" @@ -699,11 +699,11 @@ msgstr "Options" #: objinspstrconsts.oisorderbackone msgid "Back One" -msgstr "En arrière (un)" +msgstr "En arrière (un pas)" #: objinspstrconsts.oisorderforwardone msgid "Forward One" -msgstr "En avant (un)" +msgstr "En avant (un pas)" #: objinspstrconsts.oisordermovetoback msgid "Move to Back" @@ -744,7 +744,7 @@ msgstr "Appuyez sur une touche..." #: objinspstrconsts.oispressakeyegctrlp msgid "You can press e.g. Ctrl+P ..." -msgstr "Vous pouvez appuyer par exemple sur Ctrl + P..." +msgstr "Vous pouvez par exemple appuyer sur Ctrl + P..." #: objinspstrconsts.oisproperties msgid "Properties" @@ -1328,11 +1328,11 @@ msgstr "Nouvelle résolution..." #: objinspstrconsts.sccsiledtaddsliced msgid "Add sliced ..." -msgstr "Ajouter des icônes en tranches..." +msgstr "Ajouter des icônes en morceaux..." #: objinspstrconsts.sccsiledtaddslicediconerror msgid "Adding sliced icons is not supported." -msgstr "L'ajout d'icônes en tranches n'est pas pris en charge." +msgstr "L'ajout d'icônes en morceaux n'est pas pris en charge." #: objinspstrconsts.sccsiledtadjustment msgid "Adjustment" diff --git a/components/instantfpc/languages/instantfpcregisterlaz.fr.po b/components/instantfpc/languages/instantfpcregisterlaz.fr.po index 236a5ae35d..7a7e448211 100644 --- a/components/instantfpc/languages/instantfpcregisterlaz.fr.po +++ b/components/instantfpc/languages/instantfpcregisterlaz.fr.po @@ -9,21 +9,21 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: instantfpcregisterlaz.rsinstantfpcpr msgid "InstantFPC program" -msgstr "Programme \"InstantFPC\"" +msgstr "Programme InstantFPC" #: instantfpcregisterlaz.rsinstantfpcsc msgid "InstantFPC script" -msgstr "Script \"InstantFPC\"" +msgstr "Script InstantFPC" #: instantfpcregisterlaz.rssinglefilefr msgid "%s%sSingle file Free Pascal program executed by InstantFPC" -msgstr "%s%sProgramme en un seul fichier exécuté par \"InstantFPC\"." +msgstr "%s%sProgramme en un seul fichier exécuté par InstantFPC" #: instantfpcregisterlaz.rssinglefilepr msgid "%s%sSingle file program using InstantFPC to compile and execute" -msgstr "%s%sProgramme en un seul fichier utilisant \"InstantFPC\" pour se compiler et se lancer." +msgstr "%s%sProgramme en un seul fichier utilisant InstantFPC pour se compiler et se lancer" diff --git a/components/jcf2/IdePlugin/lazarus/languages/jcfideregister.fr.po b/components/jcf2/IdePlugin/lazarus/languages/jcfideregister.fr.po index e50df85ce4..f2ea44b546 100644 --- a/components/jcf2/IdePlugin/lazarus/languages/jcfideregister.fr.po +++ b/components/jcf2/IdePlugin/lazarus/languages/jcfideregister.fr.po @@ -5,11 +5,11 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: jcfideregister.format_about_menu msgid "&About" @@ -18,7 +18,7 @@ msgstr "&À propos" #: jcfideregister.format_category_idecmd msgctxt "jcfideregister.format_category_idecmd" msgid "JEDI Code Format" -msgstr "Formatage de code \"JEDI\"" +msgstr "Formatage de code JEDI" #: jcfideregister.format_current_idecmd msgid "Format code in current editor window" @@ -31,7 +31,7 @@ msgstr "Fenêtre de l'éditeur en &cours" #: jcfideregister.format_menu msgid "JEDI Code &Format" -msgstr "&Formatage de code \"JEDI\"" +msgstr "&Formatage de code JEDI" #: jcfideregister.format_open_menu msgctxt "jcfideregister.format_open_menu" diff --git a/components/jcf2/IdePlugin/lazarus/languages/jcfuiconsts.fr.po b/components/jcf2/IdePlugin/lazarus/languages/jcfuiconsts.fr.po index c3ca7c3176..3b795c9fd1 100644 --- a/components/jcf2/IdePlugin/lazarus/languages/jcfuiconsts.fr.po +++ b/components/jcf2/IdePlugin/lazarus/languages/jcfuiconsts.fr.po @@ -9,11 +9,11 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.2\n" +"X-Generator: Poedit 2.2.1\n" #: jcfuiconsts.lisaboutaboutjedicodeformat msgid "About JEDI Code Format" -msgstr "À propos de \"JEDI Code Format\"" +msgstr "À propos de JEDI Code Format" #: jcfuiconsts.lisaboutfindmoreinformationonthewebat msgid "Find more information on the web at: %s" @@ -233,7 +233,7 @@ msgstr "Définir la mise en majuscules de ces identificateurs:" #: jcfuiconsts.liscapsnotidentifiersnotidentifiers msgid "Non-identifiers" -msgstr "non identificateurs" +msgstr "Non identificateurs" #: jcfuiconsts.liscapsnotidentifierssetcapitalisationonthesenonidentifiers msgid "Set capitalisation on these non-identifiers:" @@ -304,7 +304,7 @@ msgstr "Jamais" #: jcfuiconsts.liscaseblocksuseanewlineincaseblocksat msgid "Use a new line in Case blocks at:" -msgstr "Insérer une nouvelle ligne dans les blocs \"Case\" :" +msgstr "Insérer une nouvelle ligne dans les blocs \"Case\" en :" #: jcfuiconsts.liscdcompilerdirectives msgid "Compiler Directives" @@ -516,11 +516,11 @@ msgstr "Paramètres de formatage de JCF" #: jcfuiconsts.lisjedicodeformatallopenwindow msgid "JEDI Code Format of all open windows?" -msgstr "Formatage JEDI de toutes les fenêtres ouvertes?" +msgstr "Formatage JEDI de toutes les fenêtres ouvertes ?" #: jcfuiconsts.lisjedicodeformatofareyousurethatyouwanttoformatallfi msgid "JEDI Code Format of %sAre you sure that you want to format all %s files in the project?" -msgstr "JEDI Code Format of %sVoulez-vous vraiment formater les %s fichiers du projet ?" +msgstr "JEDI Code Format de %sVoulez-vous vraiment formater les %s fichiers du projet ?" #: jcfuiconsts.lisjedicodeformatofstartformatting msgid "JEDI Code Format of %sStart formatting?" @@ -560,7 +560,7 @@ msgstr "TOUT EN MAJUSCULES" #: jcfuiconsts.lisobfsalllowercase msgid "all lowercase" -msgstr "toutes en minuscules" +msgstr "tout en minuscules" #: jcfuiconsts.lisobfsleavealone msgid "Leave alone" @@ -699,11 +699,11 @@ msgstr "Étiquette de la casse" #: jcfuiconsts.lisspacesclassvariables msgid "&Class variables" -msgstr "Variables de&Classe" +msgstr "Variables de &classe" #: jcfuiconsts.lisspacesconstdeclarations msgid "C&onst declarations" -msgstr "Déclarations \"C&onst\"" +msgstr "Déclarations de c&onstantes" #: jcfuiconsts.lisspacesfixspacing msgid "Fix &spacing" @@ -711,7 +711,7 @@ msgstr "Espacement &fixe" #: jcfuiconsts.lisspacesfunctionreturntypes msgid "&Function return types" -msgstr "Types retournés par \"&function\"" +msgstr "Types retournés par &fonction" #: jcfuiconsts.lisspacesinfunctioncall msgid "In function &call" @@ -857,15 +857,15 @@ msgstr "Du plus court au plus long" #: jcfuiconsts.listransformsortimplementationuses msgid "Sort i&mplementation uses" -msgstr "Trier les \"uses\" de l'implémentation" +msgstr "Trier les \"uses\" de l'i&mplémentation" #: jcfuiconsts.listransformsortinterfaceuses msgid "Sort i&nterface uses" -msgstr "Tri les \"uses\" de l'interface" +msgstr "Trier les \"uses\" de l'i&nterface" #: jcfuiconsts.listransformsortprogramuses msgid "Sort &program uses" -msgstr "Tri les \"uses\" du programme" +msgstr "Trier les \"uses\" du &programme" #: jcfuiconsts.listransformsortusesclauses msgid "Sort &uses clauses" @@ -897,7 +897,7 @@ msgstr "Remplacer" #: jcfuiconsts.lisusesuses msgid "Uses" -msgstr "\"Uses\"" +msgstr "Uses" #: jcfuiconsts.liswarningsignoreunusedparametersnamed msgid "&Ignore unused parameters named:" diff --git a/components/lazdebuggergdbmi/languages/gdbmistringconstants.fr.po b/components/lazdebuggergdbmi/languages/gdbmistringconstants.fr.po index 313d7b1b68..fc357b4dcb 100644 --- a/components/lazdebuggergdbmi/languages/gdbmistringconstants.fr.po +++ b/components/lazdebuggergdbmi/languages/gdbmistringconstants.fr.po @@ -3,12 +3,12 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2018-10-08 11:08+0200\n" +"PO-Revision-Date: 2019-02-07 09:53+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Poedit 2.1.1\n" +"X-Generator: Poedit 2.2.1\n" "Plural-Forms: nplurals=2; plural=(n > 1);\n" "Language: fr\n" @@ -18,7 +18,7 @@ msgstr "Débogueur" #: gdbmistringconstants.gdbmibreakpointerroronruncommand msgid "The debugger encountered an error when trying to run/step the application:%0:s%0:s%1:s%0:s%0:sPress \"Ok\" to remove the breakpoints and continue debugging (paused), and correct the problem, or choose an alternative run command.%0:sPress \"Stop\" to end the debug session." -msgstr "Le débogueur a rencontré une erreur en essayant d'exécuter l'application : %0:s%0:s%1:s%0:s%0:sAppuyez sur \"OK\" pour retirer les points d'arrêt et continuer le débogage (en pause), et corrigez le problème, ou choisissez une commande alternative. %0:sAppuyez sur \"Stop\" pour mettre fin à la session de débogage." +msgstr "Le débogueur a rencontré une erreur en essayant d'exécuter l'application : %0:s%0:s%1:s%0:s%0:sAppuyez sur \"Ok\" pour retirer les points d'arrêt et continuer le débogage (en pause), et corrigez le problème, ou choisissez une commande alternative. %0:sAppuyez sur \"Stop\" pour mettre fin à la session de débogage." #: gdbmistringconstants.gdbmicommandstartmainbreakerror msgid "The debugger could not set a breakpoint on the application's entry point.%0:sThis may be caused by missing debug info." @@ -34,11 +34,11 @@ msgstr "Le débogueur n'a pas pu obtenir le PID de l'application.%0:sCeci peut #: gdbmistringconstants.gdbmicommandstartmainruntostoperror msgid "The debugger was unable to initialize itself.%0:sThe application did run (and terminated) before the debugger could set any breakpoints. %0:sThis may be caused by missing debug info." -msgstr "Le débogueur n'a pas pu de s'initialiser. %0:sL'application a été lancée (et arrêtée) avant que le débogueur n'ait pu mettre un point d'arrêt. %0:sCela peut être dû à l'absence d'informations de débogage." +msgstr "Le débogueur n'a pas pu s'initialiser. %0:sL'application a été lancée (et arrêtée) avant que le débogueur n'ait pu mettre un point d'arrêt. %0:sCela peut être dû à l'absence d'informations de débogage." #: gdbmistringconstants.gdbmierroronruncommand msgid "The debugger encountered an error when trying to run/step the application:%0:s%0:s%1:s%0:s%0:sPress \"Ok\" to continue debugging (paused), and correct the problem, or choose an alternative run command.%0:sPress \"Stop\" to end the debug session." -msgstr "Le débogueur a rencontré une erreur en essayant d'exécuter l'application : %0:s%0:s%1:s%0:s%0:sAppuyez sur \"OK\" pour continuer le débogage (en pause), et corrigez le problème, ou choisissez une commande alternative. %0:sAppuyez sur \"Stop\" pour mettre fin à la session de débogage." +msgstr "Le débogueur a rencontré une erreur en essayant d'exécuter l'application : %0:s%0:s%1:s%0:s%0:sAppuyez sur \"Ok\" pour continuer le débogage (en pause), et corrigez le problème, ou choisissez une commande alternative. %0:sAppuyez sur \"Stop\" pour mettre fin à la session de débogage." #: gdbmistringconstants.gdbmierroronruncommandwithwarning msgid "%0:s%0:sIn addition to the error the following warning was encountered:%0:s%0:s%1:s" @@ -118,7 +118,7 @@ msgstr "Pendant l'exécution de la commande : %0:s\"%2:s\"%0:sGDB a signalé : % #: gdbmistringconstants.gdbmipressignoretocontinuedebuggingthismaynotbesafepres msgid "Press \"Ignore\" to continue debugging. This may NOT be safe. Press \"Abort\" to stop the debugger.