diff --git a/components/codetools/languages/codetoolsstrconsts.ca.po b/components/codetools/languages/codetoolsstrconsts.ca.po index 5610b1375e..06c15e3898 100644 --- a/components/codetools/languages/codetoolsstrconsts.ca.po +++ b/components/codetools/languages/codetoolsstrconsts.ca.po @@ -253,6 +253,10 @@ msgstr "Directori de les JitForm" msgid "Lazarus Sources" msgstr "Fonts del Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Activa els comentaris niats" @@ -501,6 +505,10 @@ msgstr "no existeix el fitxer \"%s\"" msgid "file is read only" msgstr "el fitxer és només de lectura" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "directori d'interfície del gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.de.po b/components/codetools/languages/codetoolsstrconsts.de.po index 1ee0a47ce6..169eaecd8f 100644 --- a/components/codetools/languages/codetoolsstrconsts.de.po +++ b/components/codetools/languages/codetoolsstrconsts.de.po @@ -256,6 +256,10 @@ msgstr "JITForm-Verzeichnis" msgid "Lazarus Sources" msgstr "Lazarus-Quellen" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Geschachtelte Kommentare An" @@ -504,6 +508,10 @@ msgstr "Datei \"%s\" ist nicht vorhanden" msgid "file is read only" msgstr "Datei ist schreibgeschützt" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "Gtk-Interface-Verzeichnis" diff --git a/components/codetools/languages/codetoolsstrconsts.es.po b/components/codetools/languages/codetoolsstrconsts.es.po index 3e48f7a67e..b0ed5e4734 100644 --- a/components/codetools/languages/codetoolsstrconsts.es.po +++ b/components/codetools/languages/codetoolsstrconsts.es.po @@ -252,6 +252,10 @@ msgstr "Directorio JITForm" msgid "Lazarus Sources" msgstr "Fuentes de Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Comentarios anidados" @@ -500,6 +504,10 @@ msgstr "archivo \"%s\" no existe" msgid "file is read only" msgstr "archivo es de slo lectura" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "directorio de la interfase gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.esutf.po b/components/codetools/languages/codetoolsstrconsts.esutf.po index 7d9090355a..ec6d5f838c 100644 --- a/components/codetools/languages/codetoolsstrconsts.esutf.po +++ b/components/codetools/languages/codetoolsstrconsts.esutf.po @@ -252,6 +252,10 @@ msgstr "Directorio JITForm" msgid "Lazarus Sources" msgstr "Fuentes de Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Comentarios anidados" @@ -500,6 +504,10 @@ msgstr "archivo \"%s\" no existe" msgid "file is read only" msgstr "archivo es de sólo lectura" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "directorio de la interfase gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.fi.po b/components/codetools/languages/codetoolsstrconsts.fi.po index 8da317242c..015a7fc2d3 100644 --- a/components/codetools/languages/codetoolsstrconsts.fi.po +++ b/components/codetools/languages/codetoolsstrconsts.fi.po @@ -242,6 +242,10 @@ msgstr "" msgid "Lazarus Sources" msgstr "" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "" @@ -490,6 +494,10 @@ msgstr "" msgid "file is read only" msgstr "Tiedosto on vain luettavissa" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "" diff --git a/components/codetools/languages/codetoolsstrconsts.fr.po b/components/codetools/languages/codetoolsstrconsts.fr.po index 9f9ee86b4f..5ec596ef93 100644 --- a/components/codetools/languages/codetoolsstrconsts.fr.po +++ b/components/codetools/languages/codetoolsstrconsts.fr.po @@ -254,6 +254,10 @@ msgstr "Répertoire JITForm" msgid "Lazarus Sources" msgstr "Sources de Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Commentaires imbriqués sur" @@ -502,6 +506,10 @@ msgstr "le fichier \"%s\" n'existe pas" msgid "file is read only" msgstr "le fichier est en lecture seule" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "répertoire interface pour gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.id.po b/components/codetools/languages/codetoolsstrconsts.id.po index b6e98dd4cf..830addc3ce 100644 --- a/components/codetools/languages/codetoolsstrconsts.id.po +++ b/components/codetools/languages/codetoolsstrconsts.id.po @@ -255,6 +255,10 @@ msgstr "Direktori JITForm" msgid "Lazarus Sources" msgstr "Sumber Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Komentar Berulang On" @@ -503,6 +507,10 @@ msgstr "file \"%s\" tidak ada" msgid "file is read only" msgstr "file hanya baca" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "Direktori interface gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.it.po b/components/codetools/languages/codetoolsstrconsts.it.po index 6b3037af67..0d228a4340 100644 --- a/components/codetools/languages/codetoolsstrconsts.it.po +++ b/components/codetools/languages/codetoolsstrconsts.it.po @@ -252,6 +252,10 @@ msgstr "Directory JITForm" msgid "Lazarus Sources" msgstr "Sorgenti di Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Commenti nidificati abilitati" @@ -500,6 +504,10 @@ msgstr "il file \"%s\" non esite" msgid "file is read only" msgstr "il file è in sola lettura" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "gtk2 directory di interfaccia" diff --git a/components/codetools/languages/codetoolsstrconsts.lt.po b/components/codetools/languages/codetoolsstrconsts.lt.po index 52d7a9b3f6..0ab0f5e17d 100644 --- a/components/codetools/languages/codetoolsstrconsts.lt.po +++ b/components/codetools/languages/codetoolsstrconsts.lt.po @@ -1,14 +1,9 @@ -# translation of codetoolsstrconsts.po to Lithuanian -# Header entry was created by KBabel! -# -#: codetoolsstrconsts:ctsothercompilerdefines -# Valdas Jankūnas , 2007. +# translation of codetoolsstrconsts.po to Lithuanian Header entry was created by KBabel!: codetoolsstrconsts:ctsothercompilerdefines Valdas Jankūnas , 2007. msgid "" msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"Mime-Version: 1.0" -"Last-Translator: Valdas Jankūnas \n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" "PO-Revision-Date: 2007-08-27 21:19+0300\n" "Project-Id-Version: codetoolsstrconsts\n" "Language-Team: Lithuanian\n" @@ -259,6 +254,10 @@ msgstr "JITForm katalogas" msgid "Lazarus Sources" msgstr "Lazarus pirminis kodas" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Įdėtiniai komentarai įgalinti" @@ -507,6 +506,10 @@ msgstr "failas \"%s\" neegzistuoja" msgid "file is read only" msgstr "failas tik skaitymui" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "gtk2 interfeiso katalogas" @@ -539,7 +542,7 @@ msgstr "rastas klaidinga patiksla %s" msgid "implementation node not found" msgstr "nerastas realizacijos mazgas" -#: codetoolsstrconsts:įdėjimo +#: codetoolsstrconsts:ctsincludedirectoriesplusdirs msgid "include directories: %s" msgstr "įdėjimo katalogai: %s" diff --git a/components/codetools/languages/codetoolsstrconsts.nl.po b/components/codetools/languages/codetoolsstrconsts.nl.po index c5ecd476f4..b80d1deced 100644 --- a/components/codetools/languages/codetoolsstrconsts.nl.po +++ b/components/codetools/languages/codetoolsstrconsts.nl.po @@ -253,6 +253,10 @@ msgstr "" msgid "Lazarus Sources" msgstr "" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "" @@ -501,6 +505,10 @@ msgstr "" msgid "file is read only" msgstr "bestand is alleen lezen" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "" diff --git a/components/codetools/languages/codetoolsstrconsts.pb.po b/components/codetools/languages/codetoolsstrconsts.pb.po index f0ba4f5b43..4317009dbf 100644 --- a/components/codetools/languages/codetoolsstrconsts.pb.po +++ b/components/codetools/languages/codetoolsstrconsts.pb.po @@ -242,6 +242,10 @@ msgstr "Diretorio JITForm" msgid "Lazarus Sources" msgstr "Fontes do Lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Comentarios Aninhados" @@ -490,6 +494,10 @@ msgstr "arquivo \"%s\" nao existe" msgid "file is read only" msgstr "arquivo e somente-leitura" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "diretorio de interface gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.pl.po b/components/codetools/languages/codetoolsstrconsts.pl.po index 80b2a2fcfa..ced80b585a 100644 --- a/components/codetools/languages/codetoolsstrconsts.pl.po +++ b/components/codetools/languages/codetoolsstrconsts.pl.po @@ -257,6 +257,10 @@ msgstr "Katalog JITForm" msgid "Lazarus Sources" msgstr "źródła lazarusa" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Włączone zagnieżdżanie komentarzy" @@ -505,6 +509,10 @@ msgstr "plik \"%s\" nie istnieje" msgid "file is read only" msgstr "plik jest tylko do odczytu" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "katalog interfejsu gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.pliso.po b/components/codetools/languages/codetoolsstrconsts.pliso.po index 1903f55851..1ecd461c7d 100644 --- a/components/codetools/languages/codetoolsstrconsts.pliso.po +++ b/components/codetools/languages/codetoolsstrconsts.pliso.po @@ -253,6 +253,10 @@ msgstr "Katalog JITForm" msgid "Lazarus Sources" msgstr "rda lazarusa" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Wczone zagniedanie komentarzy" @@ -501,6 +505,10 @@ msgstr "plik \"%s\" nie istnieje" msgid "file is read only" msgstr "plik jest tylko do odczytu" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "katalog interfejsu gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.plwin.po b/components/codetools/languages/codetoolsstrconsts.plwin.po index 8d283df1f4..b9865adaf7 100644 --- a/components/codetools/languages/codetoolsstrconsts.plwin.po +++ b/components/codetools/languages/codetoolsstrconsts.plwin.po @@ -253,6 +253,10 @@ msgstr "Katalog JITForm" msgid "Lazarus Sources" msgstr "rda lazarusa" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Wczone zagniedanie komentarzy" @@ -501,6 +505,10 @@ msgstr "plik \"%s\" nie istnieje" msgid "file is read only" msgstr "plik jest tylko do odczytu" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "katalog interfejsu gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.po b/components/codetools/languages/codetoolsstrconsts.po index f3b978225e..1b438935d8 100644 --- a/components/codetools/languages/codetoolsstrconsts.po +++ b/components/codetools/languages/codetoolsstrconsts.po @@ -242,6 +242,10 @@ msgstr "" msgid "Lazarus Sources" msgstr "" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "" @@ -490,6 +494,10 @@ msgstr "" msgid "file is read only" msgstr "" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "" diff --git a/components/codetools/languages/codetoolsstrconsts.ru.po b/components/codetools/languages/codetoolsstrconsts.ru.po index 8eaa2e0f8e..c297eb69a1 100644 --- a/components/codetools/languages/codetoolsstrconsts.ru.po +++ b/components/codetools/languages/codetoolsstrconsts.ru.po @@ -253,6 +253,10 @@ msgstr "Каталог JITForm" msgid "Lazarus Sources" msgstr "Исходники lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Вкл. вложенные комментарии" @@ -501,6 +505,10 @@ msgstr "файл \"%s\" не существует" msgid "file is read only" msgstr "файл только для чтения" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "каталог интерфейса gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.ua.po b/components/codetools/languages/codetoolsstrconsts.ua.po index 261ddb65e7..9fa97ea303 100644 --- a/components/codetools/languages/codetoolsstrconsts.ua.po +++ b/components/codetools/languages/codetoolsstrconsts.ua.po @@ -242,6 +242,10 @@ msgstr "Тека JITForm" msgid "Lazarus Sources" msgstr "Коди lazarus" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Ввімкн. вкладені коментарі" @@ -490,6 +494,10 @@ msgstr "файл \"%s\" не існує" msgid "file is read only" msgstr "файл тільки для читання" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "тека інтерфейсу gtk2" diff --git a/components/codetools/languages/codetoolsstrconsts.zh-cn.po b/components/codetools/languages/codetoolsstrconsts.zh-cn.po index 466d40a1ea..17f2927604 100644 --- a/components/codetools/languages/codetoolsstrconsts.zh-cn.po +++ b/components/codetools/languages/codetoolsstrconsts.zh-cn.po @@ -253,6 +253,10 @@ msgstr "JITForm 目录" msgid "Lazarus Sources" msgstr "Lazarus 源代码" +#: codetoolsstrconsts:ctsnesteddefinitionsarenotallowed +msgid "Nested %s definitions are not allowed" +msgstr "" + #: codetoolsstrconsts:ctsnestedcommentson msgid "Nested Comments On" msgstr "Nested Comments On" @@ -501,6 +505,10 @@ msgstr "文件 \"%s\" 不存在" msgid "file is read only" msgstr "文件为只读" +#: codetoolsstrconsts:ctsgenericidentifier +msgid "generic identifier" +msgstr "" + #: codetoolsstrconsts:ctsgtk2intfdirectory msgid "gtk2 interface directory" msgstr "gtk2 接口目录" diff --git a/components/synedit/languages/synedit.lt.po b/components/synedit/languages/synedit.lt.po index 06eb555efe..b6b063a672 100644 --- a/components/synedit/languages/synedit.lt.po +++ b/components/synedit/languages/synedit.lt.po @@ -1,59 +1,42 @@ -# translation of synedit.po to Lithuanian -# Header entry was created by KBabel! -# -#: syneditstrconst:syns_exporterformathtml -# Valdas Jankūnas , 2007. +# translation of synedit.po to Lithuanian Header entry was created by KBabel!: syneditstrconst:syns_exporterformathtml Valdas Jankūnas , 2007. msgid "" msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"Mime-Version: 1.0" -"Last-Translator: Valdas Jankūnas \n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" "PO-Revision-Date: 2007-08-27 18:34+0300\n" "Project-Id-Version: synedit\n" "Language-Team: Lithuanian\n" "X-Generator: KBabel 1.11.4\n" "MIME-Version: 1.0\n" -#: syneditstrconst:syns_exporterformathtml -msgid "HTML" -msgstr "HTML" - -#: syneditstrconst:syns_exporterformatrtf -msgid "RTF" -msgstr "RTF" - #: syneditstrconst:syns_scrollinfofmt msgid "%d - %d" msgstr "%d - %d" -#: syneditstrconst:syns_scrollinfofmttop -msgid "Top Line: %d" -msgstr "Viršutinė eilutė: %d" - -#: syneditstrconst:syns_previewscrollinfofmt -msgid "Page: %d" -msgstr "Lapas: %d" - -#: syneditstrconst:syns_eduplicateshortcut -msgid "Shortcut already exists" -msgstr "Toks šaukinys jau yra" +#: syneditstrconst:syns_filterasm68hc11 +msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" +msgstr "68HC11 asemblerio failai (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" #: syneditstrconst:syns_shortcutnone msgid "" msgstr "" -#: syneditstrconst:syns_duplicateshortcutmsg -msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" -msgstr "Klavišo paspaudimas \"%s\" jau yra priskirtas kitai redaktoriaus komandai. (%s)" +#: syneditstrconst:syns_filterawk +msgid "AWK Script (*.awk)|*.awk" +msgstr "AWK scenarijus (*.awk)|*.awk" -#: syneditstrconst:syns_filterpascal -msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" -msgstr "Paskalio failai (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" +#: syneditstrconst:syns_filterbaan +msgid "Baan 4GL Files (*.cln)|*.cln" +msgstr "Baan 4GL failai (*.cln)|*.cln" -#: syneditstrconst:syns_filterhp48 -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" -msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" +#: syneditstrconst:syns_filterdfm +msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm" +msgstr "Borland formos failai (*.dfm;*.xfm)|*.dfm;*.xfm" + +#: syneditstrconst:syns_filtercpp +msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" +msgstr "C++ failai (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" #: syneditstrconst:syns_filtercaclipper msgid "CA-Clipper Files (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" @@ -67,94 +50,6 @@ msgstr "CORBA IDL failai (*.idl)|*.idl" msgid "CPM reports (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" msgstr "CPM ataskaitos (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" -#: syneditstrconst:syns_filtercpp -msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" -msgstr "C++ failai (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" - -#: syneditstrconst:syns_filterjava -msgid "Java Files (*.java)|*.java" -msgstr "Java failai (*.java)|*.java" - -#: syneditstrconst:syns_filterperl -msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" -msgstr "Perl failai (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" - -#: syneditstrconst:syns_filterawk -msgid "AWK Script (*.awk)|*.awk" -msgstr "AWK scenarijus (*.awk)|*.awk" - -#: syneditstrconst:syns_filterhtml -msgid "HTML Document (*.htm,*.html)|*.htm;*.html" -msgstr "HTML dokumentas (*.htm,*.html)|*.htm;*.html" - -#: syneditstrconst:syns_filtervbscript -msgid "VBScript Files (*.vbs)|*.vbs" -msgstr "VBScript failai (*.vbs)|*.vbs" - -#: syneditstrconst:syns_filtergalaxy -msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" -msgstr "Galaxy failai (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" - -#: syneditstrconst:syns_filterpython -msgid "Python Files (*.py)|*.py" -msgstr "Python failai (*.py)|*.py" - -#: syneditstrconst:syns_filtersql -msgid "SQL Files (*.sql)|*.sql" -msgstr "SQL failai (*.sql)|*.sql" - -#: syneditstrconst:syns_filterhp -msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" -msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" - -#: syneditstrconst:syns_filtertcltk -msgid "Tcl/Tk Files (*.tcl)|*.tcl" -msgstr "Tcl/Tk failai (*.tcl)|*.tcl" - -#: syneditstrconst:syns_filterrtf -msgid "Rich Text Format (*.rtf)|*.rtf" -msgstr "Raiškiojo teksto formatas (*.rtf)|*.rtf" - -#: syneditstrconst:syns_filterbatch -msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" -msgstr "MS-DOS komandų failai (*.bat;*.cmd)|*.bat;*.cmd" - -#: syneditstrconst:syns_filterdfm -msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm" -msgstr "Borland formos failai (*.dfm;*.xfm)|*.dfm;*.xfm" - -#: syneditstrconst:syns_filterlfm -msgid "Lazarus Form Files (*.lfm)|*.lfm" -msgstr "Lazarus formos failai (*.lfm)|*.lfm" - -#: syneditstrconst:syns_filterx86asm -msgid "x86 Assembly Files (*.asm)|*.ASM" -msgstr "x86 asemblerio failai (*.asm)|*.ASM" - -#: syneditstrconst:syns_filtergembase -msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM" -msgstr "GEMBASE failai (*.dml,*.gem)|*.DML;*.GEM" - -#: syneditstrconst:syns_filterini -msgid "INI Files (*.ini)|*.ini" -msgstr "INI failai (*.ini)|*.ini" - -#: syneditstrconst:syns_filtersml -msgid "Standard ML Files (*.sml)|*.sml" -msgstr "Standard ML failai (*.sml)|*.sml" - -#: syneditstrconst:syns_filtervisualbasic -msgid "Visual Basic Files (*.bas)|*.bas" -msgstr "Visual Basic failai (*.bas)|*.bas" - -#: syneditstrconst:syns_filteradsp21xx -msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" -msgstr "DSP failai (*.dsp,*.inc)|*.DSP;*.INC" - -#: syneditstrconst:syns_filterphp -msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" -msgstr "PHP failai (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" - #: syneditstrconst:syns_filtercache msgid "Cache Files (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" msgstr "Cache failai (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" @@ -163,6 +58,58 @@ msgstr "Cache failai (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" msgid "Cascading Stylesheets (*.css)|*.css" msgstr "Pakopiniai stiliai (*.css)|*.css" +#: syneditstrconst:syns_filteradsp21xx +msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" +msgstr "DSP failai (*.dsp,*.inc)|*.DSP;*.INC" + +#: syneditstrconst:syns_filterfortran +msgid "Fortran Files (*.for)|*.for" +msgstr "Fortran failai (*.for)|*.for" + +#: syneditstrconst:syns_filterfoxpro +msgid "Foxpro Files (*.prg)|*.prg" +msgstr "Foxpro failai (*.prg)|*.prg" + +#: syneditstrconst:syns_filtergembase +msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM" +msgstr "GEMBASE failai (*.dml,*.gem)|*.DML;*.GEM" + +#: syneditstrconst:syns_filtergws +msgid "GW-TEL Script Files (*.gws)|*.gws" +msgstr "GW-TEL scenarijaus failai (*.gws)|*.gws" + +#: syneditstrconst:syns_filtergalaxy +msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" +msgstr "Galaxy failai (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" + +#: syneditstrconst:syns_filterhp +msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" +msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" + +#: syneditstrconst:syns_filterhp48 +msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" +msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" + +#: syneditstrconst:syns_exporterformathtml +msgid "HTML" +msgstr "HTML" + +#: syneditstrconst:syns_filterhtml +msgid "HTML Document (*.htm,*.html)|*.htm;*.html" +msgstr "HTML dokumentas (*.htm,*.html)|*.htm;*.html" + +#: syneditstrconst:syns_filterini +msgid "INI Files (*.ini)|*.ini" +msgstr "INI failai (*.ini)|*.ini" + +#: syneditstrconst:syns_filterinno +msgid "Inno Setup Script Files (*.iss)|*.iss" +msgstr "Inno Setup scenarijaus failai (*.iss)|*.iss" + +#: syneditstrconst:syns_filterjava +msgid "Java Files (*.java)|*.java" +msgstr "Java failai (*.java)|*.java" + #: syneditstrconst:syns_filterjscript msgid "Javascript Files (*.js)|*.js" msgstr "Javascript failai (*.js)|*.js" @@ -171,29 +118,13 @@ msgstr "Javascript failai (*.js)|*.js" msgid "KiXtart scripts (*.kix)|*.kix" msgstr "KiXtart scenarijai (*.kix)|*.kix" -#: syneditstrconst:syns_filterbaan -msgid "Baan 4GL Files (*.cln)|*.cln" -msgstr "Baan 4GL failai (*.cln)|*.cln" +#: syneditstrconst:syns_filterlfm +msgid "Lazarus Form Files (*.lfm)|*.lfm" +msgstr "Lazarus formos failai (*.lfm)|*.lfm" -#: syneditstrconst:syns_filterfoxpro -msgid "Foxpro Files (*.prg)|*.prg" -msgstr "Foxpro failai (*.prg)|*.prg" - -#: syneditstrconst:syns_filterfortran -msgid "Fortran Files (*.for)|*.for" -msgstr "Fortran failai (*.for)|*.for" - -#: syneditstrconst:syns_filterasm68hc11 -msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" -msgstr "68HC11 asemblerio failai (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" - -#: syneditstrconst:syns_filterprogress -msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" -msgstr "Progress failai (*.w,*.p,*.i)|*.w;*.p;*.i" - -#: syneditstrconst:syns_filterinno -msgid "Inno Setup Script Files (*.iss)|*.iss" -msgstr "Inno Setup scenarijaus failai (*.iss)|*.iss" +#: syneditstrconst:syns_filterbatch +msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" +msgstr "MS-DOS komandų failai (*.bat;*.cmd)|*.bat;*.cmd" #: syneditstrconst:syns_filtermodelica msgid "Modelica Files (*.mo)|*.mo" @@ -203,27 +134,91 @@ msgstr "Modelica failai (*.mo)|*.mo" msgid "Modula-3 Files (*.m3)|*.m3" msgstr "Modula-3 failai (*.m3)|*.m3" -#: syneditstrconst:syns_filtersdd -msgid "Semanta DD files (*.sdd)|*.sdd" -msgstr "Semanta DD failai (*.sdd)|*.sdd" - -#: syneditstrconst:syns_filterxml -msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" -msgstr "XML dokumentas (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" - -#: syneditstrconst:syns_filtergws -msgid "GW-TEL Script Files (*.gws)|*.gws" -msgstr "GW-TEL scenarijaus failai (*.gws)|*.gws" - #: syneditstrconst:syns_filtersyngenmsgfiles msgid "Msg files (*.msg)|*.msg" msgstr "Msg failai (*.msg)|*.msg" -#: syneditstrconst:syns_filterunixshellscript -msgid "UNIX Shell Scripts (*.sh)|*.sh" -msgstr "UNIX apvalkalo scenarijus (*.sh)|*.sh" +#: syneditstrconst:syns_filterphp +msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" +msgstr "PHP failai (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" + +#: syneditstrconst:syns_previewscrollinfofmt +msgid "Page: %d" +msgstr "Lapas: %d" + +#: syneditstrconst:syns_filterpascal +msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" +msgstr "Paskalio failai (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" + +#: syneditstrconst:syns_filterperl +msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" +msgstr "Perl failai (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" + +#: syneditstrconst:syns_filterprogress +msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" +msgstr "Progress failai (*.w,*.p,*.i)|*.w;*.p;*.i" + +#: syneditstrconst:syns_filterpython +msgid "Python Files (*.py)|*.py" +msgstr "Python failai (*.py)|*.py" + +#: syneditstrconst:syns_exporterformatrtf +msgid "RTF" +msgstr "RTF" + +#: syneditstrconst:syns_filterrtf +msgid "Rich Text Format (*.rtf)|*.rtf" +msgstr "Raiškiojo teksto formatas (*.rtf)|*.rtf" + +#: syneditstrconst:syns_filtersql +msgid "SQL Files (*.sql)|*.sql" +msgstr "SQL failai (*.sql)|*.sql" + +#: syneditstrconst:syns_filtersdd +msgid "Semanta DD files (*.sdd)|*.sdd" +msgstr "Semanta DD failai (*.sdd)|*.sdd" + +#: syneditstrconst:syns_eduplicateshortcut +msgid "Shortcut already exists" +msgstr "Toks šaukinys jau yra" + +#: syneditstrconst:syns_filtersml +msgid "Standard ML Files (*.sml)|*.sml" +msgstr "Standard ML failai (*.sml)|*.sml" + +#: syneditstrconst:syns_filtertcltk +msgid "Tcl/Tk Files (*.tcl)|*.tcl" +msgstr "Tcl/Tk failai (*.tcl)|*.tcl" #: syneditstrconst:syns_filtertex msgid "TeX Files (*.tex)|*.tex" msgstr "TeX failai (*.tex)|*.tex" +#: syneditstrconst:syns_duplicateshortcutmsg +msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" +msgstr "Klavišo paspaudimas \"%s\" jau yra priskirtas kitai redaktoriaus komandai. (%s)" + +#: syneditstrconst:syns_scrollinfofmttop +msgid "Top Line: %d" +msgstr "Viršutinė eilutė: %d" + +#: syneditstrconst:syns_filterunixshellscript +msgid "UNIX Shell Scripts (*.sh)|*.sh" +msgstr "UNIX apvalkalo scenarijus (*.sh)|*.sh" + +#: syneditstrconst:syns_filtervbscript +msgid "VBScript Files (*.vbs)|*.vbs" +msgstr "VBScript failai (*.vbs)|*.vbs" + +#: syneditstrconst:syns_filtervisualbasic +msgid "Visual Basic Files (*.bas)|*.bas" +msgstr "Visual Basic failai (*.bas)|*.bas" + +#: syneditstrconst:syns_filterxml +msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" +msgstr "XML dokumentas (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" + +#: syneditstrconst:syns_filterx86asm +msgid "x86 Assembly Files (*.asm)|*.ASM" +msgstr "x86 asemblerio failai (*.asm)|*.ASM" + diff --git a/components/synedit/languages/synmacrorecorder.lt.po b/components/synedit/languages/synmacrorecorder.lt.po index 4e330eb39b..468421e330 100644 --- a/components/synedit/languages/synmacrorecorder.lt.po +++ b/components/synedit/languages/synmacrorecorder.lt.po @@ -1,28 +1,15 @@ -# translation of synmacrorecorder.po to Lithuanian -# Header entry was created by KBabel! -# -#: synmacrorecorder:scannotrecord -# Valdas Jankūnas , 2007. +# translation of synmacrorecorder.po to Lithuanian Header entry was created by KBabel!: synmacrorecorder:scannotrecord Valdas Jankūnas , 2007. msgid "" msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"Mime-Version: 1.0" -"Last-Translator: Valdas Jankūnas \n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" "PO-Revision-Date: 2007-08-27 18:15+0300\n" "Project-Id-Version: synmacrorecorder\n" "Language-Team: Lithuanian\n" "X-Generator: KBabel 1.11.4\n" "MIME-Version: 1.0\n" -#: synmacrorecorder:scannotrecord -msgid "Cannot record macro when recording" -msgstr "Neina įrašyti makrokomandą kai įrašinėjama" - -#: synmacrorecorder:scannotplay -msgid "Cannot playback macro when recording" -msgstr "Neina paleisti makrokomandos įrašą kai įrašinėjama" - #: synmacrorecorder:scannotpause msgid "Can only pause when recording" msgstr "Įrašinėjant galima