%0:sException: %1:s with message \"%2:s\"%0:sContext: %4:s. State: %5:s %0:s%0:s%3:s" -msgstr "Appuyez sur \"Ignorer\" pour continuer le débogage. Ceci peut ne PAS être sûr. Appuyez sur \"Abandonner\" pour arrêter le débogage. %0:sException: %1:s avec le message \"%2:s\"%0:sContexte : %4:s. État : %5:s %0:s%0:s%3:s" +msgstr "Appuyez sur \"Ignorer\" pour continuer le débogage. Ceci peut ne PAS être sûr. Appuyez sur \"Abandonner\" pour arrêter le débogage. %0:sException : %1:s avec le message \"%2:s\"%0:sContexte : %4:s. État : %5:s %0:s%0:s%3:s" #: gdbmistringconstants.gdbmithedebuggerexperiencedanunknowncondition msgid "The debugger experienced an unknown condition" @@ -134,7 +134,7 @@ msgstr "Le débogueur a rencontré une situation inattendue %1:s%0:s%0:sAppuyez #: gdbmistringconstants.lisnewthegnudebuggerthroughsshallowstoremotedebugviaassh msgid "The GNU debugger through SSH allows to remote debug via a SSH connection. See docs/RemoteDebugging.txt for details. The path must contain the SSH client. Use SSH_Startup_Options for the hostname and optional username. Use Remote_GDB_Exe for the filename of GDB on the remote computer." -msgstr "Le débogueur GNU avec SSH permet le débogage à distance via une connexion SSH. Voir \"docs/RemoteDebugging.txt\" pour plus de détails. Le chemin doit contenir le client SSH. Utilisez \"SSH_Startup_Options\" pour le nom de l'hôte et pour le nom d'utilisateur optionnel. Utilisez \"Remote_GDB_Exe\" comme nom de fichier de GDB sur l'ordinateur distant." +msgstr "Le débogueur GNU avec SSH permet le débogage à distance via une connexion SSH. Voir \"docs/RemoteDebugging.txt\" pour plus de détails. Le chemin doit contenir le client SSH. Utilisez SSH_Startup_Options pour le nom de l'hôte et pour le nom d'utilisateur optionnel. Utilisez Remote_GDB_Exe comme nom de fichier de GDB sur l'ordinateur distant." #: gdbmistringconstants.lisresponsecontinue msgid "Response: %sContinue?" @@ -166,5 +166,5 @@ msgstr "Impossible de charger l'exécutable de l'application" #: gdbmistringconstants.synfthedebuggerwasunabletosetallbreakpointsduringiniti msgid "The debugger was unable to set all breakpoints during initialization.%0:sYou may wish to check if all sources were compiled with debug-info.%0:sPress OK to ignore this and continue." -msgstr "Le débogueur a été incapable de mettre les points d'arrêt pendant l'initialisation. %0:sVeuillez vérifier que tous les fichiers sources ont été compilés avec les informations de débogage. %0:sAppuyez sur \"OK\" pour ignorer cet avertissement et continuer." +msgstr "Le débogueur a été incapable de mettre les points d'arrêt pendant l'initialisation. %0:sVeuillez vérifier que tous les fichiers sources ont été compilés avec les informations de débogage. %0:sAppuyez sur \"Ok\" pour ignorer cet avertissement et continuer." diff --git a/components/lazreport/samples/editor/languages/calleditorwithpkg.fr.po b/components/lazreport/samples/editor/languages/calleditorwithpkg.fr.po index 4d666283a3..0bb1f07dd1 100644 --- a/components/lazreport/samples/editor/languages/calleditorwithpkg.fr.po +++ b/components/lazreport/samples/editor/languages/calleditorwithpkg.fr.po @@ -5,11 +5,11 @@ msgstr "" "Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2015-03-12 11:53+0100\n" +"PO-Revision-Date: 2019-02-07 09:14+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: \n" +"Language-Team: http://lazarus.developpez.com/\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: maincalleditor.ceractivereport msgid "Active report: %s" @@ -18,7 +18,7 @@ msgstr "Rapport actif : %s" #: maincalleditor.cerappcaption msgctxt "maincalleditor.cerappcaption" msgid "LazReport Test Suite" -msgstr "Suite de tests LazReport " +msgstr "Suite de tests LazReport" #: maincalleditor.cercomposite msgctxt "maincalleditor.cercomposite" @@ -52,7 +52,7 @@ msgstr "Ouvrir un rapport existant" #: maincalleditor.cerhintprevgrid msgid "Print preview current DbGrid content" -msgstr "Afficher l'aperçu du contenu de la \"DbGrid\" en cours" +msgstr "Afficher l'aperçu du contenu de la DbGrid en cours" #: maincalleditor.cerhintprevreport msgid "Preview active report" @@ -93,7 +93,7 @@ msgstr "Ouvrir un rapport en premier" #: maincalleditor.cerpreparefailed msgid "PrepareReport Failed!" -msgstr "Échec de \"PrepareReport\" !" +msgstr "Échec de PrepareReport !" #: maincalleditor.cerpreviewreport msgid "Preview report" @@ -129,7 +129,7 @@ msgstr "Aperçu personnalisé" #: tfrmmain.acceditreport.caption msgctxt "TFRMMAIN.ACCEDITREPORT.CAPTION" msgid "Edit Report" -msgstr "Édite le rapport" +msgstr "Éditer le rapport" #: tfrmmain.accexporttocsv.caption msgctxt "TFRMMAIN.ACCEXPORTTOCSV.CAPTION" @@ -164,7 +164,7 @@ msgstr "Aperçu du rapport" #: tfrmmain.accprintgrid.caption msgid "Print Grid" -msgstr "Imprimer la \"DBGrid\"" +msgstr "Imprimer la grille" #: tfrmmain.accprintreport.caption msgid "Print Report" @@ -186,7 +186,7 @@ msgstr "Test maître-détails" #: tfrmmain.caption msgctxt "tfrmmain.caption" msgid "LazReport Test Suite" -msgstr "Suite de tests LazReport " +msgstr "Suite de tests LazReport" #: tfrmmain.lblexpr.caption msgid "Expression" diff --git a/components/lazreport/source/addons/lrspreadsheetexport/languages/le_e_spreadsheet_consts.fr.po b/components/lazreport/source/addons/lrspreadsheetexport/languages/le_e_spreadsheet_consts.fr.po index 6ef665c0db..e3568a8aab 100644 --- a/components/lazreport/source/addons/lrspreadsheetexport/languages/le_e_spreadsheet_consts.fr.po +++ b/components/lazreport/source/addons/lrspreadsheetexport/languages/le_e_spreadsheet_consts.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2016-05-14 08:37+0200\n" +"PO-Revision-Date: 2019-02-07 11:54+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.8.7\n" +"X-Generator: Poedit 2.2.1\n" #: le_e_spreadsheet_consts.sallinonepage msgid "All in one page" @@ -25,7 +25,7 @@ msgstr "Créer automatiquement le fichier" #: le_e_spreadsheet_consts.schunkseach msgid "Chunks. Each chunk has (rows):" -msgstr "Morceaux. Chaque morceau a (lignes) :" +msgstr "Blocs. Chaque bloc a (lignes) :" #: le_e_spreadsheet_consts.scurrentpage msgid "Current page" @@ -40,16 +40,12 @@ msgid "Delete empty rows" msgstr "Supprimer les lignes vides" #: le_e_spreadsheet_consts.senterpagenumbers -#, fuzzy -#| msgid "" -#| "Enter page numbers and/or page ranges,\n" -#| "separated by commas. For example, 1,3,5-12\n" msgid "" "Enter page numbers and/or page ranges,\n" "separated by commas. For example, 1,3,5-12" msgstr "" "Saisir les numéros de pages et/ou les intervalles de pages,\n" -"séparés par des virgules. Par exemple : 1,3,5-12\n" +"séparés par des virgules. Par exemple : 1,3,5-12" #: le_e_spreadsheet_consts.sexportpagefooter msgid "Export page footer" @@ -101,7 +97,7 @@ msgstr "Fusionner les cellules" #: le_e_spreadsheet_consts.sonlyonecomponent msgid "Only one TlrSpreadSheetExport component allowed." -msgstr "Seul un composant \"TlrSpreadSheetExport\" est autorisé." +msgstr "Seul un composant TlrSpreadSheetExport est autorisé." #: le_e_spreadsheet_consts.sopenafterexport msgid "Open after export" diff --git a/components/lazthread/languages/reglazthread.fr.po b/components/lazthread/languages/reglazthread.fr.po index f3bffa8fbe..9863cedfd8 100644 --- a/components/lazthread/languages/reglazthread.fr.po +++ b/components/lazthread/languages/reglazthread.fr.po @@ -9,11 +9,11 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: reglazthread.sthreaddescription msgid "A Pascal unit with a subclass of TThread class." -msgstr "Une unité Pascal avec un descendant de la classe \"TThread\"." +msgstr "Une unité Pascal avec un descendant de la classe TThread." #: reglazthread.sthreadname msgid "Thread Object" diff --git a/components/lazthread/languages/threadoptionsdialog.fr.po b/components/lazthread/languages/threadoptionsdialog.fr.po index 95d5b01f5b..00dec4dece 100644 --- a/components/lazthread/languages/threadoptionsdialog.fr.po +++ b/components/lazthread/languages/threadoptionsdialog.fr.po @@ -1,5 +1,15 @@ msgid "" -msgstr "Content-Type: text/plain; charset=UTF-8" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: \n" +"Language-Team: http://lazarus.developpez.com/\n" +"MIME-Version: 1.0\n" +"Content-Transfer-Encoding: 8bit\n" +"Language: fr\n" +"X-Generator: Poedit 2.2.1\n" #: threadoptionsdialog.screateunitbuttoncaption msgid "Create Unit" @@ -15,5 +25,5 @@ msgstr "Options de tâche" #: threadoptionsdialog.sthreadnamelabelcaption msgid "Thread Class Name" -msgstr "Nom de la classe" +msgstr "Nom de la classe de la tâche" diff --git a/components/leakview/languages/heaptrcview.fr.po b/components/leakview/languages/heaptrcview.fr.po index 651d1493da..9bd60ee00b 100644 --- a/components/leakview/languages/heaptrcview.fr.po +++ b/components/leakview/languages/heaptrcview.fr.po @@ -3,14 +3,14 @@ msgstr "" "Project-Id-Version: lazaruside\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2015-12-18 09:27+0100\n" +"PO-Revision-Date: 2019-02-07 10:10+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Poedit 1.8.6\n" +"X-Generator: Poedit 2.2.1\n" #: heaptrcview.rsdtimes msgid " (%d times)" @@ -26,7 +26,7 @@ msgstr "Fuites et Traces" #: heaptrcview.sbtnclipbrd msgid "Paste Clipboard" -msgstr "Coller depuis le presse-papier" +msgstr "Coller depuis le presse-papiers" #: heaptrcview.sbtnresolve msgid "Resolve" @@ -46,7 +46,7 @@ msgstr "Toujours au dessus" #: heaptrcview.sfrmcap msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer" -msgstr "Fuites et Traces - Afficheur de traces \"HeapTrc\" et \"GDB\"" +msgstr "Fuites et Traces - Afficheur de traces HeapTrc et GDB" #: heaptrcview.sfrmselectfilewithdebuginfo msgid "Select file with debug info" @@ -58,7 +58,7 @@ msgstr "Choisir le fichier contenant un journal d'exécution" #: heaptrcview.slbltrace msgid ".trc file" -msgstr "Fichier \".trc\"" +msgstr "Fichier .trc" #: heaptrcview.stacklineformat msgid "%s" diff --git a/components/macroscript/languages/emsstrings.fr.po b/components/macroscript/languages/emsstrings.fr.po index 162810438f..4860b71fb9 100644 --- a/components/macroscript/languages/emsstrings.fr.po +++ b/components/macroscript/languages/emsstrings.fr.po @@ -6,11 +6,11 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr_FR\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: emsstrings.emsactive msgid "Scripting active." @@ -38,15 +38,15 @@ msgstr "Script inactif. L'autotest s'exécutera au prochain démarrage de l'EDI. #: emsstrings.emsselftesterrcaption msgid "Error in EditorMacroScript" -msgstr "Erreur dans \"EditorMacroScript\"" +msgstr "Erreur dans EditorMacroScript" #: emsstrings.emsselftestfailed msgid "The package EditorMacroScript (pascalscript macros) has detected a problem and was deactivated.%0:sThe package failed its selftest with the message:%0:s\"%1:s\"" -msgstr "Le paquet \"EditorMacroScript\" (macros \"pascalscript\") a détecté un problème et a été désactivé.