tik pristabdyti" @@ -31,3 +18,11 @@ msgstr "Įrašinėjant galima tik pristabdyti" msgid "Can only resume when paused" msgstr "Pristabdžius galima tik tęsti" +#: synmacrorecorder:scannotplay +msgid "Cannot playback macro when recording" +msgstr "Neina paleisti makrokomandos įrašą kai įrašinėjama" + +#: synmacrorecorder:scannotrecord +msgid "Cannot record macro when recording" +msgstr "Neina įrašyti makrokomandą kai įrašinėjama" + diff --git a/languages/installerstrconsts.lt.po b/languages/installerstrconsts.lt.po index 2f81c901f5..8fa9d1bc63 100644 --- a/languages/installerstrconsts.lt.po +++ b/languages/installerstrconsts.lt.po @@ -1,33 +1,28 @@ -# translation of installerstrconsts.po to Lithuanian -# Header entry was created by KBabel! -# -#: installerstrconsts:wiseditsource -# Valdas Jankūnas , 2007. +# translation of installerstrconsts.po to Lithuanian Header entry was created by KBabel!: installerstrconsts:wiseditsource Valdas Jankūnas , 2007. msgid "" msgstr "" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"Mime-Version: 1.0" -"Last-Translator: Valdas Jankūnas \n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" "PO-Revision-Date: 2007-08-18 13:09+0300\n" "Project-Id-Version: installerstrconsts\n" "Language-Team: Lithuanian\n" "X-Generator: KBabel 1.11.4\n" "MIME-Version: 1.0\n" -#: installerstrconsts:wiseditsource -msgid "&Edit source" -msgstr "&Keisti išeities kodą" - #: installerstrconsts:wiseditform msgid "&Edit form" msgstr "&Keisti formą" -#: installerstrconsts:wisopenproject -msgid "&Open project" -msgstr "&Atverti projektą" +#: installerstrconsts:wiseditsource +msgid "&Edit source" +msgstr "&Keisti išeities kodą" #: installerstrconsts:wisopenpackage msgid "&Open package" msgstr "&Atverti paketą" +#: installerstrconsts:wisopenproject +msgid "&Open project" +msgstr "&Atverti projektą" + diff --git a/languages/lazaruside.af_ZA.po b/languages/lazaruside.af_ZA.po index 84d2cad1e6..99cbba25c4 100644 --- a/languages/lazaruside.af_ZA.po +++ b/languages/lazaruside.af_ZA.po @@ -1688,6 +1688,10 @@ msgstr "" msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" @@ -2316,6 +2320,10 @@ msgstr "" msgid "Direction" msgstr "" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "" @@ -4645,15 +4653,15 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" +msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" +msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" +msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts:lislevels @@ -4720,6 +4728,10 @@ msgstr "" msgid "Linking" msgstr "" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "" @@ -9676,6 +9688,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "" diff --git a/languages/lazaruside.ar.po b/languages/lazaruside.ar.po index 18560fe3ec..01e822c63b 100644 --- a/languages/lazaruside.ar.po +++ b/languages/lazaruside.ar.po @@ -1685,6 +1685,10 @@ msgstr "" msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "" @@ -4642,15 +4650,15 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" +msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" +msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" +msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts:lislevels @@ -4717,6 +4725,10 @@ msgstr "" msgid "Linking" msgstr "" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "" @@ -9673,6 +9685,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "" diff --git a/languages/lazaruside.ca.po b/languages/lazaruside.ca.po index 87b4169f6d..b18ebaccb8 100644 --- a/languages/lazaruside.ca.po +++ b/languages/lazaruside.ca.po @@ -1685,6 +1685,10 @@ msgstr "Conflicte" msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "El nom del constructor ha de ser 'init' (el del destructor ha de ser 'done')" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "Direcció" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Directori" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Nivell 0 (sense optimitzacions extres)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Nivell 1 (Optimitzacions ràpides)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Nivell 2 (Nivell 1 + Optimitzacions més lentes)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Nivell 3 (Nivell 2 + incert)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Enllaçador" msgid "Linking" msgstr "Enllaçament" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Carrega els paràmetres de l'escriptori des del fitxer" @@ -9673,6 +9685,10 @@ msgstr "avalua/modifica" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "en el projecte:" diff --git a/languages/lazaruside.de.po b/languages/lazaruside.de.po index 834884b798..418109e8ee 100644 --- a/languages/lazaruside.de.po +++ b/languages/lazaruside.de.po @@ -1687,6 +1687,10 @@ msgstr "Konflikt" msgid "Conflict found" msgstr "Konflikt aufgetreten" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Name des Konstruktors muß 'init' sein (Destruktor muß 'done' heißen)" @@ -2315,6 +2319,10 @@ msgstr "Editordateien vergleichen" msgid "Direction" msgstr "Richtung" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Verzeichnis" @@ -4644,16 +4652,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Stufe 0 (keine zusätzlichen Optimierungen)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Stufe 1 (Schnelle Optimierung)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Stufe 2 (Stufe 1 und langsamere Optimierung)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Stufe 3 (Stufe 2 und unsichere Optimierungen)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4719,6 +4727,10 @@ msgstr "Linker" msgid "Linking" msgstr "Linken" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Von Datei laden" @@ -9675,6 +9687,10 @@ msgstr "auswerten/ändern" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "Datei, in die Debug-Ausgaben geschrieben werden. Falls nichts angegeben ist, werden Debug-Ausgaben auf die Konsole geschrieben." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "im Projekt:" diff --git a/languages/lazaruside.es.po b/languages/lazaruside.es.po index 8d0190edc5..2508ced5ab 100644 --- a/languages/lazaruside.es.po +++ b/languages/lazaruside.es.po @@ -1684,6 +1684,10 @@ msgstr "Conflicto " msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "El Nombre del constructor debe de ser 'init' (destructor 'done')" @@ -2312,6 +2316,10 @@ msgstr "" msgid "Direction" msgstr "Dirección" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Directorio" @@ -4641,16 +4649,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Nivel 0 (sin optimizaciones extra)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Nivel 1 (optimizaciones rápidas)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Nivel 2 (Nivel 1 + optimizaciones más lentas)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Nivel 3 (Nivel 2 + Inciertas)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4716,6 +4724,10 @@ msgstr "Enlazador" msgid "Linking" msgstr "Enlazando" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Cargar configuraciones del escritorio desde archivo" @@ -9672,6 +9684,10 @@ msgstr "evaluar/modificar" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "en Proyecto:" diff --git a/languages/lazaruside.fi.po b/languages/lazaruside.fi.po index b2fd5e68d1..626aa0d433 100644 --- a/languages/lazaruside.fi.po +++ b/languages/lazaruside.fi.po @@ -1674,6 +1674,10 @@ msgstr "" msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" @@ -2302,6 +2306,10 @@ msgstr "" msgid "Direction" msgstr "Suunta" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Kansio" @@ -4631,16 +4639,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Taso 0 (Ei optimointia)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Taso 1 (Nopea optimoiti)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Taso 2 (Taso 1 + hitaampi optimoiti)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Taso 3 (Taso2 + Uncertain)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4706,6 +4714,10 @@ msgstr "" msgid "Linking" msgstr "" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Lue työpöytäasetukset tiedostosta" @@ -9662,6 +9674,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "Projektissa:" diff --git a/languages/lazaruside.fr.po b/languages/lazaruside.fr.po index 37612abf0b..d8a13fb316 100644 --- a/languages/lazaruside.fr.po +++ b/languages/lazaruside.fr.po @@ -1687,6 +1687,10 @@ msgstr "Conflit" msgid "Conflict found" msgstr " Conflit trouvé " +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Le nom du constructeur doit être 'init' (le destructeur doit être 'done')" @@ -2315,6 +2319,10 @@ msgstr "Editeur de différences " msgid "Direction" msgstr "Sens" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Répertoire" @@ -4644,16 +4652,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Niveau 0 (pas d'optimisations additionnelles)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Niveau 1 (optimisations rapides)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Niveau 2 (niveau 1 + optimisations plus lentes)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Niveau 3 (niveau 2 + incertitudes)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4719,6 +4727,10 @@ msgstr "Editeur de liens" msgid "Linking" msgstr "Edition des liens" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Charger les paramètres du bureau" @@ -9675,6 +9687,10 @@ msgstr "Evaluer/Modifier" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "Où est écrit le fichier de déboguage. Si on ne l'indique pas, la sortie de déboguage est écrit sur la console. " +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "dans projet:" diff --git a/languages/lazaruside.he.po b/languages/lazaruside.he.po index 60fcc28f02..d88faf470c 100644 --- a/languages/lazaruside.he.po +++ b/languages/lazaruside.he.po @@ -1685,6 +1685,10 @@ msgstr "Conflicte" msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "" @@ -4642,15 +4650,15 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" +msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" +msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" +msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts:lislevels @@ -4717,6 +4725,10 @@ msgstr "" msgid "Linking" msgstr "" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "" @@ -9673,6 +9685,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "" diff --git a/languages/lazaruside.id.po b/languages/lazaruside.id.po index 1b2c64224d..44df67cc2e 100644 --- a/languages/lazaruside.id.po +++ b/languages/lazaruside.id.po @@ -1685,6 +1685,10 @@ msgstr "Konflik" msgid "Conflict found" msgstr "Konflik ditemukan" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Nama Constructor harus 'init' (destructor harus 'done')" @@ -2313,6 +2317,10 @@ msgstr "File editor Diff" msgid "Direction" msgstr "Arah" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Direktori" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Tingkat 0 (tidak ada Optimasi ekstra)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Tingkat 1 (Optimasi Cepat)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Tingkat 2 (Tingkat 1 + Optimasi Lebih Lambat)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Tingkat 3 (Tingkat 2 + Tidak pasti)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Linker" msgid "Linking" msgstr "Penggabungan" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Ambil seting desktop dari file" @@ -9673,6 +9685,10 @@ msgstr "evaluasi/modifikasi" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "file, dimana output debug ditulisnya. Jika tidak ditetapkan, output debug ditulis ke konsol" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "dalam Proyek:" diff --git a/languages/lazaruside.it.po b/languages/lazaruside.it.po index 54b8ea7939..64a540413b 100644 --- a/languages/lazaruside.it.po +++ b/languages/lazaruside.it.po @@ -1686,6 +1686,10 @@ msgstr "Conflitto" msgid "Conflict found" msgstr "Trovato un conflitto" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Il nome del costruttore deve essere 'init' (e del distruttore deve essere 'done')" @@ -2314,6 +2318,10 @@ msgstr "" msgid "Direction" msgstr "Direzione" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Directory" @@ -4643,16 +4651,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Livello 0 (nessuna ottimizzazione)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Livello 1 (ottimizzazioni veloci)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Livello 2 (livello 1 + ottimizzazioni più lente)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Livello 3 (livello 2 + incerte)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4718,6 +4726,10 @@ msgstr "Linker" msgid "Linking" msgstr "Linking" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Carica impostazioni del desktop dal file" @@ -9674,6 +9686,10 @@ msgstr "valuta/modifica" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "file, dove viene scritto l'output di debug. Se non viene specificato, l'output di debug viene scritto sulla console." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "In progetto:" diff --git a/languages/lazaruside.ja.po b/languages/lazaruside.ja.po index f85e8546d9..bb7dc59337 100644 --- a/languages/lazaruside.ja.po +++ b/languages/lazaruside.ja.po @@ -1684,6 +1684,10 @@ msgstr "矛盾" msgid "Conflict found" msgstr "矛盾を見つけました" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "コンストラクタの名前は'init'（デストラクタは'done'）でなければなりません" @@ -2312,6 +2316,10 @@ msgstr "" msgid "Direction" msgstr "方向" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "ディレクトリ" @@ -4641,16 +4649,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "レベル 0(それ以外の最適化なし)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "レベル1(高速最適化)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "レベル2(Level 1 + より遅い最適化)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "レベル3(Level 2 +不確定)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4716,6 +4724,10 @@ msgstr "リンカー" msgid "Linking" msgstr "リンク中" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "ファイルからデスクトップの設定を読み込み" @@ -9672,6 +9684,10 @@ msgstr "評価/変更" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "デバッグ出力が書き込まれるファイル。それが指定されない場合、デバッグ出力はコンソールに書き込まれます。" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "プロジェクト内" diff --git a/languages/lazaruside.lt.po b/languages/lazaruside.lt.po index 0692ff8099..42b45ac503 100644 --- a/languages/lazaruside.lt.po +++ b/languages/lazaruside.lt.po @@ -1,8 +1,4 @@ -# translation of lazaruside.po to Lithuanian -# Header entry was created by KBabel! -# -#: lazarusidestrconsts:liserrinvalidoption -# Valdas Jankūnas , 2007. +# translation of lazaruside.po to Lithuanian Header entry was created by KBabel!: lazarusidestrconsts:liserrinvalidoption Valdas Jankūnas , 2007. msgid "" msgstr "" "Content-Type: text/plain; charset=UTF-8\n" @@ -15,1717 +11,25 @@ msgstr "" "MIME-Version: 1.0\n" "Last-Translator: Valdas Jankūnas \n" -#: lazarusidestrconsts:liserrinvalidoption -msgid "Invalid option at position %d: \"%s\"" -msgstr "Klaidinga parinktis ties pozicija %d: \"%s\"" +#: lazarusidestrconsts:srkmcommand1 +msgid " command1 \"" +msgstr "komanda 1 \"" -#: lazarusidestrconsts:liserrnooptionallowed -msgid "Option at position %d does not allow an argument: %s" -msgstr "Parinkčiai ties pozicija %s argumentai nepriimtini: %s" +#: lazarusidestrconsts:srkmcommand2 +msgid " command2 \"" +msgstr "komanda 2 \"" -#: lazarusidestrconsts:liserroptionneeded -msgid "Option at position %d needs an argument : %s" -msgstr "Parinkčiai ties pozicija %d reikia nurodyti argumentą: %s" +#: lazarusidestrconsts:liscodetemplatokenalreadyexists +msgid " A token %s%s%s already exists! " +msgstr "Leksema %s%s%s jau egzistuoja! " -#: lazarusidestrconsts:lisentertransla -msgid "Enter translation language" -msgstr "Įveskite vertimo kalbą" +#: lazarusidestrconsts:srkmalreadyconnected +msgid " The key \"%s\" is already connected to \"%s\"." +msgstr "Klavišas \"%s\" jau yra surištas su \"%s\"." -#: lazarusidestrconsts:lislazarusversionstring -msgid "%s beta" -msgstr "%s beta" - -#: lazarusidestrconsts:lisleaveemptyfo -msgid "Leave empty for default .po file" -msgstr "Palikite tuščią jei naudosite numatytąjį .po failą" - -#: lazarusidestrconsts:lismenucollectpofil -msgid "Collect .po files" -msgstr "Surinkti .po failus" - -#: lazarusidestrconsts:lismenucreatepofile -msgid "Create .po files" -msgstr "Kurti .po failus" - -#: lazarusidestrconsts:listhishelpmessage -msgid "this help message" -msgstr "Tai žinyno pranešimas" - -#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig -msgid "primary config directory, where Lazarus stores its config files. Default is " -msgstr "Pirminis katalogas nustatymamų failams, kuriame Lazarus laikys savo nustatymų failus. Numatytasis yra" - -#: lazarusidestrconsts:lislazarusoptionsprojectfilename -msgid "lazarus [options] " -msgstr "lazarus [parinktys] " - -#: lazarusidestrconsts:lisideoptions -msgid "IDE Options:" -msgstr "IKA parinktys:" - -#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions -msgid "LCL Interface specific options:" -msgstr "LCL interfeiso specifinės parinktys:" - -#: lazarusidestrconsts:lisdonotshowsplashscreen -msgid "Do not show splash screen" -msgstr "Nerodyti prisistatymo langelio" - -#: lazarusidestrconsts:lisskiploadinglastproject -msgid "Skip loading last project" -msgstr "Neįkelti paskutinio naudoto projekto" - -#: lazarusidestrconsts:lisoverridelanguage -msgid "Override language. For example --language=de. For possible values see files in the languages directory." -msgstr "Viršesnė kalba. Pavyzdžiui: --language=de. Galimas reikšmes galite sužinoti žvilgterėje į kalbų katalogą." - -#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor -msgid "secondary config directory, where Lazarus searches for config template files. Default is " -msgstr "Antrinis katalogas nustatymų failams, kuriame Lazarus ieškos nustatymų šablonų failų. Numatytasis yra" - -#: lazarusidestrconsts:lisfilewheredebugoutputiswritten -msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." -msgstr "Failas, į kurį bus rašoma derinimo išvestis. Jei jis nenurodytas, tai derinimo išvestis bus spauzdinama konsolėje." - -#: lazarusidestrconsts:lisselectiontool -msgid "Selection tool" -msgstr "Žymėjimo įrankis" - -#: lazarusidestrconsts:liscursorcolumnincurrenteditor -msgid "Cursor column in current editor" -msgstr "Žymeklio stulpelis veikiamąjame redaktoriuje" - -#: lazarusidestrconsts:liscursorrowincurrenteditor -msgid "Cursor row in current editor" -msgstr "Žymeklio eilutė veikiamąjame redaktoriuje" - -#: lazarusidestrconsts:liscompilerfilename -msgid "Compiler filename" -msgstr "Kompiliatoriaus failo vardas" - -#: lazarusidestrconsts:liswordatcursorincurrenteditor -msgid "Word at cursor in current editor" -msgstr "Žodis ties žymekliu veikiamąjame redaktoriuje" - -#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor -msgid "Expanded filename of current editor file" -msgstr "Veikiamojo redaktoriaus failo vardas su pilnu keliu iki jo" - -#: lazarusidestrconsts:lisfreepascalsourcedirectory -msgid "Freepascal source directory" -msgstr "FreePascal pirminio kodo katalogas" - -#: lazarusidestrconsts:lislazarusdirectory -msgid "Lazarus directory" -msgstr "Lazarus katalogas" - -#: lazarusidestrconsts:lislazaruslanguageid -msgid "Lazarus language ID (e.g. en, de, br, fi)" -msgstr "Lazarus kalbos ID (t.y. en, de, lt, ...)" - -#: lazarusidestrconsts:lislazaruslanguagename -msgid "Lazarus language name (e.g. english, deutsch)" -msgstr "Lazarus kalbos vardas (t.y. anglų, vokiečių, lietuvių, ...)" - -#: lazarusidestrconsts:lislclwidgettype -msgid "LCL Widget Type" -msgstr "LCL valdiklių tipas" - -#: lazarusidestrconsts:liscovarious -msgid "%s (various)" -msgstr "%s (įvairūs)" - -#: lazarusidestrconsts:listargetcpu -msgid "Target CPU" -msgstr "Paskirties procesorius" - -#: lazarusidestrconsts:listargetos -msgid "Target OS" -msgstr "Paskirties OS" - -#: lazarusidestrconsts:liscommandlineparamsofprogram -msgid "Command line parameters of program" -msgstr "Programos komandinės eilutės parametrai" - -#: lazarusidestrconsts:lispromptforvalue -msgid "Prompt for value" -msgstr "Kvietimas įvesti reikšmę" - -#: lazarusidestrconsts:lisprojectfilename -msgid "Project filename" -msgstr "Projekto failo vardas" - -#: lazarusidestrconsts:lisprojectdirectory -msgid "Project directory" -msgstr "Projekto katalogas" - -#: lazarusidestrconsts:lissavecurrenteditorfile -msgid "save current editor file" -msgstr "Išsaugoti dabartinį redaktoriaus failą" - -#: lazarusidestrconsts:lissaveallmodified -msgid "save all modified files" -msgstr "Išsaugoti visus pakeistus failus" - -#: lazarusidestrconsts:listargetfilenameofproject -msgid "Target filename of project" -msgstr "Projekto būsimo failo vardas" - -#: lazarusidestrconsts:listargetfilenameplusparams -msgid "Target filename + params" -msgstr "Būsimo failo vardas + parametrai" - -#: lazarusidestrconsts:listestdirectory -msgid "Test directory" -msgstr "Testo katalogas" - -#: lazarusidestrconsts:lislaunchingcmdline -msgid "Launching target command line" -msgstr "Startuojamos paskirties komandinė eilutė" - -#: lazarusidestrconsts:lispublishprojdir -msgid "Publish project directory" -msgstr "Skelbiamo projekto katalogas" - -#: lazarusidestrconsts:lisprojectunitpath -msgid "Project Unit Path" -msgstr "Kelias iki projekto modulių" - -#: lazarusidestrconsts:lisprojectincpath -msgid "Project Include Path" -msgstr "Kelias iki projekto įterpinių" - -#: lazarusidestrconsts:lisprojectsrcpath -msgid "Project Src Path" -msgstr "Kelias iki projekto pirminio kodo" - -#: lazarusidestrconsts:lismakeexe -msgid "Make Executable" -msgstr "Daryti vykdomąjį failą" - -#: lazarusidestrconsts:lisprojectmacroproperties -msgid "Project macro properties" -msgstr "Projekto makrokomandos savybės" - -#: lazarusidestrconsts:lisopenproject2 -msgid "Open project" -msgstr "Atverti projektą" - -#: lazarusidestrconsts:liskmsaveproject -msgid "Save project" -msgstr "Išsaugoti projektą" - -#: lazarusidestrconsts:liskmcloseproject -msgid "Close project" -msgstr "Užverti projektą" - -#: lazarusidestrconsts:liskmsaveprojectas -msgid "Save project as" -msgstr "Išsaugoti projektą kaip" - -#: lazarusidestrconsts:liskmpublishproject -msgid "Publish project" -msgstr "Skelbti projektą" - -#: lazarusidestrconsts:lisopenthefileasnormalsource -msgid "Open the file as normal source" -msgstr "Failą įkelti kaip įprastą pirminį kodą" - -#: lazarusidestrconsts:lisopenasxmlfile -msgid "Open as XML file" -msgstr "Įkelti kaip XML failą" - -#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro -msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" -msgstr "Paskutinio starto metu įkeliant projektą %s įvyko klaida!%s%sVėl įkelti šį projektą?" - -#: lazarusidestrconsts:lisopenprojectagain -msgid "Open project again" -msgstr "Vėl atverti projektą" - -#: lazarusidestrconsts:lisstartwithanewproject -msgid "Start with a new project" -msgstr "Startuti su nauju projektu" - -#: lazarusidestrconsts:lisprojectmacrounitpath -msgid "macro ProjectUnitPath" -msgstr "makrokomanda ProjectUnitPath" - -#: lazarusidestrconsts:lisconfigdirectory -msgid "Lazarus config directory" -msgstr "Lazarus nustatymų katalogas" - -#: lazarusidestrconsts:lismenufile -msgid "&File" -msgstr "&Failas" - -#: lazarusidestrconsts:lismenuedit -msgid "&Edit" -msgstr "&Keisti" - -#: lazarusidestrconsts:lismenusearch -msgid "&Search" -msgstr "&Paieška" - -#: lazarusidestrconsts:lismenuview -msgid "&View" -msgstr "&Rodymas" - -#: lazarusidestrconsts:lismenuproject -msgid "&Project" -msgstr "Projek&tas" - -#: lazarusidestrconsts:lismenurun -msgid "&Run" -msgstr "&Startuoti" - -#: lazarusidestrconsts:lismenucomponents -msgid "&Components" -msgstr "K&omponentai" - -#: lazarusidestrconsts:lismenutools -msgid "&Tools" -msgstr "Įra&nkiai" - -#: lazarusidestrconsts:lismenuenvironent -msgid "E&nvironment" -msgstr "&Aplinka" - -#: lazarusidestrconsts:lismenuwindows -msgid "&Windows" -msgstr "&Langai" - -#: lazarusidestrconsts:lismenuhelp -msgid "&Help" -msgstr "Žin&ynas" - -#: lazarusidestrconsts:lismenunewunit -msgid "New Unit" -msgstr "Naujas modulis" - -#: lazarusidestrconsts:lismenunewform -msgid "New Form" -msgstr "Nauja forma" - -#: lazarusidestrconsts:lismenunewother -msgid "New ..." -msgstr "Naujas..." - -#: lazarusidestrconsts:lismenuopen -msgid "Open ..." -msgstr "Atverti..." - -#: lazarusidestrconsts:lismenurevert -msgid "Revert" -msgstr "Atstatyti" - -#: lazarusidestrconsts:lispkgeditpublishpackage -msgid "Publish Package" -msgstr "Skelbti paketą" - -#: lazarusidestrconsts:lismenuopenrecent -msgid "Open Recent ..." -msgstr "Atverti paskutinį naudotą..." - -#: lazarusidestrconsts:lismenusave -msgid "Save" -msgstr "Išsaugoti" - -#: lazarusidestrconsts:liskmsaveas -msgid "SaveAs" -msgstr "Išsaugoti kaip" - -#: lazarusidestrconsts:liskmsaveall -msgid "SaveAll" -msgstr "Išsaugoti visus" - -#: lazarusidestrconsts:lisdiscardchanges -msgid "Discard changes" -msgstr "Neįrašyti pakeitimų" - -#: lazarusidestrconsts:lisdonotclosetheproject -msgid "Do not close the project" -msgstr "Neužverti projekto" - -#: lazarusidestrconsts:lisdonotclosetheide -msgid "Do not close the IDE" -msgstr "Neužveti IKA" - -#: lazarusidestrconsts:lismenusaveas -msgid "Save As ..." -msgstr "Išsaugoti kaip..." - -#: lazarusidestrconsts:lismenusaveall -msgid "Save All" -msgstr "Išsaugoti visus" - -#: lazarusidestrconsts:lismenuclose -msgid "Close" -msgstr "Užverti" - -#: lazarusidestrconsts:liskmcloseall -msgid "Close All" -msgstr "Užverti visus" - -#: lazarusidestrconsts:lisctdefdefinetemplates -msgid "Define templates" -msgstr "Apibrėžčių šablonai" - -#: lazarusidestrconsts:lismenucloseall -msgid "Close all editor files" -msgstr "Užverti visus redaktoriaus failus" - -#: lazarusidestrconsts:lismenucleandirectory -msgid "Clean directory ..." -msgstr "Apvalyti katalogą..." - -#: lazarusidestrconsts:lismenuquit -msgid "Quit" -msgstr "Baigti darbą" - -#: lazarusidestrconsts:lismenurestart -msgid "Restart" -msgstr "Startuoti išnaujo" - -#: lazarusidestrconsts:lismenuundo -msgid "Undo" -msgstr "Grąžinti" - -#: lazarusidestrconsts:lismenuredo -msgid "Redo" -msgstr "Pakartoti" - -#: lazarusidestrconsts:lismenucut -msgid "Cut" -msgstr "Iškirpti" - -#: lazarusidestrconsts:lismenucopy -msgid "Copy" -msgstr "Kopijuoti" - -#: lazarusidestrconsts:lismenupaste -msgid "Paste" -msgstr "Įdėti" - -#: lazarusidestrconsts:lismenuindentselection -msgid "Indent selection" -msgstr "Suteikti įtrauką pažymėjime" - -#: lazarusidestrconsts:lismenuunindentselection -msgid "Unindent selection" -msgstr "Naikinti įtrauką pažymėjime" - -#: lazarusidestrconsts:lismenuuppercaseselection -msgid "Uppercase selection" -msgstr "Pažymėjime visas raides didžiosiomis" - -#: lazarusidestrconsts:lismenulowercaseselection -msgid "Lowercase selection" -msgstr "Pažymėjime visas raides mažosiomis" - -#: lazarusidestrconsts:lismenutabstospacesselection -msgid "Tabs to spaces in selection" -msgstr "Pažymėtoje srityje tabuliatorius keisti tarpais" - -#: lazarusidestrconsts:lismenuencloseselection -msgid "Enclose selection ..." -msgstr "Apgaubti pažymėtąjį..." - -#: lazarusidestrconsts:lismenucommentselection -msgid "Comment selection" -msgstr "Uždėti komentarą pažymėtajam" - -#: lazarusidestrconsts:lismenuuncommentselection -msgid "Uncomment selection" -msgstr "Nuimti komentarą nuo pažymetojo" - -#: lazarusidestrconsts:liskminsertifdef -msgid "Insert $IFDEF" -msgstr "Įterpti $IFDEF" - -#: lazarusidestrconsts:lismenuconditionalselection -msgid "Insert $IFDEF..." -msgstr "Įterpti $IFDEF..." - -#: lazarusidestrconsts:lismenusortselection -msgid "Sort selection ..." -msgstr "Rūšiuoti pažymėtą..." - -#: lazarusidestrconsts:lismenubeaklinesinselection -msgid "Break Lines in selection" -msgstr "Laužyti eilutes pažymėtoje srityje" - -#: lazarusidestrconsts:liskmselectwordleft -msgid "Select word left" -msgstr "Pažymėti žodį kairėje" - -#: lazarusidestrconsts:liskmselectwordright -msgid "Select word right" -msgstr "Pažymėti žodį dešinėje" - -#: lazarusidestrconsts:liskmselectlinestart -msgid "Select line start" -msgstr "Žymėti iki eilutės pradžios" - -#: lazarusidestrconsts:liskmselectlineend -msgid "Select line end" -msgstr "Žymėti iki eilutės galo" - -#: lazarusidestrconsts:liskmselectpagetop -msgid "Select page top" -msgstr "Žymėti iki lapo viršaus" - -#: lazarusidestrconsts:liskmselectpagebottom -msgid "Select page bottom" -msgstr "Žymėti iki lapo apačios" - -#: lazarusidestrconsts:lismenuselect -msgid "Select" -msgstr "Žymėjimas" - -#: lazarusidestrconsts:lismenuselectall -msgid "Select all" -msgstr "Pažymėti viską" - -#: lazarusidestrconsts:lismenuselecttobrace -msgid "Select to brace" -msgstr "Pažymėti iki skliaustelio" - -#: lazarusidestrconsts:lismenuselectcodeblock -msgid "Select code block" -msgstr "Pažymėti kodo bloką" - -#: lazarusidestrconsts:lismenuselectword -msgid "Select word" -msgstr "Pažymėti žodį" - -#: lazarusidestrconsts:lismenuselectline -msgid "Select line" -msgstr "Pažymėti eilutę" - -#: lazarusidestrconsts:lismenuselectparagraph -msgid "Select paragraph" -msgstr "Pažymėti paragrafą" - -#: lazarusidestrconsts:lismenuinsertcharacter -msgid "Insert from Character Map" -msgstr "Įterpti iš simbolių lentelės" - -#: lazarusidestrconsts:lismenuinserttext -msgid "Insert text" -msgstr "Įterpti tekstą" - -#: lazarusidestrconsts:lismenuinsertcvskeyword -msgid "CVS keyword" -msgstr "CVS raktažodis" - -#: lazarusidestrconsts:lismenuinsertgeneral -msgid "General" -msgstr "Pagrindinis" - -#: lazarusidestrconsts:lisnone2 -msgid "none" -msgstr "nieks" - -#: lazarusidestrconsts:lisor -msgid "or" -msgstr "arba" - -#: lazarusidestrconsts:lisnone -msgid "%snone" -msgstr "%snieks" - -#: lazarusidestrconsts:lisunitpaths -msgid "Unit paths" -msgstr "Modulių keliai" - -#: lazarusidestrconsts:lisincludepaths -msgid "Include paths" -msgstr "Įterpimo keliai" - -#: lazarusidestrconsts:lissourcepaths -msgid "Source paths" -msgstr "Keliai iki pirminio kodo" - -#: lazarusidestrconsts:lismenucompletecode -msgid "Complete Code" -msgstr "Užbaigti kodą" - -#: lazarusidestrconsts:lismenuextractproc -msgid "Extract procedure ..." -msgstr "Ištraukti procedūrą..." - -#: lazarusidestrconsts:lismenufindidentifierrefs -msgid "Find Identifier References ..." -msgstr "Ieškoti identifikatoriaus įrašų..." - -#: lazarusidestrconsts:lismenurenameidentifier -msgid "Rename Identifier ..." -msgstr "Pervardyti identifikatorių..." - -#: lazarusidestrconsts:lismenuinsertgplnotice -msgid "GPL notice" -msgstr "GPL raštas" - -#: lazarusidestrconsts:lismenuinsertlgplnotice -msgid "LGPL notice" -msgstr "LGPL raštas" - -#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice -msgid "Modified LGPL notice" -msgstr "Modifikuotas LGPL raštas" - -#: lazarusidestrconsts:lismenuinsertusername -msgid "Current username" -msgstr "Dabartinis naudotojo vardas" - -#: lazarusidestrconsts:lismenuinsertdatetime -msgid "Current date and time" -msgstr "Dabartinė data ir laikas" - -#: lazarusidestrconsts:lismenuinsertchangelogentry -msgid "ChangeLog entry" -msgstr "Pakeitimų žurnalo įrašas" - -#: lazarusidestrconsts:lismenufind -msgid "Find" -msgstr "Paieška" - -#: lazarusidestrconsts:lismenufindnext -msgid "Find &Next" -msgstr "Ieškoti &toliau" - -#: lazarusidestrconsts:lismenufind2 -msgid "Find ..." -msgstr "Ieškoti..." - -#: lazarusidestrconsts:lismenufindprevious -msgid "Find &Previous" -msgstr "Ieškoti an&kstesnio" - -#: lazarusidestrconsts:lismenufindinfiles -msgid "Find &in files ..." -msgstr "&Ieškoti failuose..." - -#: lazarusidestrconsts:lismenureplace -msgid "Replace" -msgstr "Pakeisti" - -#: lazarusidestrconsts:lismenuincrementalfind -msgid "Incremental Find" -msgstr "Prieauginė paieška" - -#: lazarusidestrconsts:lismenureplace2 -msgid "Replace ..." -msgstr "Pakeisti..." - -#: lazarusidestrconsts:lismenugotoline -msgid "Goto line ..." -msgstr "Rodyti eilutę..." - -#: lazarusidestrconsts:lismenujumpback -msgid "Jump back" -msgstr "Peršokti atgal" - -#: lazarusidestrconsts:lismenujumpforward -msgid "Jump forward" -msgstr "Peršokti pirmyn" - -#: lazarusidestrconsts:lismenuaddjumppointtohistory -msgid "Add jump point to history" -msgstr "Peršokimo tašką įdėti istorijon" - -#: lazarusidestrconsts:lismenuviewjumphistory -msgid "View Jump-History ..." -msgstr "Rodyti peršokimų istoriją..." - -#: lazarusidestrconsts:lismenufindblockotherendofcodeblock -msgid "Find other end of code block" -msgstr "Ieškoti kodo bloko kitos pabaigos" - -#: lazarusidestrconsts:lismenufindcodeblockstart -msgid "Find code block start" -msgstr "Ieškoti kodo bloko pradžios" - -#: lazarusidestrconsts:lismenufinddeclarationatcursor -msgid "Find Declaration at cursor" -msgstr "Ieškoti ties žymekliu nurodytojo paskelbimo" - -#: lazarusidestrconsts:lismenuopenfilenameatcursor -msgid "Open filename at cursor" -msgstr "Atverti ties žymekliu nurodytą failą" - -#: lazarusidestrconsts:lismenugotoincludedirective -msgid "Goto include directive" -msgstr "Rodyti įterpimo direktyvą" - -#: lazarusidestrconsts:lismenujumptonexterror -msgid "Jump to next error" -msgstr "Šokti prie tolesnės klaidos" - -#: lazarusidestrconsts:lismenujumptopreverror -msgid "Jump to previous error" -msgstr "Šokti prie ankstesnės klaidos" - -#: lazarusidestrconsts:lismenusetfreebookmark -msgid "Set a free bookmark" -msgstr "Padėti laisvą žymę" - -#: lazarusidestrconsts:lismenujumptonextbookmark -msgid "Jump to next bookmark" -msgstr "Šokti prie tolesnės žymės" - -#: lazarusidestrconsts:lismenujumptoprevbookmark -msgid "Jump to previous bookmark" -msgstr "Šokti prie ankstesnės žymės" - -#: lazarusidestrconsts:lismenuviewobjectinspector -msgid "Object Inspector" -msgstr "Objektų inspektorius" - -#: lazarusidestrconsts:lismenuviewsourceeditor -msgid "Source Editor" -msgstr "Pirminio kodo redaktorius" - -#: lazarusidestrconsts:lismenuviewcodeexplorer -msgid "Code Explorer" -msgstr "Kodo tyrinėtojas" - -#: lazarusidestrconsts:lismenuviewcodebrowser -msgid "Code Browser" -msgstr "Kodo naršyklė" - -#: lazarusidestrconsts:lismenujumpto -msgid "Jump to" -msgstr "Šokti į" - -#: lazarusidestrconsts:lismenuviewunits -msgid "Units..." -msgstr "Moduliai..." - -#: lazarusidestrconsts:lismenuviewforms -msgid "Forms..." -msgstr "Formos..." - -#: lazarusidestrconsts:lismenuviewunitdependencies -msgid "View Unit Dependencies" -msgstr "Rodyti modulio priklausomybes" - -#: lazarusidestrconsts:liskmviewunitinfo -msgid "View Unit Info" -msgstr "Rodyti informaciją apie modulį" - -#: lazarusidestrconsts:lismenuviewunitinfo -msgid "View Unit Information" -msgstr "Rodyti informaciją apie modulį" - -#: lazarusidestrconsts:lismenuviewtoggleformunit -msgid "Toggle form/unit view" -msgstr "Rodyti formą arba modulį" - -#: lazarusidestrconsts:lismenuviewmessages -msgid "Messages" -msgstr "Pranešimai" - -#: lazarusidestrconsts:liscopyselectedmessagestoclipboard -msgid "Copy selected messages to clipboard" -msgstr "Kopijuoti pažymėtus pranešimus į iškarpinę" - -#: lazarusidestrconsts:liscopyallmessagestoclipboard -msgid "Copy all messages to clipboard" -msgstr "Kopijuoti visus pranešimus į iškarpinę" - -#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard -msgid "Copy all and hidden messages to clipboard" -msgstr "Kopijuoti visus (ir paslėptus) pranešimus į iškarpinę" - -#: lazarusidestrconsts:lissaveallmessagestofile -msgid "Save all messages to file" -msgstr "Visus pranešimus įrašyti failan" - -#: lazarusidestrconsts:lismenuviewsearchresults -msgid "Search Results" -msgstr "Ieškos rezultatai" - -#: lazarusidestrconsts:lissearchagain -msgid "Search again" -msgstr "Ieškoti toliau" - -#: lazarusidestrconsts:lissrclosepage -msgid "Close page" -msgstr "Užverti lapą" - -#: lazarusidestrconsts:lismenuviewanchoreditor -msgid "View Anchor Editor" -msgstr "Rodyti prieraišų redaktorių" - -#: lazarusidestrconsts:liskmtoggleviewcomponentpalette -msgid "Toggle view component palette" -msgstr "Keisti komponenčių paletės matomumą" - -#: lazarusidestrconsts:lismenuviewcomponentpalette -msgid "View Component Palette" -msgstr "Rodyti komponenčių paletę" - -#: lazarusidestrconsts:lismenuviewidespeedbuttons -msgid "View IDE speed buttons" -msgstr "Rodyti IKA sparčiuosius mygtukus" - -#: lazarusidestrconsts:lismenudebugwindows -msgid "Debug windows" -msgstr "Derinimo langai" - -#: lazarusidestrconsts:lismenuviewwatches -msgid "Watches" -msgstr "Stebimieji" - -#: lazarusidestrconsts:lismenuviewbreakpoints -msgid "BreakPoints" -msgstr "Stabdos taškai" - -#: lazarusidestrconsts:lismenuviewlocalvariables -msgid "Local Variables" -msgstr "Vietiniai kintamieji" - -#: lazarusidestrconsts:lismenuviewcallstack -msgid "Call Stack" -msgstr "Kreipčių dėklas" - -#: lazarusidestrconsts:lismenuviewdebugoutput -msgid "Debug output" -msgstr "Derinimo išvestis" - -#: lazarusidestrconsts:lismenunewproject -msgid "New Project ..." -msgstr "Naujas projektas..." - -#: lazarusidestrconsts:lismenunewprojectfromfile -msgid "New Project from file ..." -msgstr "Naujas projektas iš failo..." - -#: lazarusidestrconsts:lismenuopenproject -msgid "Open Project ..." -msgstr "Atverti projektą..." - -#: lazarusidestrconsts:lismenucloseproject -msgid "Close Project" -msgstr "Užverti projektą" - -#: lazarusidestrconsts:lismenuopenrecentproject -msgid "Open Recent Project ..." -msgstr "Atverti paskutinį naudotą projektą..." - -#: lazarusidestrconsts:lismenusaveproject -msgid "Save Project" -msgstr "Išsaugoti projektą" - -#: lazarusidestrconsts:lismenusaveprojectas -msgid "Save Project As ..." -msgstr "Projektą išsaugoti kaip..." - -#: lazarusidestrconsts:lismenupublishproject -msgid "Publish Project ..." -msgstr "Skelbti projektą..." - -#: lazarusidestrconsts:lismenuprojectinspector -msgid "Project Inspector" -msgstr "Projekto inspektorius" - -#: lazarusidestrconsts:liskmaddactiveunittoproject -msgid "Add active unit to project" -msgstr "Įdėti į projektą aktyvųjį modulį" - -#: lazarusidestrconsts:liskmremoveactiveunitfromproject -msgid "Remove active unit from project" -msgstr "Pašalinti iš projekto aktyvųjį modulį" - -#: lazarusidestrconsts:liskmviewprojectsource -msgid "View project source" -msgstr "Rodyti projekto pirminį kodą" - -#: lazarusidestrconsts:liskmviewprojecttodolist -msgid "View project ToDo list" -msgstr "Rodyti projekto ToDo sąrašą" - -#: lazarusidestrconsts:lismenuaddtoproject -msgid "Add editor file to Project" -msgstr "Redaktoriaus failą įdėti į projektą" - -#: lazarusidestrconsts:lismenuremovefromproject -msgid "Remove from Project ..." -msgstr "Pašalinti iš projekto..." - -#: lazarusidestrconsts:lismenuviewsource -msgid "View Source" -msgstr "Rodyti pirminį kodą" - -#: lazarusidestrconsts:lismenuviewprojecttodos -msgid "View ToDo List ..." -msgstr "Rodyti ToDo sąrašą..." - -#: lazarusidestrconsts:lismenuprojectoptions -msgid "Project Options ..." -msgstr "Projekto parinktys..." - -#: lazarusidestrconsts:lismenubuild -msgid "Build" -msgstr "Daryti" - -#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath -msgid "Working directory (Leave empty for file path)" -msgstr "Darbinis katalogas (palikite tuščią failo keliui)" - -#: lazarusidestrconsts:lisbfbuildcommand -msgid "Build Command" -msgstr "Darymo komanda" - -#: lazarusidestrconsts:lismenubuildall -msgid "Build all" -msgstr "Daryti visus" - -#: lazarusidestrconsts:lismenuquickcompile -msgid "Quick compile" -msgstr "Spartus kompiliavimas" - -#: lazarusidestrconsts:lismenuabortbuild -msgid "Abort Build" -msgstr "Nutraukti darymą" - -#: lazarusidestrconsts:lismenuprojectrun -msgid "Run" -msgstr "Startuoti" - -#: lazarusidestrconsts:lisbfalwaysbuildbeforerun -msgid "Always Build before Run" -msgstr "Prieš startuojant visada daryti" - -#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2 -msgid "Working Directory (Leave empty for file path)" -msgstr "Darbinis katalogas (palikite tuščią failo keliui)" - -#: lazarusidestrconsts:lisbfruncommand -msgid "Run Command" -msgstr "Startavimo komanda" - -#: lazarusidestrconsts:lismenupause -msgid "Pause" -msgstr "Pauzė" - -#: lazarusidestrconsts:lismenustepinto -msgid "Step into" -msgstr "Žengti gilyn" - -#: lazarusidestrconsts:lismenustepover -msgid "Step over" -msgstr "Žengti virš" - -#: lazarusidestrconsts:lismenuruntocursor -msgid "Run to cursor" -msgstr "Startuoti iki žymeklio" - -#: lazarusidestrconsts:liskmstopprogram -msgid "Stop program" -msgstr "Sustabdyti programą" - -#: lazarusidestrconsts:lismenustop -msgid "Stop" -msgstr "Stabdyti" - -#: lazarusidestrconsts:liscontinue -msgid "Continue" -msgstr "Tęsti" - -#: lazarusidestrconsts:lismenuresetdebugger -msgid "Reset debugger" -msgstr "Atstatyti derintuvę pradžion" - -#: lazarusidestrconsts:liskmcompileroptions -msgid "Compiler options" -msgstr "Kompiliatoriaus parinktys" - -#: lazarusidestrconsts:lismenucompileroptions -msgid "Compiler Options ..." -msgstr "Kompiliatoriaus parinktys..." - -#: lazarusidestrconsts:lismenurunparameters -msgid "Run Parameters ..." -msgstr "Startavimo parametrai..." - -#: lazarusidestrconsts:lismenubuildfile -msgid "Build File" -msgstr "Daryti failą" - -#: lazarusidestrconsts:lismenurunfile -msgid "Run File" -msgstr "Startuoti failą" - -#: lazarusidestrconsts:liskmconfigbuildfile -msgid "Config %sBuild File%s" -msgstr "Derinti %sDaryti failą%s" - -#: lazarusidestrconsts:liskminspect -msgid "Inspect" -msgstr "Inspektuoti" - -#: lazarusidestrconsts:liskmevaluatemodify -msgid "Evaluate/Modify" -msgstr "Įvertinti/Modifikuoti" - -#: lazarusidestrconsts:liskmaddwatch -msgid "Add watch" -msgstr "Pridėti stebimąjį" - -#: lazarusidestrconsts:lismenuconfigbuildfile -msgid "Configure Build+Run File ..." -msgstr "Derinti \"Daryti ir startuoti failą\"..." - -#: lazarusidestrconsts:lismenuinspect -msgid "Inspect ..." -msgstr "Inspektuoti..." - -#: lazarusidestrconsts:lismenuevaluate -msgid "Evaluate/Modify ..." -msgstr "Įvertinti/Modifikuoti..." - -#: lazarusidestrconsts:lismenuaddwatch -msgid "Add watch ..." -msgstr "Pridėti stebimąjį..." - -#: lazarusidestrconsts:lismenuaddbreakpoint -msgid "Add breakpoint" -msgstr "Padėti stabdos tašką" - -#: lazarusidestrconsts:lismenuaddbpsource -msgid "Source breakpoint" -msgstr "Stabdos taškas pirminiame kode" - -#: lazarusidestrconsts:lismenuopenpackage -msgid "Open loaded package ..." -msgstr "Atverti įkeltą paketą..." - -#: lazarusidestrconsts:lismenuopenrecentpkg -msgid "Open recent package ..." -msgstr "Atverti paskutinį naudotą paketą..." - -#: lazarusidestrconsts:lismenuopenpackagefile -msgid "Open package file (.lpk) ..." -msgstr "Atverti paketo failą (.lpk)" - -#: lazarusidestrconsts:lismenuopenpackageofcurunit -msgid "Open package of current unit" -msgstr "Atverti veikiamojo modulio paketą" - -#: lazarusidestrconsts:lismenuaddcurunittopkg -msgid "Add active unit to a package" -msgstr "Įdėti aktyvųjį modulį į paketą" - -#: lazarusidestrconsts:liskmpackagegraph -msgid "Package graph" -msgstr "Paketų grafas" - -#: lazarusidestrconsts:liskmconfigureinstalledpackages -msgid "Configure installed packages" -msgstr "Derinti įdiegtus paketus" - -#: lazarusidestrconsts:liskmconfigurecustomcomponents -msgid "Configure custom components" -msgstr "Derinti naudotojo komponentes" - -#: lazarusidestrconsts:lismenupackagegraph -msgid "Package Graph ..." -msgstr "Paketų grafas..." - -#: lazarusidestrconsts:lismenueditinstallpkgs -msgid "Configure installed packages ..." -msgstr "Derinti įdiegtus paketus..." - -#: lazarusidestrconsts:lismenuconfigcustomcomps -msgid "Configure custom components ..." -msgstr "Derinti naudotojo komponentes..." - -#: lazarusidestrconsts:lismenusettings -msgid "Configure custom tools ..." -msgstr "Derinti naudotojo įrankius..." - -#: lazarusidestrconsts:lismenuquicksyntaxcheck -msgid "Quick syntax check" -msgstr "Sparti sintaksės patikra" - -#: lazarusidestrconsts:lismenuguessunclosedblock -msgid "Guess unclosed block" -msgstr "Nuspėti neužbaigtus blokus" - -#: lazarusidestrconsts:lismenuguessmisplacedifdef -msgid "Guess misplaced IFDEF/ENDIF" -msgstr "Nuspėti nevietoj esančius $IFDEF/$ENDIF" - -#: lazarusidestrconsts:lismenumakeresourcestring -msgid "Make Resource String ..." -msgstr "Kurti resursų eilutę..." - -#: lazarusidestrconsts:lismenudiff -msgid "Diff" -msgstr "Diff" - -#: lazarusidestrconsts:lismenuconvertdfmtolfm -msgid "Convert DFM file to LFM ..." -msgstr "Konvertuoti DFM failą į LFM..." - -#: lazarusidestrconsts:lismenuchecklfm -msgid "Check LFM file in editor" -msgstr "Tikrinti LFM failą redaktoriuje" - -#: lazarusidestrconsts:lismenuconvertdelphiunit -msgid "Convert Delphi unit to Lazarus unit ..." -msgstr "Konvertuoti Delphi modulį į Lazarus modulį..." - -#: lazarusidestrconsts:lismenuconvertdelphiproject -msgid "Convert Delphi project to Lazarus project ..." -msgstr "Konvertuoti Delphi projektą į Lazarus projektą..." - -#: lazarusidestrconsts:lismenuconvertdelphipackage -msgid "Convert Delphi package to Lazarus package ..." -msgstr "Konvertuoti Delphi paketą į Lazarus paketą..." - -#: lazarusidestrconsts:lismenubuildlazarus -msgid "Build Lazarus" -msgstr "Daryti Lazarus" - -#: lazarusidestrconsts:lismenuconfigurebuildlazarus -msgid "Configure \"Build Lazarus\" ..." -msgstr "Derinti \"Daryti Lazarus\"..." - -#: lazarusidestrconsts:lismenugeneraloptions -msgid "Environment options ..." -msgstr "Aplinkos parinktys..." - -#: lazarusidestrconsts:lismenueditoroptions -msgid "Editor options ..." -msgstr "Redaktoriaus parinktys..." - -#: lazarusidestrconsts:lismenueditcodetemplates -msgid "Code Templates ..." -msgstr "Kodo šablonai..." - -#: lazarusidestrconsts:lismendebuggeroptions -msgid "Debugger Options ..." -msgstr "Derintuvės parinktys..." - -#: lazarusidestrconsts:lismenucodetoolsoptions -msgid "CodeTools Options ..." -msgstr "CodeTools parinktys..." - -#: lazarusidestrconsts:lismenucodetoolsdefineseditor -msgid "CodeTools defines editor ..." -msgstr "CodeTools apibrėžčių redaktorius..." - -#: lazarusidestrconsts:lismenuonlinehelp -msgid "Online Help" -msgstr "Internetinis žinynas" - -#: lazarusidestrconsts:liskmconfigurehelp -msgid "Configure Help" -msgstr "Derinti žinyną" - -#: lazarusidestrconsts:liskmcontextsensitivehelp -msgid "Context sensitive help" -msgstr "Kontekstinis žinynas" - -#: lazarusidestrconsts:liskmeditcontextsensitivehelp -msgid "Edit context sensitive help" -msgstr "Keisti kontekstinį žinyną" - -#: lazarusidestrconsts:lismenuconfigurehelp -msgid "Configure Help ..." -msgstr "Derinti žinyną..." - -#: lazarusidestrconsts:lismenucontexthelp -msgid "Context sensitive Help" -msgstr "Kontekstinis žinynas" - -#: lazarusidestrconsts:lismenueditcontexthelp -msgid "Edit context sensitive Help" -msgstr "Redaktoriaus kontekstinis žinynas" - -#: lazarusidestrconsts:lismenucreatelazdocfiles -msgid "Create LazDoc files" -msgstr "Kurti LazDoc failus" - -#: lazarusidestrconsts:lisdsgcopycomponents -msgid "Copy selected components to clipboard" -msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" - -#: lazarusidestrconsts:lisdsgcutcomponents -msgid "Cut selected components to clipboard" -msgstr "Iškirpti pažymėtas komponentes į iškarpinę" - -#: lazarusidestrconsts:lisdsgpastecomponents -msgid "Paste selected components from clipboard" -msgstr "Įterpti pažymėtas komponentes iš iškarpinės" - -#: lazarusidestrconsts:lisdsgselectparentcomponent -msgid "Select parent component" -msgstr "Pažymėkite tėvinę komponentę" - -#: lazarusidestrconsts:lisdsgordermovetofront -msgid "Move component to front" -msgstr "Perkelti komponentę priekin" - -#: lazarusidestrconsts:lisdsgordermovetoback -msgid "Move component to back" -msgstr "Perkelti komponentę galan" - -#: lazarusidestrconsts:lisdsgorderforwardone -msgid "Move component one forward" -msgstr "Perkelti komponentę per viena pirmyn" - -#: lazarusidestrconsts:lisdsgorderbackone -msgid "Move component one back" -msgstr "Perkelti komponentę per viena atgal" - -#: lazarusidestrconsts:lischooseprogramsourcepppaslpr -msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "Nurodykit programos pirminį kodą (*.pp, *.pas, *.lpr)" - -#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp -msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "Programos pirminio kodo failo prievardis turi būti panašus į paskalio: .pas, .pp arba .lpr" - -#: lazarusidestrconsts:liscompileroptionsforproject -msgid "Compiler Options for Project: %s" -msgstr "Kompiliatoriaus parinktys projektui: %s" - -#: lazarusidestrconsts:lischoosedelphiunit -msgid "Choose Delphi unit (*.pas)" -msgstr "Nurodykit Delphi modulį (*.pas)" - -#: lazarusidestrconsts:lischoosedelphiproject -msgid "Choose Delphi project (*.dpr)" -msgstr "Nurodykit Delphi projektą (*.dpr)" - -#: lazarusidestrconsts:lischoosedelphipackage -msgid "Choose Delphi package (*.dpk)" -msgstr "Nurodykit Delphi paketą (*.dpk)" - -#: lazarusidestrconsts:lisdelphiproject -msgid "Delphi project" -msgstr "Delphi projektas" - -#: lazarusidestrconsts:lisunabletoreadfileerror -msgid "Unable to read file %s%s%s%sError: %s" -msgstr "Nepavyko skaityti iš failo %s%s%s%sKlaida: %s" - -#: lazarusidestrconsts:lisformaterror -msgid "Format error" -msgstr "Formato klaida" - -#: lazarusidestrconsts:lislfmfilecorrupt -msgid "LFM file corrupt" -msgstr "LFM failas sugadintas" - -#: lazarusidestrconsts:lisunabletofindavalidclassnamein -msgid "Unable to find a valid classname in %s%s%s" -msgstr "%s%s%s nepavyko rasti klasę tinkamu vardu" - -#: lazarusidestrconsts:lisunabletoconvertfileerror -msgid "Unable to convert file %s%s%s%sError: %s" -msgstr "Nepavyko konvertuoti į failą %s%s%s%sKlaida: %s" - -#: lazarusidestrconsts:lisunabletowritefileerror -msgid "Unable to write file %s%s%s%sError: %s" -msgstr "Nepavyko rašyti į failą %s%s%s%sKlaida: %s" - -#: lazarusidestrconsts:liserrorcreatinglrs -msgid "Error creating lrs" -msgstr "Klaida kuriant LRS" - -#: lazarusidestrconsts:lislfmfilenotfound -msgid "LFM file not found" -msgstr "Nerastas LFM failas" - -#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren -msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." -msgstr "Šių modulių nepavyko rasti:%s%s%s%s 1) Ko gero šie moduliai nėra modulių kelyje, tada jūs galite nutraukti viską, ištaisyti modulių kelią ir bandyti vėl.%s 2) Arba jūs galite praleisti trūkstamus modulius ir vėliau jiems uždėti komentarą." - -#: lazarusidestrconsts:lisunitnotfound -msgid "Unit not found" -msgstr "Modulis nerastas" - -#: lazarusidestrconsts:lisunitsnotfound2 -msgid "Units not found" -msgstr "Moduliai nerasti" - -#: lazarusidestrconsts:lisunitlfmfile -msgid "Unit: %s%sLFM file: %s" -msgstr "Modulis: %s%sLFM failas: %s" - -#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile -msgid "Unable to convert lfm to lrs and write lrs file." -msgstr "Nepavyko LFM konvertuoti į LRS ir sukurti LRS failą." - -#: lazarusidestrconsts:lisnotadelphiproject -msgid "Not a Delphi project" -msgstr "Ne Delphi projektas" - -#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr -msgid "The file %s%s%s is not a Delphi project (.dpr)" -msgstr "Failas %s%s%s nėra Delphi projektas (.dpr)" - -#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis -msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "Nepavyko įkelti senąjį resursų failą.%sResursų failas yra pirmasis įdedamasis failas \"initialization\" sekcijoje.%sPavyzdžiui: {$I %s.lrs}.%sKogero tai sintaksės klaida." - -#: lazarusidestrconsts:lisresourceloaderror -msgid "Resource load error" -msgstr "Klaida įkeliant resursus" - -#: lazarusidestrconsts:lisignoremissingfile -msgid "Ignore missing file" -msgstr "Praleisti trūkstamą failą" - -#: lazarusidestrconsts:lisnoname -msgid "noname" -msgstr "bevardis" - -#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist -msgid "The destination directory%s%s%s%s does not exist." -msgstr "Paskirties katalogas%s%s%s%s neegzistuoja." - -#: lazarusidestrconsts:lisrenamefile -msgid "Rename file?" -msgstr "Pervardyti failą?" - -#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc -msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" -msgstr "Panašu kad tai paskalio failas.%sRekomenduotina failo varde naudoti tik mažąsias raides, tokiu būdu išvengsite problemų, susijusių su įvairiomis failų sistemomis ar įvairiais kompiliatoriais.%sPervardyti mažosiomis raidėmis?" - -#: lazarusidestrconsts:lisrenametolowercase -msgid "Rename to lowercase" -msgstr "Pervardyti mažosiomis" - -#: lazarusidestrconsts:liskeepname -msgid "Keep name" -msgstr "Nekeisti vardo" - -#: lazarusidestrconsts:lisoverwritefile -msgid "Overwrite file?" -msgstr "Perrašyti failą?" - -#: lazarusidestrconsts:lisafilealreadyexistsreplaceit -msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "Failas %s%s%s jau egzistuoja.%sPerrašyti?" - -#: lazarusidestrconsts:lisoverwritefileondisk -msgid "Overwrite file on disk" -msgstr "Perrašyti failą diske" - -#: lazarusidestrconsts:lisambiguousfilesfound -msgid "Ambiguous files found" -msgstr "Rastas neaiškus failas" - -#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename -msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "Kataloge yra failų, kurių vardai skiriasi tik raidžių lygiais:%s%s%sJuos ištrinti?" - -#: lazarusidestrconsts:lisdeleteoldfile -msgid "Delete old file %s%s%s?" -msgstr "Ištrinti senąjį failą %s%s%s?" - -#: lazarusidestrconsts:lisdeletingoffilefailed -msgid "Deleting of file %s%s%s failed." -msgstr "Nepavyko ištrinti failą %s%s%s." - -#: lazarusidestrconsts:lisstreamingerror -msgid "Streaming error" -msgstr "Klaida siunčiant srautu" - -#: lazarusidestrconsts:lisunabletostreamt -msgid "Unable to stream %s:T%s." -msgstr "Nepavyko siųsti srautu %s:T%s." - -#: lazarusidestrconsts:lisresourcesaveerror -msgid "Resource save error" -msgstr "Klaida išsaugojant resursus" - -#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile -msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "Resursu faile %s%s%s%snepavyko įrašyti resursų antraštinį komentarą.%sKogero tai sintaksės klaida." - -#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably -msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." -msgstr "Resurso T%s:FORMDATA nepavyko įrašyti į resursų failą %s%s%s%s.