%0:sLe paquet a échoué lors de son autotest avec le message : %0:s\"%1:s\"" +msgstr "Le paquet EditorMacroScript (macros pascalscript) a détecté un problème et a été désactivé.%0:sLe paquet a échoué lors de son autotest avec le message : %0:s\"%1:s\"" #: emsstrings.emsselftestfailedlasttime msgid "The package EditorMacroScript (pascalscript macros) has detected a problem and was deactivated.%0:sThe package selftest was not completed during the last start of the IDE." -msgstr "Le paquet \"EditorMacroScript\" (macros \"pascalscript\") a détecté un problème et a été désactivé.%0:sL'autotest du paquet n'était pas terminé lors du dernier démarrage de l'EDI." +msgstr "Le paquet EditorMacroScript (macros pascalscript) a détecté un problème et a été désactivé.%0:sL'autotest du paquet n'était pas terminé lors du dernier démarrage de l'EDI." #: emsstrings.emsstatustitle msgid "Status" diff --git a/components/memds/languages/frmselectdataset.fr.po b/components/memds/languages/frmselectdataset.fr.po index ada81fe96a..895b6137f4 100644 --- a/components/memds/languages/frmselectdataset.fr.po +++ b/components/memds/languages/frmselectdataset.fr.po @@ -4,7 +4,7 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: 2015-04-13 13:58+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: \n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" diff --git a/components/messagecomposer/languages/messagecomposer.fr.po b/components/messagecomposer/languages/messagecomposer.fr.po index 686c62cd5e..d25c540eaa 100644 --- a/components/messagecomposer/languages/messagecomposer.fr.po +++ b/components/messagecomposer/languages/messagecomposer.fr.po @@ -7,9 +7,9 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: \n" "Last-Translator: Yann Mérignac <yann.merignac@laposte.net>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "Language: fr\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" #: messagecomposer.rscancel msgid "Cancel" @@ -29,11 +29,11 @@ msgstr "Ajouter" #: messagecomposer.sbuttonsarrayofconst msgid "Buttons (array of const)" -msgstr "Boutons (\"array of const\")" +msgstr "Boutons (array of const)" #: messagecomposer.sbuttonstmsgdlgbuttons msgid "Buttons (TMsgDlgButtons)" -msgstr "Boutons (\"TMsgDlgButtons\")" +msgstr "Boutons (TMsgDlgButtons)" #: messagecomposer.scaseresult msgid "\"Case\" result" @@ -107,9 +107,9 @@ msgstr "Texte d'invite" #: messagecomposer.ssourcewrapper msgid "Source wrapper" -msgstr "Code source englobant" +msgstr "Code source englobé" #: messagecomposer.svaluevar msgid "Value (var)" -msgstr "Valeur (\"var\")" +msgstr "Valeur (var)" diff --git a/components/onlinepackagemanager/languages/opkman_const.fr.po b/components/onlinepackagemanager/languages/opkman_const.fr.po index 48efeb2157..bcc26f2db5 100644 --- a/components/onlinepackagemanager/languages/opkman_const.fr.po +++ b/components/onlinepackagemanager/languages/opkman_const.fr.po @@ -3,14 +3,14 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2017-02-06 11:11+0100\n" -"PO-Revision-Date: 2018-11-28 17:34+0100\n" +"PO-Revision-Date: 2019-02-07 12:10+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.1.1\n" +"X-Generator: Poedit 2.2.1\n" #: opkman_const.rsaddrepositorypackagefrm_bcancel_caption msgctxt "opkman_const.rsaddrepositorypackagefrm_bcancel_caption" @@ -198,28 +198,20 @@ msgid "The following file: \"%s\" already exists in the current repository. Over msgstr "Le fichier \"%s\" existe déjà dans le dépôt en cours. Voulez-vous le remplacer ?" #: opkman_const.rscreaterepositoryfrm_error1 -#, fuzzy -#| msgid "" -#| "Cannot open private repository: \"%s\". Error message: \n" -#| "\"%s\"\n" msgid "" "Cannot open private repository: \"%s\". Error message: \n" "\"%s\"" msgstr "" "Impossible d'ouvrir le dépôt privé \"%s\". Message d'erreur :\n" -"\"%s\"\n" +"\"%s\"" #: opkman_const.rscreaterepositoryfrm_error3 -#, fuzzy -#| msgid "" -#| "Cannot save private repository: \"%s\". Error message: \n" -#| "\"%s\"\n" msgid "" "Cannot save private repository: \"%s\". Error message: \n" "\"%s\"" msgstr "" "Impossible de sauvegarder le dépôt privé \"%s\". Message d'erreur :\n" -"\"%s\"\n" +"\"%s\"" #: opkman_const.rscreaterepositoryfrm_error4 msgid "Cannot add package to repository!" @@ -230,40 +222,28 @@ msgid "Cannot delete package: \"%s\"!" msgstr "Impossible de supprimer le paquet \"%s\" !" #: opkman_const.rscreaterepositoryfrm_info1 -#, fuzzy -#| msgid "" -#| "The following directory: \"%s\" is not empty.\n" -#| "It's recommended to save the repository to an empty directory. Continue?\n" msgid "" "The following directory: \"%s\" is not empty.\n" "It's recommended to save the repository to an empty directory. Continue?" msgstr "" "Le répertoire \"%s\" n'est pas vide.\n" -"Il est recommandé de sauvegarder le dépôt dans un répertoire vide. Voulez-vous continuer ?\n" +"Il est recommandé de sauvegarder le dépôt dans un répertoire vide. Voulez-vous continuer ?" #: opkman_const.rscreaterepositoryfrm_info3 -#, fuzzy -#| msgid "" -#| "The following package: \"%s\" is already in the current repository.\n" -#| "Each repository and Lazarus package must be unique!\n" msgid "" "The following package: \"%s\" is already in the current repository.\n" "Each repository and Lazarus package must be unique!" msgstr "" "Le paquet \"%s\" est déjà dans le dépôt en cours.\n" -"Les dépôts et les paquets Lazarus doivent être uniques !\n" +"Les dépôts et les paquets Lazarus doivent être uniques !" #: opkman_const.rscreaterepositoryfrm_info5 -#, fuzzy -#| msgid "" -#| "The following Lazarus package: \"%s\" is already in the current repository.\n" -#| "Each repository and Lazarus package must be unique!\n" msgid "" "The following Lazarus package: \"%s\" is already in the current repository.\n" "Each repository and Lazarus package must be unique!" msgstr "" "Le paquet Lazarus \"%s\" est déjà dans le dépôt en cours.\n" -"Les dépôts et les paquets Lazarus doivent être uniques !\n" +"Les dépôts et les paquets Lazarus doivent être uniques !" #: opkman_const.rscreaterepositoryfrm_info7 msgid "Package successfully added to repository." @@ -552,16 +532,12 @@ msgid "Sending files (\"%s\"). Please wait..." msgstr "Envoi de fichiers (\"%s\"). Veuillez patienter..." #: opkman_const.rscreaterepositorypackagefrm_message9 -#, fuzzy -#| msgid "" -#| "Files successfully sent. Thank you for submitting packages!\n" -#| "Your request will be processed in 24 hours.\n" msgid "" "Files successfully sent. Thank you for submitting packages!\n" "Your request will be processed in 24 hours." msgstr "" "Fichiers envoyés avec succès. Merci d'avoir proposé ces paquets !\n" -"Votre requête sera traitée dans les 24 heures.\n" +"Votre requête sera traitée dans les 24 heures." #: opkman_const.rscreaterepositorypackagefrm_nopackage msgid "No packages found!" @@ -721,16 +697,12 @@ msgid "None of the checked repository packages are available externally." msgstr "Aucun des paquets de dépôt cochés n'est disponible en externe." #: opkman_const.rsmainfrm_packageupdatewarning -#, fuzzy -#| msgid "" -#| "Installing packages from external link is not without a risk!\n" -#| "Only install if you trust the package maintainer. Continue?\n" msgid "" "Installing packages from external link is not without a risk!\n" "Only install if you trust the package maintainer. Continue?" msgstr "" "La mise à jour depuis un lien externe n'est pas sans risques !\n" -"Ne procédez à l'installation que si vous faites confiance au mainteneur. Voulez-vous continuer ?\n" +"Ne procédez à l'installation que si vous faites confiance au mainteneur. Voulez-vous continuer ?" #: opkman_const.rsmainfrm_resmessagechecksloaded msgid "%s packages successfully loaded from file!" @@ -769,16 +741,12 @@ msgid "No packages to show." msgstr "Pas de paquets à montrer." #: opkman_const.rsmainfrm_rsmessagenorepository0 -#, fuzzy -#| msgid "" -#| "Remote package repository not configured.\n" -#| "Do you wish to configure it now?\n" msgid "" "Remote package repository not configured.\n" "Do you wish to configure it now?" msgstr "" "Le dépôt des paquets n'est pas configuré.\n" -"Voulez-vous le configurer maintenant ?\n" +"Voulez-vous le configurer maintenant ?" #: opkman_const.rsmainfrm_rsmessagenothingchacked msgid "Please check at least one package!" @@ -821,16 +789,12 @@ msgid "%s packages deleted!" msgstr "%s paquets supprimés !" #: opkman_const.rsmainfrm_rsuninstall -#, fuzzy -#| msgid "" -#| "%sAre you sure you wish to uninstall the checked packages?\n" -#| "Please note: in order for the changes to take effect you must rebuid the IDE.\n" msgid "" "%sAre you sure you wish to uninstall the checked packages?\n" "Please note: in order for the changes to take effect you must rebuid the IDE." msgstr "" "%sÊtes-vous sûr de vouloir désinstaller les paquets cochés ?\n" -"Veuillez noter que vous devrez alors reconstruire l'EDI pour que les changements deviennent effectifs.\n" +"Veuillez noter que vous devrez alors reconstruire l'EDI pour que les changements deviennent effectifs." #: opkman_const.rsmainfrm_rsuninstall_error msgid "Cannot uninstall package \"%s\"!" diff --git a/components/onlinepackagemanager/languages/opkman_zip.fr.po b/components/onlinepackagemanager/languages/opkman_zip.fr.po index 20f5eb86e4..0413cc7a11 100644 --- a/components/onlinepackagemanager/languages/opkman_zip.fr.po +++ b/components/onlinepackagemanager/languages/opkman_zip.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2017-05-24 09:20+0200\n" +"PO-Revision-Date: 2019-02-07 12:12+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.1\n" +"X-Generator: Poedit 2.2.1\n" #: opkman_zip.serrbufsizechange msgid "Changing buffer size is not allowed while (un)zipping." @@ -65,7 +65,7 @@ msgstr "La position ou le décalage %d est plus grand que le maximum supporté % #: opkman_zip.serrunsupportedcompressionformat msgid "Unsupported compression format %d." -msgstr "Le format de compression n'est pas pris en charge : %d." +msgstr "Le format de compression %d n'est pas pris en charge." #: opkman_zip.serrunsupportedmultiplediskscd msgid "A central directory split over multiple disks is unsupported." diff --git a/components/pochecker/languages/pocheckerconsts.fr.po b/components/pochecker/languages/pocheckerconsts.fr.po index 3c81900942..a2dbc485dc 100644 --- a/components/pochecker/languages/pocheckerconsts.fr.po +++ b/components/pochecker/languages/pocheckerconsts.