%sKogero tai sintaksės klaida." - -#: lazarusidestrconsts:lisunabletocreatefile2 -msgid "Unable to create file %s%s%s" -msgstr "Nepavyko sukurti failą %s%s%s" - -#: lazarusidestrconsts:liscontinuewithoutloadingform -msgid "Continue without loading form" -msgstr "Tęsti neįkeliant formos" - -#: lazarusidestrconsts:liscancelloadingunit -msgid "Cancel loading unit" -msgstr "Atsisakyti modulio įkėlimo" - -#: lazarusidestrconsts:lisabortallloading -msgid "Abort all loading" -msgstr "Nutraukti visą įkėlimo procesą" - -#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext -msgid "Unable to transform binary component stream of %s:T%s into text." -msgstr "Nepavyko dvejetainį komponento %s:T%s srautą transformuoti į tekstą." - -#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject -msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "Failas %s%s%s%s nerastas.%sPaspaudus \"Ignoruoti\" projektas bus įkeliamas toliau,%spaspaudus \"Nutraukti\" įkėlimas bus nutrauktas." - -#: lazarusidestrconsts:lisskipfileandcontinueloading -msgid "Skip file and continue loading" -msgstr "Tęsti įkrovą praleidžiant failą" - -#: lazarusidestrconsts:lisabortloadingproject -msgid "Abort loading project" -msgstr "Nutraukti projekto įkrovą" - -#: lazarusidestrconsts:lisfilenotfound2 -msgid "File %s%s%s not found.%s" -msgstr "Failas %s%s%s nerastas.%s" - -#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit -msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "Failas %s%s%s nerastas.%sJį sukurti?%s" - -#: lazarusidestrconsts:lisprojectinfofiledetected -msgid "Project info file detected" -msgstr "Aptiktas projekto informacinis failas" - -#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp -msgid "The file %s seems to be the program file of an existing lazarus Project." -msgstr "Panašu kad failas %s yra kažkurio Lazarus projekto programos failas." - -#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject -msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "Panašu kad failas %s%s%s%s yra programa. Užverti šį projektą ir tai programai sukurti naują Lazarus projektą?%sPaspaudus \"Ne\" failas bus įkeltas kaip įprastas pirminis kodas." - -#: lazarusidestrconsts:lisprogramdetected -msgid "Program detected" -msgstr "Aptikta programa" - -#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream -msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" -msgstr "Nepavyko faile %s%s%s%s%sesantį tekstą konvertuoti į dvejetainį srautą. (%s)" - -#: lazarusidestrconsts:lisformloaderror -msgid "Form load error" -msgstr "Klaida įkeliant formą" - -#: lazarusidestrconsts:lissaveprojectlpi -msgid "Save Project %s (*.lpi)" -msgstr "Išsaugoti projektą %s (.lpi)" - -#: lazarusidestrconsts:lisinvalidprojectfilename -msgid "Invalid project filename" -msgstr "Klaidingas projekto failo vardas" - -#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject -msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "Projekto vardas %s%s%s yra klaidingas.%sNurodykite kitokį vardą (pvz.: projektas1.lpi)" - -#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier -msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "Vardas %s%s%s nėra paskalio identifikatorius." - -#: lazarusidestrconsts:lischooseadifferentname -msgid "Choose a different name" -msgstr "Nurodykite kitokį vardą" - -#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource -msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "Projekto informacinis failas %s%s%s%s toks pat kaip ir projekto pagrindinio pirminio kodo failas!" - -#: lazarusidestrconsts:lisunitidentifierexists -msgid "Unit identifier exists" -msgstr "Modulio identifikatorius egzistuoja" - -#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose -msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" -msgstr "Projekte jau yra modulis tokiu vardu %s%s%s.%sParinkite kitokį vardą." - -#: lazarusidestrconsts:liserrorcreatingfile -msgid "Error creating file" -msgstr "Klaida kuriant failą" - -#: lazarusidestrconsts:lisunabletocreatefile3 -msgid "Unable to create file%s%s%s%s" -msgstr "Nepavyko sukurti failą%s%s%s%s" - -#: lazarusidestrconsts:liscopyerror2 -msgid "Copy error" -msgstr "Klaida kopijuojant" - -#: lazarusidestrconsts:lissourcedirectorydoesnotexist -msgid "Source directory %s%s%s does not exist." -msgstr "Pirminio kodo katalogas %s%s%s neegzistuoja." - -#: lazarusidestrconsts:lisunabletocreatedirectory -msgid "Unable to create directory %s%s%s." -msgstr "Nepavyko sukurti katalogą %s%s%s." - -#: lazarusidestrconsts:lisunabletocopyfileto -msgid "Unable to copy file %s%s%s%sto %s%s%s" -msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s" - -#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented -msgid "Sorry, this type is not yet implemented" -msgstr "Deja, šis tipas dar neįgyvendintas" - -#: lazarusidestrconsts:lisfilehaschangedsave -msgid "File %s%s%s has changed. Save?" -msgstr "Failas %s%s%s pakeistas. Išsaugoti?" - -#: lazarusidestrconsts:lisunithaschangedsave -msgid "Unit %s%s%s has changed. Save?" -msgstr "Modulis %s%s%s pakeistas. Išsaugoti?" - -#: lazarusidestrconsts:lissourceofpagehaschangedsave -msgid "Source of page %s%s%s has changed. Save?" -msgstr "Pirminis kodas lape %s%s%s pakeistas. Išsaugoti?" - -#: lazarusidestrconsts:lissourcemodified -msgid "Source modified" -msgstr "Pirminis kodas pakeistas" - -#: lazarusidestrconsts:lisopenproject -msgid "Open Project?" -msgstr "Atverti projektą?" - -#: lazarusidestrconsts:lisopentheproject -msgid "Open the project %s?" -msgstr "Atverti projektą %s?" - -#: lazarusidestrconsts:lisopenpackage -msgid "Open Package?" -msgstr "Atverti paketą?" - -#: lazarusidestrconsts:lisopenthepackage -msgid "Open the package %s?" -msgstr "Atverti paketą %s?" - -#: lazarusidestrconsts:lisrevertfailed -msgid "Revert failed" -msgstr "Atstatyti nepavyko" - -#: lazarusidestrconsts:lisfileisvirtual -msgid "File %s%s%s is virtual." -msgstr "Failas %s%s%s yra virtualus." - -#: lazarusidestrconsts:lisunabletowrite -msgid "Unable to write %s%s%s%s%s." -msgstr "Nepavyko rašyti į %s%s%s%s%s." - -#: lazarusidestrconsts:lisfilenottext -msgid "File not text" -msgstr "Neteksto failas" - -#: lazarusidestrconsts:lisunabletorenamefile -msgid "Unable to rename file" -msgstr "Nepavyko pervardyti failą" - -#: lazarusidestrconsts:lisunabletocopyfile -msgid "Unable to copy file" -msgstr "Nepavyko kopijuoti failą" - -#: lazarusidestrconsts:lissourceanddestinationarethesame -msgid "Source and Destination are the same:%s%s" -msgstr "Šaltinis ir tikslas sutampa:%s%s" - -#: lazarusidestrconsts:lisunabletorenamefileto2 -msgid "Unable to rename file %s%s%s%sto %s%s%s." -msgstr "Nepavyko pervardyti failą %s%s%s%sį %s%s%s." - -#: lazarusidestrconsts:lisunabletocopyfileto2 -msgid "Unable to copy file %s%s%s%sto %s%s%s." -msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s." - -#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway -msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "Nepanašu kad failas %s%s%s%s yra teksto failas.%sVistiek jį atverti?" - -#: lazarusidestrconsts:lisinvalidcommand -msgid "Invalid command" -msgstr "Klaidinga komanda" - -#: lazarusidestrconsts:listhecommandafterisnotexecutable -msgid "The command after %s%s%s is not executable." -msgstr "Komanda esanti po %s%s%s nėra vykdomasis failas." - -#: lazarusidestrconsts:lisinvaliddestinationdirectory -msgid "Invalid destination directory" -msgstr "Klaidingas tikslo katalogas" - -#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete -msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." -msgstr "Tikslo katalogas %s%s%s yra klaidingas.%sNurodykite pilną kelią." - -#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory -msgid "Unable to clean up destination directory" -msgstr "Nepavyko apvalyti tikslo katalogo" - -#: lazarusidestrconsts:liscommandafterinvalid -msgid "Command after invalid" -msgstr "Klaidinga komanda esanti po" - -#: lazarusidestrconsts:listhecommandafterpublishingisinvalid -msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "Komanda esanti po paskelbimo yra klaidinga:%s%s%s%s" - -#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions -msgid "Unable to clean up %s%s%s.%sPlease check permissions." -msgstr "Nepavyko apvalyti %s%s%s.%sPatinkrinkite leidimus." - -#: lazarusidestrconsts:liscommandafterpublishingmodule -msgid "Command after publishing module" -msgstr "Komanda po modulio paskelbimo" - -#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith -msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." -msgstr "Nepavyko %s įdėti į projektą, nes projekte jau yra modulis tokiu pat vardu." - -#: lazarusidestrconsts:lisaddtoproject -msgid "Add %s to project?" -msgstr "Įdėti %s į projektą?" - -#: lazarusidestrconsts:listhefile -msgid "The file %s%s%s" -msgstr "Failas %s%s%s" - -#: lazarusidestrconsts:lisisalreadypartoftheproject -msgid "%s is already part of the Project." -msgstr "%s jau yra projekte." - -#: lazarusidestrconsts:lisremovefromproject -msgid "Remove from project" -msgstr "Pašalinti iš projekto" - -#: lazarusidestrconsts:liscreateaprojectfirst -msgid "Create a project first!" -msgstr "Pirma sukurkite projektą!" - -#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt -msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" -msgstr "Nerastas katalogas testui:%s%s%s%s%s(tikrinkite aplinkos parinktis)" - -#: lazarusidestrconsts:lisbuildnewproject -msgid "Build new project" -msgstr "Daryti naująjį projektą" - -#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest -msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "Prieš darymą projektas turi būti išsaugotas%sAplinkos parinktyse parinkę testo katalogą,%snaujus projektus bus galima kurti ir daryti vienu metu.%sIšsaugoti projektą?" - -#: lazarusidestrconsts:lisprojectsuccessfullybuilt -msgid "Project %s%s%s successfully built. :)" -msgstr "Projektas %s%s%s sėkmingai padarytas :)" - -#: lazarusidestrconsts:lisexecutingcommandbefore -msgid "Executing command before" -msgstr "Startuojama komanda prieš" - -#: lazarusidestrconsts:lisexecutingcommandafter -msgid "Executing command after" -msgstr "Startuojama komanda po" - -#: lazarusidestrconsts:lisnoprogramfilesfound -msgid "No program file %s%s%s found." -msgstr "Nerastas programos failas %s%s%s." - -#: lazarusidestrconsts:liserrorinitializingprogramserrors -msgid "Error initializing program%s%s%s%s%sError: %s" -msgstr "Įvyko klaida inicializuojant programą%s%s%s%s%sKlaida: %s" - -#: lazarusidestrconsts:lisnotnow -msgid "Not now" -msgstr "Ne dabar" - -#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling -msgid "You can not build lazarus while debugging or compiling." -msgstr "Derinimo ar kompiliavimo metu negalima daryti Lazarus." - -#: lazarusidestrconsts:lisunabletosavefile -msgid "Unable to save file %s%s%s" -msgstr "Nepavyko išsaugoti failą %s%s%s" - -#: lazarusidestrconsts:lisreaderror -msgid "Read Error" -msgstr "Skaitymo klaida" - -#: lazarusidestrconsts:lisunabletoreadfile2 -msgid "Unable to read file %s%s%s!" -msgstr "Nepavyko skaityti iš failo %s%s%s!" - -#: lazarusidestrconsts:liswriteerror -msgid "Write Error" -msgstr "Rašymo klaida" - -#: lazarusidestrconsts:lisunabletowritetofile -msgid "Unable to write to file %s%s%s!" -msgstr "Nepavyko rašyti į failą %s%s%s!" - -#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2 -msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "Nepanašu kad failas %s%s%s%syra teksto failas.%sVistiek atverti?" - -#: lazarusidestrconsts:lisunabletocreatebackupdirectory -msgid "Unable to create backup directory %s%s%s." -msgstr "Nepavyko sukurti atsarginių kopijų katalogo %s%s%s." - -#: lazarusidestrconsts:lisdeletefilefailed -msgid "Delete file failed" -msgstr "Nepavyko ištrinti failą" - -#: lazarusidestrconsts:lisunabletoremoveoldbackupfile -msgid "Unable to remove old backup file %s%s%s!" -msgstr "Nepavyko ištrinti seną atsarginės kopijos failą %s%s%s!" - -#: lazarusidestrconsts:lisrenamefilefailed -msgid "Rename file failed" -msgstr "Nepavyko pervardyti failą" - -#: lazarusidestrconsts:lisunabletorenamefileto -msgid "Unable to rename file %s%s%s to %s%s%s!" -msgstr "Nepavyko pervardyti failą %s%s%s į %s%s%s!" - -#: lazarusidestrconsts:lisbackupfilefailed -msgid "Backup file failed" -msgstr "Nepavyko padaryti failo atsarginę kopiją" - -#: lazarusidestrconsts:lisunabletobackupfileto -msgid "Unable to backup file %s%s%s to %s%s%s!" -msgstr "Nepavyko padaryti failo %s%s%s atsarginę kopiją į %s%s%s!" - -#: lazarusidestrconsts:lisfilenotlowercase -msgid "File not lowercase" -msgstr "Failo vardas ne mažosiomis raidėmis" - -#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds -msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" -msgstr "Modulio failo varde %s%s%s nevisos raidės yra mažosios.%sFreePascal kompiliatorius 1.0.x priima failus, kurių varduose tik mažosios raidės. Jei jūs nenaudojate FPC 1.0.x, tada jūs galite ignoruoti šį pranešimą.