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-13 21:43+0100\n" -"PO-Revision-Date: 2018-05-02 08:09+0200\n" +"PO-Revision-Date: 2019-02-07 12:16+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.6\n" +"X-Generator: Poedit 2.2.1\n" #: pocheckerconsts.rspochecker msgid "Check PO Files ..." @@ -121,7 +121,7 @@ msgstr "Toutes les langues" #: pocheckerconsts.scannotwritefileyoucanpressretrytorefreshthistransl msgid "Cannot write file%s%s%s%sYou can press \"Retry\" to refresh this translation family again and continue." -msgstr "Impossible d’écrire le fichier%s%s%s%sVous pouvez appuyer sur « Recommencer » pour réactualiser cette famille de traduction et continuer." +msgstr "Impossible d’écrire le fichier%s%s%s%sVous pouvez appuyer sur \"Recommencer\" pour réactualiser cette famille de traduction et continuer." #: pocheckerconsts.scheckforincompatibleformatarguments msgid "Check for incompatible format arguments" @@ -168,11 +168,6 @@ msgid "Duplicate Originals" msgstr "Chaînes d'origine en doublons" #: pocheckerconsts.serroroncleanup -#, fuzzy -#| msgid "" -#| "An unrecoverable error occurred\n" -#| "%s\n" -#| "Please close the program\n" msgid "" "An unrecoverable error occurred\n" "%s\n" @@ -180,19 +175,15 @@ msgid "" msgstr "" "Une erreur irrécupérable est survenue\n" "%s\n" -"Veuillez fermer le programme\n" +"Veuillez fermer le programme" #: pocheckerconsts.serroroncreate -#, fuzzy -#| msgid "" -#| "Error creating an instance of TPoFamily:\n" -#| "%s\n" msgid "" "Error creating an instance of TPoFamily:\n" "%s" msgstr "" "Erreur lors de la création d'une instance de TPoFamily :\n" -"%s\n" +"%s" #: pocheckerconsts.serrorsbytest msgid "Errors / warnings reported by %s for:" @@ -203,16 +194,12 @@ msgid "File %s" msgstr "Fichier %s" #: pocheckerconsts.sfilesnotfoundandremoved -#, fuzzy -#| msgid "" -#| "The following non-existent files were removed from the list:\n" -#| "%s\n" msgid "" "The following non-existent files were removed from the list:\n" "%s" msgstr "" "Les fichiers suivants inexistants ont été retirés de la liste :\n" -"%s\n" +"%s" #: pocheckerconsts.sfuzzystrings msgid "Fuzzy strings" @@ -276,7 +263,7 @@ msgstr "Remarque : la traduction est floue" #: pocheckerconsts.snrerrorsfound msgid "Found %d errors." -msgstr "%d erreurs trouvées." +msgstr "%d erreur(s) trouvée(s)." #: pocheckerconsts.snrofitemsmismatch msgid "Mismatch in number of items for master and child" @@ -284,31 +271,21 @@ msgstr "Discordance entre le nombre d'éléments d'origine et celui de la traduc #: pocheckerconsts.snrofitemsmismatchd msgid "%s: %d items" -msgstr "%s : %d éléments" +msgstr "%s : %d élément(s)" #: pocheckerconsts.snrwarningsfound msgid "Found %d warnings." -msgstr "%d avertissements trouvés." +msgstr "%d avertissement(s) trouvé(s)." #: pocheckerconsts.sopenfail -#, fuzzy -#| msgid "" -#| "Unable to open file:\n" -#| "\"%s\"\n" msgid "" "Unable to open file:\n" "\"%s\"" msgstr "" "Impossible d'ouvrir le fichier :\n" -"\"%s\"\n" +"\"%s\"" #: pocheckerconsts.sopenfailexternal -#, fuzzy -#| msgid "" -#| "Unable to open file\n" -#| "\"%s\"\n" -#| "in external editor\n" -#| "\"%s\"\n" msgid "" "Unable to open file\n" "\"%s\"\n" @@ -318,7 +295,7 @@ msgstr "" "Impossible d'ouvrir le fichier\n" "\"%s\"\n" "dans l'éditeur externe\n" -"\"%s\"\n" +"\"%s\"" #: pocheckerconsts.sopenfileinexternaleditor msgid "Open file in external editor" @@ -338,15 +315,15 @@ msgstr "Original" #: pocheckerconsts.spercfuzzy msgid "%s: %5.1f%% fuzzy strings." -msgstr "%s : %5.1f%% chaînes floues." +msgstr "%s : %5.1f%% chaîne(s) floue(s)." #: pocheckerconsts.sperctranslated msgid "%s: %5.1f%% translated strings." -msgstr "%s : %5.1f%% chaînes traduites." +msgstr "%s : %5.1f%% chaîne(s) traduite(s)." #: pocheckerconsts.spercuntranslated msgid "%s: %5.1f%% untranslated strings." -msgstr "%s : %5.1f%% chaînes non traduites." +msgstr "%s : %5.1f%% chaîne(s) non traduite(s)." #: pocheckerconsts.sprocessingtranslationfamily msgid "Processing translation family..." @@ -377,16 +354,12 @@ msgid "Save &As ..." msgstr "&Enregistrer sous..." #: pocheckerconsts.ssaveerror -#, fuzzy -#| msgid "" -#| "Error saving file:\n" -#| "%s\n" msgid "" "Error saving file:\n" "%s" msgstr "" "Erreur d'enregistrement du fichier :\n" -"%s\n" +"%s" #: pocheckerconsts.sscandir msgid "Scan a folder" @@ -413,12 +386,6 @@ msgid "Show statistics graph" msgstr "Afficher les statistiques" #: pocheckerconsts.sstathint -#, fuzzy -#| msgid "" -#| "Translated: %d (%.1f%%)\n" -#| "Untranslated: %d (%.1f%%)\n" -#| "Fuzzy: %d (%.1f%%)\n" -#| "Errors in selected tests: %d\n" msgid "" "Translated: %d (%.1f%%)\n" "Untranslated: %d (%.1f%%)\n" @@ -428,7 +395,7 @@ msgstr "" "%d traduites (%.1f%%)\n" "%d non traduites (%.1f%%)\n" "%d floues (%.1f%%)\n" -"%d erreur(s) dans les tests sélectionnés\n" +"%d erreur(s) dans les tests sélectionnés" #: pocheckerconsts.sthefollowingmissingmasterpofileswereremoved msgid "The following %s missing master .po file(s) were removed from the list:" diff --git a/components/projectgroups/languages/projectgroupstrconst.fr.po b/components/projectgroups/languages/projectgroupstrconst.fr.po index e838af2b1a..6aebeaa260 100644 --- a/components/projectgroups/languages/projectgroupstrconst.fr.po +++ b/components/projectgroups/languages/projectgroupstrconst.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2017-05-24 10:11+0200\n" +"PO-Revision-Date: 2019-02-07 12:18+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.1\n" +"X-Generator: Poedit 2.2.1\n" #: projectgroupstrconst.lisabort msgid "Abort" @@ -60,11 +60,6 @@ msgid "Discard changes" msgstr "Ignorer les modifications" #: projectgroupstrconst.liserrnosuchfile -#, fuzzy -#| msgid "" -#| "Could not find target file\n" -#| "\"%s\"\n" -#| "What do you want to do?\n" msgid "" "Could not find target file\n" "\"%s\"\n" @@ -72,7 +67,7 @@ msgid "" msgstr "" "Impossible de trouver le fichier cible\n" "\"%s\"\n" -"Que voulez-vous faire ?\n" +"Que voulez-vous faire ?" #: projectgroupstrconst.liserronlyprojectgroupallowed msgid "Only target type \"projectgroup\" is allowed for root project group." @@ -228,16 +223,12 @@ msgid "Project group modified" msgstr "Groupe de projets modifié" #: projectgroupstrconst.lisprojectgroupmodifiedconfirm -#, fuzzy -#| msgid "" -#| "Project group \"%s\" is modified.\n" -#| "What do you want to do?\n" msgid "" "Project group \"%s\" is modified.\n" "What do you want to do?" msgstr "" "Le groupe de projets \"%s\" a été modifié.\n" -"Que voulez-vous faire ?\n" +"Que voulez-vous faire ?" #: projectgroupstrconst.lisprojectgroupreload msgid "Reload" diff --git a/components/sqldb/languages/sqlstringspropertyeditordlg.fr.po b/components/sqldb/languages/sqlstringspropertyeditordlg.fr.po index b7068953b0..d8dd9ebc38 100644 --- a/components/sqldb/languages/sqlstringspropertyeditordlg.fr.po +++ b/components/sqldb/languages/sqlstringspropertyeditordlg.fr.po @@ -1,14 +1,14 @@ msgid "" msgstr "" "Last-Translator: Philippe BOUCAULT <philbouc@users.sourceforge.net>\n" -"PO-Revision-Date: 2015-04-20 18:55+0100\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"PO-Revision-Date: 2019-02-07 12:22+0100\n" +"Language-Team: http://lazarus.developpez.com/\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Project-Id-Version: sqldb\n" "POT-Creation-Date: \n" "MIME-Version: 1.0\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" "Plural-Forms: nplurals=2; plural=(n > 1);\n" "Language: fr\n" @@ -69,16 +69,12 @@ msgid "Quick SQL check OK" msgstr "Vérification SQL rapide OK" #: sqlstringspropertyeditordlg.ssqlsyntaxerror -#, fuzzy -#| msgid "" -#| "Probable syntax error in SQL statement:\n" -#| "%s\n" msgid "" "Probable syntax error in SQL statement:\n" "%s" msgstr "" "Probable erreur de syntaxe dans l'instruction SQL :\n" -"%s\n" +"%s" #: sqlstringspropertyeditordlg.ssqltabcaption msgid "SQL Code" diff --git a/components/sqlite/languages/sqlitecompstrings.fr.po b/components/sqlite/languages/sqlitecompstrings.fr.po index e696a069e3..500bc5ab51 100644 --- a/components/sqlite/languages/sqlitecompstrings.fr.po +++ b/components/sqlite/languages/sqlitecompstrings.fr.po @@ -8,7 +8,7 @@ msgstr "" "Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Poedit 1.7.5\n" +"X-Generator: Poedit 2.2.1\n" "Plural-Forms: nplurals=2; plural=(n > 1);\n" "Language: fr\n" @@ -18,7 +18,7 @@ msgstr "Ajouter" #: sqlitecompstrings.satablenamedalreadyexistsareyousureyouwanttoreplace msgid "A Table named \"%s\" already exists. Are you sure you want to replace this table?%sAll data stored will be lost." -msgstr "Une table nommée \"%s\" existe déjà. Êtes-vous sur de vouloir remplacer cette table ? %s Toutes les données enregistrées seront perdues." +msgstr "Une table nommée \"%s\" existe déjà. Êtes-vous sûr de vouloir remplacer cette table ? %s Toutes les données enregistrées seront perdues." #: sqlitecompstrings.sclose msgid "Close" diff --git a/components/turbopower_ipro/languages/ipconst.fr.po b/components/turbopower_ipro/languages/ipconst.fr.po index 8858c7251a..53cc8e82c7 100644 --- a/components/turbopower_ipro/languages/ipconst.fr.po +++ b/components/turbopower_ipro/languages/ipconst.fr.po @@ -3,14 +3,14 @@ msgstr "" "Project-Id-Version: lazaruside\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2016-01-03 20:32+0100\n" +"PO-Revision-Date: 2019-02-07 10:22+0100\n" "Last-Translator: Alcatiz <alcatiz@redaction-developpez.com>\n" -"Language-Team: Vasseur Gilles <gillesvasseur58@gmail.com>\n" +"Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Poedit 1.8.6\n" +"X-Generator: Poedit 2.2.1\n" "Plural-Forms: nplurals=2; plural=(n > 1);\n" #: ipconst.cacheadding @@ -123,7 +123,7 @@ msgstr "Format de fichier inconnu" #: ipconst.sbadimagelibstream msgid "ImageLib must use TMemoryStreams" -msgstr "\"ImageLib\" doit utiliser des \"TMemoryStreams\"" +msgstr "ImageLib doit utiliser des TMemoryStreams" #: ipconst.sbadlinelength msgid "Invalid line length" @@ -151,7 +151,7 @@ msgstr "Buffer non assigné" #: ipconst.sbinhexbadchar msgid "Invalid BinHex character" -msgstr "Caractère \"BinHex\" incorrect" +msgstr "Caractère BinHex incorrect" #: ipconst.sbinhexbaddatacrc msgctxt "ipconst.sbinhexbaddatacrc" @@ -160,7 +160,7 @@ msgstr "Mauvais CRC d'en-tête" #: ipconst.sbinhexbadformat msgid "Invalid BinHex format" -msgstr "Format \"BinHex\" incorrect" +msgstr "Format BinHex incorrect" #: ipconst.sbinhexbadheadercrc msgctxt "ipconst.sbinhexbadheadercrc" @@ -382,7 +382,7 @@ msgstr "Aucun fournisseur de données assigné" #: ipconst.shtmlnogetimage msgid "No OnGetImage event handler assigned" -msgstr "Aucun gestionnaire d'événement \"OnGetImage\" assigné" +msgstr "Aucun gestionnaire d'événement OnGetImage assigné" #: ipconst.shtmlnographic msgid "Picture object contains no graphic object" @@ -398,7 +398,7 @@ msgstr "Ressource indisponible :" #: ipconst.shtmltokenstackoverfl msgid "Token stack overflow" -msgstr "Débordement de pile de jetons (\"tokens\")" +msgstr "Débordement de pile de jetons (tokens)" #: ipconst.shtmlunknowntok msgid "Unknown token" @@ -409,14 +409,6 @@ msgid "Unsupported protocol in URL:%s" msgstr "Protocole non supporté dans l'URL :%s" #: ipconst.sicmpecho -#, fuzzy -#| msgid "" -#| "Echo reply (Hop number: %d)\n" -#| " Status = %d\n" -#| " RTTime = %d\n" -#| " Ttl = %d\n" -#| " Tos = %d\n" -#| " IpFlags = %d\n" msgid "" "Echo reply (Hop number: %d)\n" " Status = %d\n" @@ -430,7 +422,7 @@ msgstr "" " RTTime = %d\n" " Ttl = %d\n" " Tos = %d\n" -" IpFlags = %d\n" +" IpFlags = %d" #: ipconst.sicmpechostring msgid "Echo string: %s" @@ -466,11 +458,11 @@ msgstr "Code de réponse incorrect" #: ipconst.sinvitemsize msgid "TIpTerminalArray.GetItemPtr: invalid item size" -msgstr "\"TIpTerminalArray.GetItemPtr\" : taille d'élément incorrect" +msgstr "TIpTerminalArray.GetItemPtr : taille d'élément incorrect" #: ipconst.sinvscrollrow msgid "TIpTerminalBuffer.SetScrollRegion: invalid row number(s)" -msgstr "\"TIpTerminalBuffer.SetScrollRegion\" : numéro(s) de rangée(s) incorrect(s)" +msgstr "TIpTerminalBuffer.SetScrollRegion : numéro(s) de rangée(s) incorrect(s)" #: ipconst.sipicmp_bad_destination msgid "Bad destination" @@ -566,7 +558,7 @@ msgstr "Liste non assignée" #: ipconst.slogarticle msgid "Generating OnArticle event" -msgstr "Génération d'un événement \"OnArticle\"" +msgstr "Génération d'un événement OnArticle" #: ipconst.slogauthlogin msgid " (ssAuthLogin)" @@ -590,11 +582,11 @@ msgstr " (ssEhlo)" #: ipconst.slogencodeactionstart msgid "Generating OnEncodeAction(Start)" -msgstr "Génération de \"OnEncodeAction(Start)\"" +msgstr "Génération de OnEncodeAction(Start)" #: ipconst.slogencodeactionstop msgid "Generating OnEncodeAction(Stop)" -msgstr "Génération de \"OnEncodeAction(Stop)\"" +msgstr "Génération de OnEncodeAction(Stop)" #: ipconst.slogexpand msgid " (ssExpand)" @@ -618,7 +610,7 @@ msgstr " (ssMailFrom)" #: ipconst.slogmultiline msgid "Generating OnMultiLineResponse event" -msgstr "Génération d'un événement \"OnMultiLineResponse\"" +msgstr "Génération d'un événement OnMultiLineResponse" #: ipconst.slognextmessagenotready msgid "Next message not ready" @@ -778,11 +770,11 @@ msgstr "[POP3] " #: ipconst.slogpop3message msgid "Generating OnMessage event" -msgstr "Génération d'un événement \"OnMessage\"" +msgstr "Génération d'un événement OnMessage" #: ipconst.slogpop3top msgid "Generating OnTop event" -msgstr "Génération d'un événement \"OnTop\"" +msgstr "Génération d'un événement OnTop" #: ipconst.slogpsapop msgid " (psApop)" @@ -870,7 +862,7 @@ msgstr " (ssRcptTo)" #: ipconst.slogresponse msgid "Generating OnResponse event, Code = " -msgstr "Génération d'un événement \"OnResponse\" - Code = " +msgstr "Génération d'un événement OnResponse - Code = " #: ipconst.slogrset msgid " (ssRSet)" @@ -898,7 +890,7 @@ msgstr "[SMTP] " #: ipconst.slogsmtpnextmessage msgid "Generating OnNextMessage event" -msgstr "Génération d'un événement \"OnNextMessage\"" +msgstr "Génération d'un événement OnNextMessage" #: ipconst.slogsoml msgid " (ssSoml)" @@ -934,7 +926,7 @@ msgstr " (stSendMail)" #: ipconst.slogtaskcomplete msgid "Generating OnTaskComplete event " -msgstr "Génération d'un événement \"OnTaskComplete\"" +msgstr "Génération d'un événement OnTaskComplete" #: ipconst.slogtaskstart msgid "Starting task: " @@ -950,15 +942,15 @@ msgstr " (ssVerify)" #: ipconst.smemmapfilenamerequired msgid "You must specify a file name for TIpMemMapStream" -msgstr "Vous devez spécifier un nom de fichier pour \"TIpMemMapStream\"" +msgstr "Vous devez spécifier un nom de fichier pour TIpMemMapStream" #: ipconst.smemmapmustbeclosed msgid "The %s method requires the TIpMemMapStream instance to be closed" -msgstr "La méthode %s requiert que l'instance de \"TIpMemMapStream\" soit fermée" +msgstr "La méthode %s requiert que l'instance de TIpMemMapStream soit fermée" #: ipconst.smemmapmustbeopen msgid "The %s method requires the TIpMemMapStream instance to be opened" -msgstr "La méthode %s requiert que l'instance de \"TIpMemMapStream\" soit ouverte" +msgstr "La méthode %s requiert que l'instance de TIpMemMapStream soit ouverte" #: ipconst.snntpcmdarticle msgid "ARTICLE" @@ -1248,15 +1240,15 @@ msgstr "Sélection en cours du groupe" #: ipconst.soriginfrombegin msgid "When origin is soFromBeginning, Offset must be >= 0" -msgstr "Quand l'origine est \"soFromBeginning\", l'offset doit être >= 0" +msgstr "Quand l'origine est soFromBeginning, l'offset doit être >= 0" #: ipconst.soriginfromend msgid "When origin is soFromEnd, Offset must be <= 0" -msgstr "Quand l'origine est \"soFromEnd\", l'offset doit être <= 0" +msgstr "Quand l'origine est soFromEnd, l'offset doit être <= 0" #: ipconst.spngbadbitdepth msgid "Unsupported Bit Depth of %d" -msgstr "Bit Depth de %d non supporté" +msgstr "Bit Depth de %d non pris en charge" #: ipconst.spngbadchunktype msgid "Unrecognized Chunk Type: %s" @@ -1296,7 +1288,7 @@ msgstr "Buffer PNG trop petit." #: ipconst.spngcannotsave msgid "PNG Saving is not supported" -msgstr "La sauvegarde de PNG n'est pas supportée" +msgstr "La sauvegarde de PNG n'est pas prise en charge" #: ipconst.spngchunkidandlength msgid "PNG Chunk: %s Length: %d" @@ -1376,7 +1368,7 @@ msgstr "Date de modification : %s" #: ipconst.spngnoclipboard msgid "PNG Clipboard support is not supported." -msgstr "Le format PNG n'est pas supporté par le presse-papier." +msgstr "Le format PNG n'est pas pris en charge par le presse-papiers" #: ipconst.spngpaletteentry msgid "Palette Entry %d - Red: %d Green: %d Blue: %d" @@ -1712,7 +1704,7 @@ msgstr "Attendre la réinitialisation du modem" #: ipconst.sreadlineerr msgid "Received line too long, exceeds MaxLineBuf" -msgstr "Ligne reçue trop longue : elle dépasse \"MaxLineBuf\"" +msgstr "Ligne reçue trop longue : elle dépasse MaxLineBuf" #: ipconst.srenameddiskfileto msgid "Renamed disk file to " @@ -1728,7 +1720,7 @@ msgstr "%s : le numéro de rangée est hors limites" #: ipconst.srowrowoor msgid "TIpTerminalArray.ScrollRows: either start row %d or end row %d is out of range" -msgstr "\"TIpTerminalArray.ScrollRows\" : débordement de valeur de rangée de début %d ou de fin %d" +msgstr "TIpTerminalArray.ScrollRows : débordement de valeur de rangée de début %d ou de fin %d" #: ipconst.sseekingdiskfileto msgid "Seeking disk file to " @@ -2153,7 +2145,7 @@ msgstr "Certificat non supporté." #: ipconst.ssslunsupportedchiper msgid "Unsupported cipher chosen." -msgstr "Le chiffrement choisi n'est pas supporté." +msgstr "Le chiffrement choisi n'est pas pris en charge" #: ipconst.ssslunsupportedencoding msgid "Unsupported public encoding." @@ -2252,7 +2244,7 @@ msgstr "Méthode d'encodage non supportée" #: ipconst.suuencodecounterr msgid "Count <> Len or Count > 63" -msgstr "\"Compte <> Longueur\" ou \"Compte > 63\"" +msgstr "Compte <> Longueur ou Compte > 63" #: ipconst.swebimagecannotload msgid "Cannot load %s" @@ -2485,7 +2477,7 @@ msgstr "Hôte introuvable" #: ipconst.swsanotinitialised msgid "Successful WSAStartup not yet performed" -msgstr "\"WSAStartup\" pas encore exécuté avec succès" +msgstr "WSAStartup pas encore exécuté avec succès" #: ipconst.swsano_data msgid "Valid name, no data record of requested type" diff --git a/languages/debuggerstrconst.fr.po b/languages/debuggerstrconst.fr.po index bae5014996..78d5101ae2 100644 --- a/languages/debuggerstrconst.fr.po +++ b/languages/debuggerstrconst.fr.po @@ -6,7 +6,7 @@ msgstr "" "POT-Creation-Date: \n" "PO-Revision-Date: 2015-04-19 18:09+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" -"Language-Team: \n" +"Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" diff --git a/languages/lazaruside.fr.po b/languages/lazaruside.fr.po index 31e27731a9..2f32049acf 100644 --- a/languages/lazaruside.fr.po +++ b/languages/lazaruside.fr.po @@ -3,7 +3,7 @@ msgstr "" "Project-Id-Version: lazaruside\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: \n" -"PO-Revision-Date: 2019-02-04 12:46+0100\n" +"PO-Revision-Date: 2019-02-07 12:54+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "Language: fr_FR\n" @@ -765,16 +765,12 @@ msgid "Auto save active desktop" msgstr "Sauvegarde automatique du bureau actif" #: lazarusidestrconsts.dlgautosaveactivedesktophint -#, fuzzy -#| msgid "" -#| "Save active desktop on IDE close\n" -#| "Save debug desktop on IDE close and debug end\n" msgid "" "Save active desktop on IDE close\n" "Save debug desktop on IDE close and debug end" msgstr "" "Sauvegarder le bureau actif à la fermeture de l'EDI\n" -"Sauvegarder le bureau de débogage à la fermeture de l'EDI et en fin de débogage\n" +"Sauvegarder le bureau de débogage à la fermeture de l'EDI et en fin de débogage" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" @@ -2275,16 +2271,12 @@ msgid "Included mixed state $IFDEF node" msgstr "État $IFDEF mixte (nœud)" #: lazarusidestrconsts.dlgimportdesktopexists -#, fuzzy -#| msgid "" -#| "A desktop with the same name already exists.\n" -#| "Please confirm the desktop name:\n" msgid "" "A desktop with the same name already exists.\n" "Please confirm the desktop name:" msgstr "" "Un bureau portant le même nom existe déjà.\n" -"Veuillez confirmer le nom du bureau :\n" +"Veuillez confirmer le nom du bureau :" #: lazarusidestrconsts.dlgincludeidentifierscontainingprefix msgid "Include identifiers containing prefix" @@ -3135,16 +3127,12 @@ msgid "Overwrite block" msgstr "Écraser le bloc" #: lazarusidestrconsts.dlgoverwritedesktop -#, fuzzy -#| msgid "" -#| "Desktop with the name \"%s\" was found.\n" -#| "Should the old desktop be overwritten?\n" msgid "" "Desktop with the name \"%s\" was found.\n" "Should the old desktop be overwritten?" msgstr "" "Un bureau portant le nom \"%s\" a été trouvé.\n" -"L'ancien bureau doit-il être remplacé ?\n" +"L'ancien bureau doit-il être remplacé ?" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" @@ -3401,7 +3389,7 @@ msgstr "Renommer le bureau" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" -msgstr "&Remplacer tout" +msgstr "&Tout remplacer" #: lazarusidestrconsts.dlgreplacewith msgid "Replace wit&h" @@ -3441,12 +3429,6 @@ msgid "Rubberband Selection" msgstr "Sélection de code" #: lazarusidestrconsts.dlgrunninginstancemodalerror -#, fuzzy -#| msgid "" -#| "The running Lazarus instance cannot accept any files.\n" -#| "Do you want to open them in a new IDE instance?\n" -#| "\n" -#| "%s\n" msgid "" "The running Lazarus instance cannot accept any files.\n" "Do you want to open them in a new IDE instance?\n" @@ -3456,7 +3438,7 @@ msgstr "" "L'instance en cours de Lazarus ne peut pas accepter de fichiers.\n" "Voulez-vous en ouvrir grâce à une nouvelle instance de l'EDI ?\n" "\n" -"%s\n" +"%s" #: lazarusidestrconsts.dlgrunninginstancenotrespondingerror msgid "Lazarus instance is running but not responding." @@ -5365,7 +5347,7 @@ msgstr "multiples configurations du compilateur trouvées : " #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" -msgstr "aucun \"fpc.cfg\" trouvé" +msgstr "aucun fpc.cfg trouvé" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" @@ -5373,7 +5355,7 @@ msgstr "non ASCII" #: lazarusidestrconsts.lisccoppuexiststwice msgid "ppu exists twice: %s, %s" -msgstr "\"ppu\" existe deux fois : %s, %s" +msgstr "ppu existe deux fois : %s, %s" #: lazarusidestrconsts.lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" @@ -5697,7 +5679,7 @@ msgstr "Dans le fichier %s" #: lazarusidestrconsts.liscfeinvalidcomponentowner msgid "Invalid component owner" -msgstr "Composant propriétaire (\"owner\") incorrect" +msgstr "Composant propriétaire incorrect" #: lazarusidestrconsts.liscferoot msgid "%sRoot=%s:%s" @@ -5758,7 +5740,7 @@ msgstr "Modifier la classe" #: lazarusidestrconsts.lischangedscoordofsfromdtodinsides msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." -msgstr "%s coordonnées %s de \"%d\" changées en \"%d\" dans %s." +msgstr "%s coordonnées %s de \"%d\" changées en \"%d\" dans %s." #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" @@ -6656,7 +6638,7 @@ msgstr "Valeur en texte" #: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid msgid "%s:%svalue \"%s\" is invalid." -msgstr "%s:%svaleur\"%s\" est incorrecte." +msgstr "%s:%svaleur \"%s\" est incorrecte." #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" @@ -6834,7 +6816,7 @@ msgstr "Compiler" #: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates msgid "Compile with -vd for more details. Check for duplicates." -msgstr "Compiler avec \"-vd\"pour plus de détails. Attention aux duplications." +msgstr "Compiler avec -vd pour plus de détails. Attention aux duplications." #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" @@ -6921,7 +6903,7 @@ msgstr "Configurer la création %s" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" -msgstr "Configurer la \"création de Lazarus\"" +msgstr "Configurer la \"construction de Lazarus\"" #: lazarusidestrconsts.lisconfigureeditortoolbar msgid "Configure Toolbar" @@ -7704,7 +7686,7 @@ msgstr "Créer un projet" #: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile msgid "Create/update .po file when saving a lfm file" -msgstr "Créer/mettre à jour le fichier \".po\" en enregistrant le fichier LFM" +msgstr "Créer/mettre à jour le fichier .po en enregistrant le fichier lfm" #: lazarusidestrconsts.liscreatingfileindexoffpcsources msgid "Creating file index of FPC sources %s ..." @@ -8601,16 +8583,12 @@ msgid "Do not write updated project info file after build. If not specified, bui msgstr "Ne pas écrire le fichier d'information du projet mis à jour après la construction. Sans spécification, le numéro de construction sera incrémenté s'il est configuré." #: lazarusidestrconsts.lisdonwloadonlinepackages -#, fuzzy -#| msgid "" -#| "The following package(s) are not available locally: %s.\n" -#| "In order to install it, you must download them first. Download now?\n" msgid "" "The following package(s) are not available locally: %s.\n" "In order to install it, you must download them first. Download now?" msgstr "" -"Les paquets suivants ne sont pas disponibles localement : %s.\n" -"Pour les installer, vous devez d'abord les télécharger. Voulez-vous les télécharger maintenant ?\n" +"Le ou les paquets suivants ne sont pas disponibles localement : %s.\n" +"Pour les installer, vous devez d'abord les télécharger. Voulez-vous le faire maintenant ?" #: lazarusidestrconsts.lisdown msgctxt "lazarusidestrconsts.lisdown" @@ -9090,7 +9068,7 @@ msgstr "Erreur dans les options personnalisées de l'éditeur de liens (Compilat #: lazarusidestrconsts.liserrorinthedebuggerpathaddition msgid "Error in the \"Debugger path addition\":" -msgstr "Erreur dans \"Ajout du chemin du débogueur\":" +msgstr "Erreur dans \"Ajout du chemin du débogueur\" :" #: lazarusidestrconsts.liserrorinthesearchpathforincludefiles msgid "Error in the search path for \"Include files\":" @@ -9098,7 +9076,7 @@ msgstr "Erreur dans le chemin de recherche des \"Fichiers d'inclusion\" :" #: lazarusidestrconsts.liserrorinthesearchpathforlibraries msgid "Error in the search path for \"Libraries\":" -msgstr "Erreur dans le chemin de recherche des \"Bibliothèques\":" +msgstr "Erreur dans le chemin de recherche des \"Bibliothèques\" :" #: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles msgid "Error in the search path for \"Object files\":" @@ -9114,11 +9092,11 @@ msgstr "Erreur dans le chemin de recherche des \"Autres fichiers unités\" :" #: lazarusidestrconsts.liserrorintheunitoutputdirectory msgid "Error in the \"unit output directory\":" -msgstr "Erreur dans le \"répertoire de sortie de l'unité\" :" +msgstr "Erreur dans le \"répertoire de sortie de l'unité\" :" #: lazarusidestrconsts.liserrorinvalidbuildmode msgid "Error: (lazarus) invalid build mode \"%s\"" -msgstr "Erreur : mode de construction \"%s\" incorrect" +msgstr "Erreur : (Lazarus) mode de construction \"%s\" incorrect" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" @@ -9154,7 +9132,7 @@ msgstr "Erreur à l'ouverture de la fiche" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." -msgstr "Erreur d'analyse du flux de composants \"lfm\"." +msgstr "Erreur d'analyse du flux de composants lfm." #: lazarusidestrconsts.liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" @@ -9224,7 +9202,7 @@ msgstr "Options du journal d'événements..." #: lazarusidestrconsts.liseventlogsavetofile msgid "Save Events to File" -msgstr "Sauver les événements dans un fichier" +msgstr "Sauvegarder les événements dans un fichier" #: lazarusidestrconsts.liseventslogaddcomment msgid "Add Comment ..." @@ -9826,7 +9804,7 @@ msgstr "Il y a une erreur de syntaxe dans l'élément FPDoc \"%s\":%s%s" #: lazarusidestrconsts.lisfppkgcompilerproblem msgid "there is a problem with the Free Pascal compiler executable, " -msgstr "Il y a un problème avec l'exécutable du compilateur Free Pascal, " +msgstr "il y a un problème avec l'exécutable du compilateur Free Pascal, " #: lazarusidestrconsts.lisfppkginstallationpath msgid "The prefix of the Free Pascal Compiler installation is required to create new configuration files for Fppkg. For example it has the units \"%s\" and/or \"%s\"" @@ -9959,17 +9937,6 @@ msgid "Goto selected" msgstr "Aller au sélectionné" #: lazarusidestrconsts.lisgplnotice -#, fuzzy -#| msgid "" -#| "<description>\n" -#| "\n" -#| "Copyright (C) <year> <name of author> <contact>\n" -#| "\n" -#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" -#| "\n" -#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" -#| "\n" -#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" msgid "" "<description>\n" "\n" @@ -9990,7 +9957,7 @@ msgstr "" "\n" "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" "\n" -"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" +"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." #: lazarusidestrconsts.lisgroup msgid "Group" @@ -9998,7 +9965,7 @@ msgstr "Groupe" #: lazarusidestrconsts.lisgroupassignexisting msgid "Assign to existing \"%s\" group?" -msgstr "Attribuer au groupe \"%s\" existant?" +msgstr "Attribuer au groupe \"%s\" existant ?" #: lazarusidestrconsts.lisgroupemptydelete msgid "No more breakpoints are assigned to group \"%s\", delete it?" @@ -10230,7 +10197,7 @@ msgstr "Création du Makefile pour le paquet %s" #: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage msgid "Error: running 'compile after' tool failed for package %s" -msgstr "Erreur : L'exécution de l'outil \"compile after\" a échoué pour le paquet %s" +msgstr "Erreur : L'exécution de l'outil \"compile after\" a échoué pour le paquet %s" #: lazarusidestrconsts.lisideinfoinformationabouttheide msgid "Information about the IDE" @@ -10298,7 +10265,7 @@ msgstr "Erreur à l'ouverture du fichier XML" #: lazarusidestrconsts.lisiecoerroropeningxmlfile msgid "Error opening XML file \"%s\":%s%s" -msgstr "Erreur à l'ouverture du fichier XML \"%s\":%s%s" +msgstr "Erreur à l'ouverture du fichier XML \"%s\" :%s%s" #: lazarusidestrconsts.lisiecoexportcompileroptions msgid "Export Compiler Options" @@ -10410,7 +10377,7 @@ msgstr "Impossible" #: lazarusidestrconsts.lisinasourcedirectoryofthepackage msgid "In a source directory of the package \"%s\"." -msgstr "Dans un répertoire de codes sources du paquet \"%s\"." +msgstr "Dans un répertoire de sources du paquet \"%s\"." #: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates msgid "In a source directory of the project. Check for duplicates." @@ -10690,16 +10657,12 @@ msgid "Install it, I like the fat" msgstr "Installer malgré tout" #: lazarusidestrconsts.lisinstallpackagesmsg -#, fuzzy -#| msgid "" -#| "The following packages are not installed, but available in the main repository: %s.\n" -#| "Do you wish to install missing packages?\n" msgid "" "The following packages are not installed, but available in the main repository: %s.\n" "Do you wish to install missing packages?" msgstr "" "Les paquets suivants ne sont pas installés, mais présents dans le répertoire principal : %s.\n" -"Voulez-vous installer les paquets manquants ?\n" +"Voulez-vous installer les paquets manquants ?" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" @@ -11744,17 +11707,6 @@ msgid "LFM is ok" msgstr "Fichier LFM correct" #: lazarusidestrconsts.lislgplnotice -#, fuzzy -#| msgid "" -#| "<description>\n" -#| "\n" -#| "Copyright (C) <year> <name of author> <contact>\n" -#| "\n" -#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" -#| "\n" -#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" -#| "\n" -#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" msgid "" "<description>\n" "\n" @@ -11775,7 +11727,7 @@ msgstr "" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" -"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" +"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." #: lazarusidestrconsts.lislibrarypath msgid "library path" @@ -11877,11 +11829,11 @@ msgstr "Chaîne de caractères en minuscules donnée en paramètre." #: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative msgid "lpk has vanished on disk. Using as alternative%s" -msgstr "\"lpk\" a disparu du disque. Utilisation de %s comme alternative" +msgstr "lpk a disparu du disque. Utilisation de %s comme alternative" #: lazarusidestrconsts.lislpkismissing msgid "lpk is missing" -msgstr "\"lpk\" est absent" +msgstr "lpk est absent" #: lazarusidestrconsts.lislrsincludefiles msgid "Lazarus resources (.lrs) include files" @@ -12153,7 +12105,7 @@ msgstr "Configurer les outils externes..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." -msgstr "Configurer la création de Lazarus..." +msgstr "Configurer la construction de Lazarus..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" @@ -12667,23 +12619,19 @@ msgstr "Raccourcis utilisés dans %s (%d)" #: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil msgid "ShowMenuEditor: TMenu parameter is nil" -msgstr "\"ShowMenuEditor\" : Le paramètre de \"TMenu\" est nul" +msgstr "ShowMenuEditor : le paramètre de TMenu est nul" #: lazarusidestrconsts.lismenueditorsins msgid "\"%s\" in %s" msgstr "\"%s\" dans %s" #: lazarusidestrconsts.lismenueditorsisalreadyinuse -#, fuzzy -#| msgid "" -#| "\"%s\" is already in use in %s as a shortcut.\n" -#| "Try a different shortcut.\n" msgid "" "\"%s\" is already in use in %s as a shortcut.\n" "Try a different shortcut." msgstr "" "\"%s\" est déjà utilisé dans %s comme raccourci.\n" -"Veuillez essayer un raccourci différent.\n" +"Veuillez essayer un raccourci différent." #: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand msgid "Please expand: \"%s\" is not a sufficient Description" @@ -12726,11 +12674,6 @@ msgid "Template saved" msgstr "Modèle enregistré" #: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates -#, fuzzy -#| msgid "" -#| "There are no user-saved menu templates.\n" -#| "\n" -#| "Only standard default templates are available.\n" msgid "" "There are no user-saved menu templates.\n" "\n" @@ -12738,23 +12681,19 @@ msgid "" msgstr "" "Il n'y a pas de modèles de menu sauvegardés par l'utilisateur.\n" "\n" -"Seuls les modèles standard sont disponibles.\n" +"Seuls les modèles standard sont disponibles." #: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" msgstr "TSCList.GetScanListCompName : index %d incorrect pour FScanList" #: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict -#, fuzzy -#| msgid "" -#| "You have to change the shortcut from %s\n" -#| "to avoid a conflict\n" msgid "" "You have to change the shortcut from %s\n" "to avoid a conflict" msgstr "" "Vous devez modifier le raccourci depuis %s\n" -"afin d'éviter un conflit\n" +"afin d'éviter un conflit" #: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption msgid "You must enter text for the Caption" @@ -13567,17 +13506,6 @@ msgid "Skip this Unit" msgstr "Ignorer cette unité" #: lazarusidestrconsts.lismitnotice -#, fuzzy -#| msgid "" -#| "<description>\n" -#| "\n" -#| "Copyright (c) <year> <copyright holders>\n" -#| "\n" -#| "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" -#| "\n" -#| "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" -#| "\n" -#| "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n" msgid "" "<description>\n" "\n" @@ -13599,7 +13527,7 @@ msgstr "" "\n" "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" "\n" -"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n" +"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." #: lazarusidestrconsts.lismmadditionsandoverrides msgid "Additions and Overrides" @@ -13772,19 +13700,6 @@ msgid ", Mode: %s" msgstr " - Mode : %s" #: lazarusidestrconsts.lismodifiedlgplnotice -#, fuzzy -#| msgid "" -#| "<description>\n" -#| "\n" -#| "Copyright (C) <year> <name of author> <contact>\n" -#| "\n" -#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" -#| "\n" -#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" -#| "\n" -#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" -#| "\n" -#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" msgid "" "<description>\n" "\n" @@ -13809,7 +13724,7 @@ msgstr "" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" -"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n" +"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." #: lazarusidestrconsts.lismodify msgid "&Modify" @@ -14075,7 +13990,7 @@ msgstr "Aucune option de compilateur héritée." #: lazarusidestrconsts.lisnofppkgprefix msgid "empty Free Pascal compiler prefix." -msgstr "Préfixe du compilateur Free Pascal vide." +msgstr "préfixe du compilateur Free Pascal vide." #: lazarusidestrconsts.lisnohints msgid "no hints" @@ -15001,7 +14916,7 @@ msgstr "Fondamental : ne peut être désinstallé" #: lazarusidestrconsts.lispckexplinstalled msgctxt "lazarusidestrconsts.lispckexplinstalled" msgid "Installed" -msgstr "Installés" +msgstr "Installé(s)" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" @@ -15378,7 +15293,7 @@ msgstr "%sAjout d'une nouvelle dépendance pour le projet %s : paquet %s" #: lazarusidestrconsts.lispkgmangaddunittousesclause msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." -msgstr "Ajouter l'unité à la clause \"uses\" du fichier principal du paquet. Ne désactiver ce comportement que pour les unités qui ne doivent pas être recompilées dans tous les cas." +msgstr "Ajouter l'unité à la clause uses du fichier principal du paquet. Ne désactiver ce comportement que pour les unités qui ne doivent pas être recompilées dans tous les cas." #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" @@ -15430,7 +15345,7 @@ msgstr "Erreur de lecture du paquet" #: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage msgid "Error: updating po files failed for package %s" -msgstr "Erreur : la mise à jour des fichiers \".po\" a échoué pour le paquet %s" +msgstr "Erreur : la mise à jour des fichiers .po a échoué pour le paquet %s" #: lazarusidestrconsts.lispkgmangerrorwritingfile msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" @@ -15571,16 +15486,12 @@ msgid "One or more required packages were not found. See package graph for detai msgstr "Un ou plusieurs paquets sont introuvables. Voir le graphe des paquets pour les détails." #: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage -#, fuzzy -#| msgid "" -#| "The package %s is already open in the IDE.\n" -#| "You cannot save a package with the same name.\n" msgid "" "The package %s is already open in the IDE.\n" "You cannot save a package with the same name." msgstr "" -"Le paquet \"%s\" est déjà ouvert dans l'EDI.\n" -"Vous ne pouvez pas sauvegarder un paquet portant le même nom.\n" +"Le paquet %s est déjà ouvert dans l'EDI.\n" +"Vous ne pouvez pas sauvegarder un paquet portant le même nom." #: lazarusidestrconsts.lispkgmangsavepackage msgid "Save package?" @@ -15641,7 +15552,7 @@ msgstr "Les paquets suivants n'ont pas pu être chargés :" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s" -msgstr "%sLes unités suivantes seront ajoutées à la clause \"uses\" de%s%s:%s%s" +msgstr "%sLes unités suivantes seront ajoutées à la clause uses de%s%s:%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?" @@ -15789,7 +15700,7 @@ msgstr "Utiliser l'unité" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file \"%s\"%sbelongs to the current project." -msgstr "Avertissement : le fichier \"%s\"%sappartient projet actuel." +msgstr "Avertissement : le fichier \"%s\"%sappartient au projet actuel." #: lazarusidestrconsts.lispkgmgrkeep msgctxt "lazarusidestrconsts.lispkgmgrkeep" @@ -15837,7 +15748,7 @@ msgstr "Nom d'unité incorrecte : %s" #: lazarusidestrconsts.lispkgsyslpkfilename msgid "%s%slpk file: \"%s\"" -msgstr "%s%sfichier du paquet : \"%s\"" +msgstr "%s%sfichier lpk : \"%s\"" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" @@ -15853,7 +15764,7 @@ msgstr "La procédure Register est à nil" #: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called but no package is registering." -msgstr "\"RegisterUnit\" a été appelé, mais aucun paquet n'est en cours de référencement." +msgstr "RegisterUnit a été appelé, mais aucun paquet n'est en cours de référencement." #: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound msgid "%s%sThe lpk file was not found." @@ -15906,7 +15817,7 @@ msgstr "Impossible de lire le fichier du paquet \"%s\".%sErreur : %s" #: lazarusidestrconsts.lisplay msgid "Play" -msgstr "Jouer" +msgstr "Exécuter" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" @@ -16021,11 +15932,11 @@ msgstr "Enregistrer dans le fichier .lps du dossier de configuration de l'EDI" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" -msgstr "Sauver dans un fichier .lpi" +msgstr "Sauvegarder dans un fichier .lpi" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" -msgstr "Sauver dans un fichier .lps du dossier projet" +msgstr "Sauvegarder dans un fichier .lps du dossier projet" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" @@ -16045,7 +15956,7 @@ msgstr "%s (position hors du code source)" #: lazarusidestrconsts.lisppuinwrongdirectory msgid "ppu in wrong directory=%s." -msgstr "\"ppu\" dans un répertoire incorrect = %s." +msgstr "ppu dans un répertoire incorrect = %s." #: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg msgid "%s.ppu not found. Check your fpc.cfg." @@ -16790,19 +16701,6 @@ msgid "Result:" msgstr "Résultat :" #: lazarusidestrconsts.lisreturnparameterindexedword -#, fuzzy -#| msgid "" -#| "Return parameter-indexed word from the current line preceding cursor position.\n" -#| "\n" -#| "Words in a line are numbered 1,2,3,... from left to right, but the last word\n" -#| "which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" -#| "is always the current macro.\n" -#| "\n" -#| "Example line:\n" -#| "i 0 count-1 forb|\n" -#| "Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" -#| "\n" -#| "In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n" msgid "" "Return parameter-indexed word from the current line preceding cursor position.\n" "\n" @@ -16826,15 +16724,9 @@ msgstr "" "i 0 count-1 forb|\n" "Ici, $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" "\n" -"À la fin de votre modèle, utilisez $PrevWord(-1) qui ne donnera qu'une chaîne vide, mais qui opèrera un nettoyage important de tous les $PrevWords trouvés. En bonus, voici une expression régulière utilisée afin de détecter les mots pour cette macro : [\\w\\-+*\\(\\)\\[\\].^@]+\n" +"À la fin de votre modèle, utilisez $PrevWord(-1) qui ne donnera qu'une chaîne vide, mais qui opèrera un nettoyage important de tous les $PrevWords trouvés. En bonus, voici une expression régulière utilisée afin de détecter les mots pour cette macro : [\\w\\-+*\\(\\)\\[\\].^@]+" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria -#, fuzzy -#| msgid "" -#| "Return the list of all values of case variable in front of variable.\n" -#| "\n" -#| "Optional Parameters (comma separated):\n" -#| "WithoutExtraIndent // the case list will be generated without extra indentation\n" msgid "" "Return the list of all values of case variable in front of variable.\n" "\n" @@ -16844,7 +16736,7 @@ msgstr "" "Retourne la liste de toutes les valeurs de la variable \"case\" en face de la variable.\n" "\n" "Paramètres facultatifs (séparés par des virgules) :\n" -"WithoutExtraIndent // la liste de cas sera générée sans indentation supplémentaire.\n" +"WithoutExtraIndent // la liste de cas sera générée sans indentation supplémentaire" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" @@ -17725,7 +17617,7 @@ msgstr "Basculer les paramètres de filtre" #: lazarusidestrconsts.lisswitchtofavoritestabafterasking msgid "Switch to Favorites tab after asking for component name." -msgstr "Basculer vers l'onglet \"Favoris\" après avoir demandé le nom du composant." +msgstr "Basculer vers l'onglet Favoris après avoir demandé le nom du composant." #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" @@ -18354,7 +18246,7 @@ msgstr "Seul le mode de construction par défaut existe pour ce projet." #: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." -msgstr "Ce jeu d'options pour construire Lazarus n'est pas supporté par cette installation.%sLe répertoire \"%s\" est en lecture seule.%sVoir le site Lazarus pour d'autres façons d'installer Lazarus." +msgstr "Ce jeu d'options pour construire Lazarus n'est pas pris en charge par cette installation.%sLe répertoire \"%s\" est en lecture seule.%sVoir le site Lazarus pour d'autres façons d'installer Lazarus." #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." @@ -19032,7 +18924,7 @@ msgstr "Impossible de placer le contrôle d'ancrage latéral" #: lazarusidestrconsts.lisunabletoshowmethod msgid "Unable to show method." -msgstr "Incapable de montrer la méthode." +msgstr "Impossible de montrer la méthode." #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" @@ -19403,7 +19295,7 @@ msgstr "Avertissement : " #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\"" -msgstr "Avertissement : le fichier équivoque \"%s\" est équivoque. Le fichier de code source est : \"%s\"" +msgstr "Avertissement : le fichier \"%s\" est équivoque. Le fichier du source est : \"%s\"" #: lazarusidestrconsts.liswarnings msgid ", Warnings: %s" @@ -19725,7 +19617,7 @@ msgstr "Incrémenter automatiquement le numéro de construction" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint msgid "Increased every time the project is compiled." -msgstr "Incrémenté à chaque compilation du programme." +msgstr "Incrémenté à chaque compilation du projet." #: lazarusidestrconsts.rsbuild msgid "&Build:" @@ -20971,7 +20863,7 @@ msgstr "arrêter le programme" #: lazarusidestrconsts.srkmecsynmacroplay msgid "Play Macro" -msgstr "Jouer la macro" +msgstr "Exécuter la macro" #: lazarusidestrconsts.srkmecsynmacrorecord msgid "Record Macro" @@ -21467,7 +21359,7 @@ msgstr "Fermer les pages à &droite" #: lazarusidestrconsts.uemcloseotherpagesrightplain msgid "Close Pages on the Right" -msgstr "Fermer les pages à &gauche" +msgstr "Fermer les pages à droite" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" @@ -21543,27 +21435,27 @@ msgstr "&Verrouiller la page" #: lazarusidestrconsts.uemmovepageleft msgid "Move Page Left" -msgstr "Déplacer la page vers la gauche" +msgstr "Vers la gauche" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move Page Leftmost" -msgstr "Déplacer la page le plus à gauche possible" +msgstr "Le plus à gauche possible" #: lazarusidestrconsts.uemmovepageright msgid "Move Page Right" -msgstr "Déplacer la page vers la droite" +msgstr "Vers la droite" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move Page Rightmost" -msgstr "Déplacer la page le plus à droite possible" +msgstr "Le plus à droite possible" #: lazarusidestrconsts.uemmovetonewwindow msgid "Move to New Window" -msgstr "Se déplacer vers une nouvelle fenêtre" +msgstr "Déplacer vers une nouvelle fenêtre" #: lazarusidestrconsts.uemmovetootherwindow msgid "Move to Other Window" -msgstr "Se déplacer vers une autre fenêtre" +msgstr "Déplacer vers une autre fenêtre" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" diff --git a/tools/glazres/languages/glazres.fr.po b/tools/glazres/languages/glazres.fr.po index dee6c83371..237e5a3765 100644 --- a/tools/glazres/languages/glazres.fr.po +++ b/tools/glazres/languages/glazres.fr.po @@ -9,7 +9,7 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 1.8.7\n" +"X-Generator: Poedit 2.2.1\n" #: glazresmain.cbtncancel msgid "Cancel" @@ -27,7 +27,7 @@ msgstr "Enregistrer le fichier de ressources sous" #: glazresmain.errconverttotext msgid "ERROR: unable to convert Delphi form to text: \"%s\"" -msgstr "ERREUR : impossible de convertir la fiche Delphi en texte : \"%s\"" +msgstr "ERREUR : Impossible de convertir la fiche Delphi en texte : \"%s\"" #: glazresmain.errcreate msgid "ERROR: Cannot create \"%s\"" @@ -43,11 +43,11 @@ msgstr "ERREUR : Fichier introuvable : \"%s\"" #: glazresmain.errnoresourcename msgid "ERROR: No resourcename found for \"%s\"" -msgstr "ERREUR: Aucun nom de ressource trouvé pour \"%s\"" +msgstr "ERREUR : Aucun nom de ressource trouvé pour \"%s\"" #: glazresmain.errread msgid "ERROR: Cannot read from \"%s\"" -msgstr "ERREUR : impossible de lire à partir de \"%s\"" +msgstr "ERREUR : Impossible de lire à partir de \"%s\"" #: glazresmain.msgcreatinglrs msgid "Creating \"%s\"" @@ -62,16 +62,12 @@ msgid " Resource name = \"%s\", Type = \"%s\"" msgstr " Nom de la ressource = \"%s\" - Type = \"%s\"" #: glazresmain.msgsuccess -#, fuzzy -#| msgid "" -#| "Done.\n" -#| "Number of resources added: %d.\n" msgid "" "Done.\n" "Number of resources added: %d." msgstr "" "Terminé.\n" -"Nombre de ressources ajoutées : %d.\n" +"Nombre de ressources ajoutées : %d." #: glazresmain.msgwrongext msgid "Filename does not have the required extension: fix it?" diff --git a/tools/jsonviewer/languages/jsonviewer.fr.po b/tools/jsonviewer/languages/jsonviewer.fr.po index a43b763085..11fe2f9417 100644 --- a/tools/jsonviewer/languages/jsonviewer.fr.po +++ b/tools/jsonviewer/languages/jsonviewer.fr.po @@ -4,13 +4,13 @@ msgstr "" "Plural-Forms: nplurals=2; plural=(n > 1);\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-29 15:02+0100\n" -"PO-Revision-Date: 2018-10-08 11:59+0200\n" +"PO-Revision-Date: 2019-02-07 09:00+0100\n" "Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr_FR\n" -"X-Generator: Poedit 2.1.1\n" +"X-Generator: Poedit 2.2.1\n" #: msgjsonviewer.sarray msgid "Array (%d elements)" @@ -38,16 +38,12 @@ msgid "JSON document modified" msgstr "Document JSON modifié" #: msgjsonviewer.sdocumentmodifiedaction -#, fuzzy -#| msgid "" -#| "The JSON data in \"%s\" was changed but not saved.\n" -#| "What do want to do ?\n" msgid "" "The JSON data in \"%s\" was changed but not saved.\n" "What do want to do ?" msgstr "" -"Les données JSON dans \"%s\"ont été modifiées mais pas enregistrées.\n" -"Que voulez-vous faire ?\n" +"Les données JSON dans \"%s\"ont été modifiées mais pas enregistrées.\n" +"Que voulez-vous faire ?" #: msgjsonviewer.sduplicatemembername msgid "Duplicate member name \"%s\"." diff --git a/tools/lazdatadesktop/languages/lazdatadesktop.fr.po b/tools/lazdatadesktop/languages/lazdatadesktop.fr.po index b8f7892903..bc4e4851a2 100644 --- a/tools/lazdatadesktop/languages/lazdatadesktop.fr.po +++ b/tools/lazdatadesktop/languages/lazdatadesktop.fr.po @@ -3,13 +3,13 @@ msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Project-Id-Version: \n" "POT-Creation-Date: 2015-04-14 07:54+0100\n" -"PO-Revision-Date: 2017-05-27 19:07+0200\n" -"Last-Translator: <h.mira@free.fr>\n" +"PO-Revision-Date: 2019-02-07 09:05+0100\n" +"Last-Translator: h.mira@free.fr\n" "Language-Team: http://lazarus.developpez.com/\n" "MIME-Version: 1.0\n" "Content-Transfer-Encoding: 8bit\n" "Language: fr\n" -"X-Generator: Poedit 2.0.1\n" +"X-Generator: Poedit 2.2.1\n" #: lazdatadeskstr.eoaddterminator msgid "Add terminator" @@ -37,7 +37,7 @@ msgstr "Ignorer les clés étrangères" #: lazdatadeskstr.eouseoldinwhereparams msgid "Use OLD prefix in where parameters" -msgstr "Utiliser le préfixe ANCIEN pour les paramètres WHERE" +msgstr "Utiliser l'ANCIEN préfixe pour les paramètres WHERE" #: lazdatadeskstr.sabortscript msgid "Abort the script" @@ -68,7 +68,7 @@ msgstr "Taille" #: lazdatadeskstr.scoltype msgid "Type" -msgstr "Type " +msgstr "Type" #: lazdatadeskstr.sconfirmclose msgid "Confirm close" @@ -79,16 +79,12 @@ msgid "Enter a descriptive name for the connection" msgstr "Entrez un nom descriptif pour la connexion" #: lazdatadeskstr.sconnectionnameexists -#, fuzzy -#| msgid "" -#| "There is already a connection named \"%s\"\n" -#| "Would you like to override the connection data ?\n" msgid "" "There is already a connection named \"%s\"\n" "Would you like to override the connection data ?" msgstr "" "Il existe déjà une connexion nommée \"%s\"\n" -"Souhaitez-vous remplacer les données de connexion?\n" +"Souhaitez-vous remplacer les données de connexion?" #: lazdatadeskstr.screatecode msgid "Create code" @@ -99,16 +95,12 @@ msgid "Would you like to create a new connection for this database ?" msgstr "Voulez-vous créer une nouvelle connexion pour cette base de données ?" #: lazdatadeskstr.sddmodified -#, fuzzy -#| msgid "" -#| "Data dictionary \"%s\" has changed.\n" -#| "What do you want to do with the changes?\n" msgid "" "Data dictionary \"%s\" has changed.\n" "What do you want to do with the changes?" msgstr "" "Le dictionnaire de données \"%s\" a changé.\n" -"Que voulez-vous faire avec les changements?\n" +"Que voulez-vous faire des changements ?" #: lazdatadeskstr.sdeleteobject msgid "Delete this %s" @@ -144,16 +136,12 @@ msgid "Error in SQL script" msgstr "Erreur dans le script SQL" #: lazdatadeskstr.serrinscriptchoice -#, fuzzy -#| msgid "" -#| "An error occurred in the SQL script.\n" -#| "How would you like to continue ?\n" msgid "" "An error occurred in the SQL script.\n" "How would you like to continue ?" msgstr "" "Une erreur est survenue dans le script SQL.\n" -"Comment souhaitez-vous poursuivre ?\n" +"Comment souhaitez-vous poursuivre ?" #: lazdatadeskstr.serrnoengine msgid "No database engine !" @@ -169,7 +157,7 @@ msgstr "Aucun champ sélectionné. Veuillez sélectionner certains champs" #: lazdatadeskstr.serrselecttable msgid "No table selected. Please select a table" -msgstr "Aucune table sélectionnée. Veuillez sélectionner une table" +msgstr "Aucune table sélectionnée. Veuillez en sélectionner une" #: lazdatadeskstr.serrunknowndirective msgid "Unknown directive: %s (args: %s)" @@ -422,7 +410,7 @@ msgstr "&Enregistrer" #: lazdatadeskstr.sld_actionsaveas msgid "Save &as" -msgstr "Enregistrer sous..." +msgstr "Enregistrer &sous" #: lazdatadeskstr.sld_actionsaveash msgid "Save data dictionary as" @@ -482,7 +470,7 @@ msgstr "Créer la table" #: lazdatadeskstr.sld_database msgctxt "lazdatadeskstr.sld_database" msgid "Database" -msgstr "Base de données " +msgstr "Base de données" #: lazdatadeskstr.sld_delete msgctxt "lazdatadeskstr.sld_delete" @@ -732,7 +720,7 @@ msgstr "Entrer un nom pour le nouvel index :" #: lazdatadeskstr.snewobject msgid "Create new %s" -msgstr "Créer un nouveau%s" +msgstr "Créer un nouveau %s" #: lazdatadeskstr.snewsequence msgid "Create new sequence" @@ -757,7 +745,7 @@ msgstr "Suivant" #: lazdatadeskstr.snodedatabase msgctxt "lazdatadeskstr.snodedatabase" msgid "Database" -msgstr "Base de données " +msgstr "Base de données" #: lazdatadeskstr.snodedatadictionary msgid "Data dictionary" @@ -782,7 +770,7 @@ msgstr "Index" #: lazdatadeskstr.snodeindexfields msgid "Index fields: " -msgstr "Champs index : " +msgstr "Champs d'index : " #: lazdatadeskstr.snodeindexoptions msgid "Index options: " @@ -813,16 +801,12 @@ msgid "Previous" msgstr "Précédent" #: lazdatadeskstr.sql_noconnectionsfound -#, fuzzy -#| msgid "" -#| "No connections or data dictionaries were found.\n" -#| " Start by creating a new connection or data dictionary.\n" msgid "" "No connections or data dictionaries were found.\n" " Start by creating a new connection or data dictionary." msgstr "" "Connexions ou dictionnaires de données introuvables.\n" -" Commencez par créer une connexion ou un dictionnaire de données.\n" +" Commencez par créer une connexion ou un dictionnaire de données." #: lazdatadeskstr.squery msgid "Run query"