%s%sPervardyti failą?" - -#: lazarusidestrconsts:lisdeleteambiguousfile -msgid "Delete ambiguous file?" -msgstr "Ištrinti neaiškųjį failą?" - -#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete -msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" -msgstr "Rastas neaiškus failas: %s%s%s%sŠis failas gali būti supainiotas su %s%s%s%s%sIštrinti neaiškųjį failą?" - -#: lazarusidestrconsts:lislazaruseditorv -msgid "Lazarus Editor v%s" -msgstr "Lazarus redaktorius v%s" - -#: lazarusidestrconsts:lisnewproject -msgid "%s - (new project)" -msgstr "%s - (naujas projektas)" +#: lazarusidestrconsts:srkmconflicw +msgid " conflicts with " +msgstr " konfliktuoja su " #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" @@ -1735,3117 +39,845 @@ msgstr "%s (kompiliuojama...)" msgid "%s (debugging ...)" msgstr "%s (derinama...)" -#: lazarusidestrconsts:lisunabletofindfile -msgid "Unable to find file %s%s%s." -msgstr "Nerastas failas %s%s%s." +#: lazarusidestrconsts:liscovarious +msgid "%s (various)" +msgstr "%s (įvairūs)" -#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption -msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" -msgstr "Failas %s%s%s nerastas.%sPatikrinkite kelius meniu%s\"Projektas -> Kompiliatoriaus parinktys... -> Keliai -> Kitų modulių failai\"" +#: lazarusidestrconsts:lisnewproject +msgid "%s - (new project)" +msgstr "%s - (naujas projektas)" -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal -msgid "NOTE: Could not create Define Template for Free Pascal Sources" -msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto FreePascal pirminiam kodui" +#: lazarusidestrconsts:lislazarusversionstring +msgid "%s beta" +msgstr "%s beta" -#: lazarusidestrconsts:lisclassnotfound -msgid "Class not found" -msgstr "Klasė nerasta" +#: lazarusidestrconsts:lisuidbytes +msgid "%s bytes" +msgstr "% baitų" -#: lazarusidestrconsts:lisoifclassnotfound -msgid "Class %s%s%s not found." -msgstr "Klasė %s%s%s nerasta." +#: lazarusidestrconsts:liscodetoolsdefsdirectory +msgid "%s directory" +msgstr "%s katalogas" -#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste -msgid "Class %s%s%s is not a registered component class.%sUnable to paste." -msgstr "Klasė %s%s%s nėra registruoto komponento klasė.%sĮdėti nepavyks." +#: lazarusidestrconsts:lisisalreadypartoftheproject +msgid "%s is already part of the Project." +msgstr "%s jau yra projekte." -#: lazarusidestrconsts:liscontrolneedsparent -msgid "Control needs parent" -msgstr "Valdikliui reikia tėvo" +#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 +msgid "%s project directory" +msgstr "%s projekto katalogas" -#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro -msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "Klasė %s%s%s yra \"TControl\" tipo, todėl jos neis įdėti ne į valdiklį.%sĮdėti nepavyks." +#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject +msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" +msgstr "Projekto vardas %s%s%s yra klaidingas.%sNurodykite kitokį vardą (pvz.: projektas1.lpi)" -#: lazarusidestrconsts:lisconversionerror -msgid "Conversion error" -msgstr "Klaida konvertuojant" +#: lazarusidestrconsts:lissvuoisnotavalididentifier +msgid "%s%s%s is not a valid identifier." +msgstr "Identifikatorius %s%s%s klaidingas." -#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat -msgid "Unable to convert component text into binary format:%s%s" -msgstr "Nepavyko komponentės tekstą konvertuoti į dvejetainį formatą:%s%s" - -#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources -msgid "NOTE: Could not create Define Template for Lazarus Sources" -msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto Lazarus pirminiam kodui" - -#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction -msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." -msgstr "Klaidingas reiškinys.%sUžuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos, kuri yra tik viename faile.%sPažymėkite reiškinį ir bandykite vėl." - -#: lazarusidestrconsts:lisselectionexceedsstringconstant -msgid "Selection exceeds string constant" -msgstr "Pažymėta daugiau nei eilutės konstanta" - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 -msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." -msgstr "Užuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos.%sPažymėkite tik eilutės reiškinį ir bandykite vėl." - -#: lazarusidestrconsts:lisnoresourcestringsectionfound -msgid "No ResourceString Section found" -msgstr "Nerasta \"ResourceString\" sekcija" - -#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe -msgid "Unable to find a ResourceString section in this or any of the used units." -msgstr "Nepavyko rasti \"ResourceString\" sekcijos šiame ir kituose naudojamuose moduliuose" - -#: lazarusidestrconsts:liscomponentnameisnotavalididentifier -msgid "Component name %s%s%s is not a valid identifier" -msgstr "Komponento vardas %s%s%s nėra identifikatorius" - -#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe -msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" -msgstr "Vardai dubliuojasi: komponentas, vardu %s%s%s, jau yra paveldėtame komponente %s" - -#: lazarusidestrconsts:liscomponentnameiskeyword -msgid "Component name %s%s%s is keyword" -msgstr "Komponentės vardas %s%s%s kaip ir raktažodžio" - -#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus -msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "Jau pačio modulio vardas yra toks %s%s%s. Paskalio identifikatoriai turi būti unikalūs." - -#: lazarusidestrconsts:lisunabletorenamevariableinsource -msgid "Unable to rename variable in source." -msgstr "Nepavyko pirminiame kode pervardyti kintamąjį" - -#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource -msgid "Unable to update CreateForm statement in project source" -msgstr "Nepavyko projekto pirminiame kode atnaujinti sakinį \"CreateStatement\"" - -#: lazarusidestrconsts:listhereisalreadyaformwiththename -msgid "There is already a form with the name %s%s%s" -msgstr "Forma tokiu vardu %s%s%s jau yra" - -#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus -msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "Modulis tokiu vardu %s%s%s jau yra. Paskalio identifikatoriai turi būti unikalūs." - -#: lazarusidestrconsts:lisseemessages -msgid "See messages." -msgstr "Peržvelkit pranešimus." - -#: lazarusidestrconsts:liserror -msgid "Error: " -msgstr "Klaida:" - -#: lazarusidestrconsts:lissavechanges -msgid "Save changes?" -msgstr "Išsaugoti pakeitimus?" - -#: lazarusidestrconsts:lissavefilebeforeclosingform -msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "Išsaugoti failą %s%s%s%sprieš užveriant formą %s%s%s?" - -#: lazarusidestrconsts:lisunabletorenameforminsource -msgid "Unable to rename form in source." -msgstr "Nepavyko pirminiame kode pervardyti formą." - -#: lazarusidestrconsts:lissorrynotimplementedyet -msgid "Sorry, not implemented yet" -msgstr "Deja, dar neįgyvendinta" - -#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage -msgid "Unable to find method. Plz fix the error shown in the message window." -msgstr "Nepavyko rasti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." - -#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin -msgid "Unable to create new method. Plz fix the error shown in the message window." -msgstr "Nepavyko sukurti naują metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." - -#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage -msgid "Unable to show method. Plz fix the error shown in the message window." -msgstr "Nepavyko parodyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." - -#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag -msgid "Unable to rename method. Plz fix the error shown in the message window." -msgstr "Nepavyko pervardyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." - -#: lazarusidestrconsts:lisstopdebugging -msgid "Stop Debugging?" -msgstr "Nutraukti derinimą?" - -#: lazarusidestrconsts:lisstopthedebugging -msgid "Stop the debugging?" -msgstr "Nutraukti derinimą?" - -#: lazarusidestrconsts:liscannotfindlazarusstarter -msgid "Cannot find lazarus starter:%s%s" -msgstr "Nepavyko rasti Lazarus startuotoją:%s%s" - -#: lazarusidestrconsts:lisresourcefilecomment -msgid "This is an automatically generated lazarus resource file" -msgstr "Tai automatiškai sugeneruotas Lazarus resursų failas" - -#: lazarusidestrconsts:lisopenfile -msgid "Open file" -msgstr "Atverti failą" - -#: lazarusidestrconsts:lisiecoexportfileexists -msgid "Export file exists" -msgstr "Eksportuojamas failas egzistuoja" - -#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti -msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" -msgstr "Eksportuojamas failas %s%s%s jau yra.%sAtverti failą ir jame įrašyti tik kompiliatoriaus parinktis?%s(Kitos faile esančios nuostatos lik tokios pačios.)" - -#: lazarusidestrconsts:lisiecoopenorloadcompileroptions -msgid "Open or Load Compiler Options" -msgstr "Atverti arba įkelti kompiliatoriaus parinktis" - -#: lazarusidestrconsts:lisiecoerroraccessingxml -msgid "Error accessing xml" -msgstr "Klaida kreipiantis į XML" - -#: lazarusidestrconsts:lisiecoerrorloadingxml -msgid "Error loading xml" -msgstr "Klaida įkeliant XML" - -#: lazarusidestrconsts:lisiecoerrorloadingxmlfile -msgid "Error loading xml file %s%s%s:%s%s" -msgstr "Įvyko klaida įkeliant XML failą %s%s%s:%s%s" - -#: lazarusidestrconsts:lisiecoerroraccessingxmlfile -msgid "Error accessing xml file %s%s%s:%s%s" -msgstr "Įvyko klaida kreipiantis į XML falą %s%s%s:%s%s" - -#: lazarusidestrconsts:lisiecorecentfiles -msgid "Recent files" -msgstr "Paskutiniai naudoti" - -#: lazarusidestrconsts:lisiecosavetorecent -msgid "Save to recent" -msgstr "Išsaugoti paskutinį naudotame" - -#: lazarusidestrconsts:lisiecoopenrecent -msgid "Open recent" -msgstr "Atverti paskutinį naudotą" - -#: lazarusidestrconsts:lisiecosavetofile -msgid "Save to file" -msgstr "Išsaugoti faile" - -#: lazarusidestrconsts:lisiecoloadfromfile -msgid "Load from file" -msgstr "Įkelti iš failo" - -#: lazarusidestrconsts:lislazarusfile -msgid "Lazarus File" -msgstr "Lazarus failas" - -#: lazarusidestrconsts:lispascalunit -msgid "Pascal unit" -msgstr "Paskalio modulis" - -#: lazarusidestrconsts:lispascalsourcefile -msgid "Pascal source file" -msgstr "Paskalio pirminio kodo failas" - -#: lazarusidestrconsts:lisfreepascalsourcefile -msgid "FreePascal source file" -msgstr "FreePascal pirminio kodo failas" - -#: lazarusidestrconsts:lisdebugunabletoloadfile -msgid "Unable to load file" -msgstr "Nepavyko įkelti failą" - -#: lazarusidestrconsts:lisdebugunabletoloadfile2 -msgid "Unable to load file %s%s%s." -msgstr "Nepavyko įkelti failą %s%s%s." - -#: lazarusidestrconsts:lisopenprojectfile -msgid "Open Project File" -msgstr "Atverti projekto failą" - -#: lazarusidestrconsts:lislazarusprojectinfofile -msgid "Lazarus Project Info file" -msgstr "Lazarus projekto informacinis failas" - -#: lazarusidestrconsts:lisallfiles -msgid "All Files" -msgstr "Visi failai" - -#: lazarusidestrconsts:lisprojectclosed -msgid "Project closed" -msgstr "Projektas užvertas" - -#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin -msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically." -msgstr "Projektas užvertas. Šiuo atveju yra trys galimybės.%sUžuomina: jums nebūtina pačiam užverti projektą, tai padaroma automatiškai." - -#: lazarusidestrconsts:lisquitlazarus -msgid "Quit Lazarus" -msgstr "Baigti Lazarus darbą" - -#: lazarusidestrconsts:liscreatenewproject -msgid "Create new project" -msgstr "Kurti naują projektą" - -#: lazarusidestrconsts:lisopenpackagefile -msgid "Open Package File" -msgstr "Atverti paketo failą" - -#: lazarusidestrconsts:lissavespace -msgid "Save " -msgstr "Išsaugoti" - -#: lazarusidestrconsts:lisselectdfmfiles -msgid "Select Delphi form files (*.dfm)" -msgstr "Nurodykite Delphi formos failus (*.dfm)" - -#: lazarusidestrconsts:lischoosedirectory -msgid "Choose directory" -msgstr "Nurodykite katalogą" - -#: lazarusidestrconsts:lisdestinationdirectory -msgid "Destination directory" -msgstr "Paskirties katalogas" - -#: lazarusidestrconsts:liscommandafter -msgid "Command after" -msgstr "Komanda po" - -#: lazarusidestrconsts:lischooselazarussourcedirectory -msgid "Choose Lazarus Directory" -msgstr "Nurodykite Lazarus katalogą" - -#: lazarusidestrconsts:lischoosecompilerpath -msgid "Choose compiler filename (%s)" -msgstr "Nurorodykite kompiliatoriaus dailo vardą (%s)" - -#: lazarusidestrconsts:lischoosefpcsourcedir -msgid "Choose FPC source directory" -msgstr "Nurodykite FPC pirminio kodo katalogą" - -#: lazarusidestrconsts:lischoosemakepath -msgid "Choose make path" -msgstr "Nurodykite make kelią" - -#: lazarusidestrconsts:lischoosedebuggerpath -msgid "Choose debugger filename" -msgstr "Nurodykite derintuvės failo vardą" - -#: lazarusidestrconsts:lischoosetestbuilddir -msgid "Choose the directory for tests" -msgstr "Nurodykite katalogą testams" - -#: lazarusidestrconsts:lislazarusdesktopsettings -msgid "Lazarus Desktop Settings" -msgstr "Lazarus darbastalio nuostatos" - -#: lazarusidestrconsts:lisxmlfiles -msgid "XML files" -msgstr "XML failai" - -#: lazarusidestrconsts:lissavechangestoproject -msgid "Save changes to project %s?" -msgstr "Išsaugoti pakeitimus projekte %s?" - -#: lazarusidestrconsts:lisprojectchanged -msgid "Project changed" -msgstr "Projektas pakeistas" - -#: lazarusidestrconsts:lisfpcsourcedirectoryerror -msgid "FPC Source Directory error" -msgstr "FPC pirminio kodo katalogo klaida" - -#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory -msgid "Please check the freepascal source directory" -msgstr "Patikrinkite FreePascal pirminio kodo katalogą" - -#: lazarusidestrconsts:liscompilererror -msgid "Compiler error" -msgstr "Kompiliatoriaus klaida" - -#: lazarusidestrconsts:lisplzcheckthecompilername -msgid "Please check the compiler name" -msgstr "Patikrinkite kompiliatoriaus vardą" - -#: lazarusidestrconsts:lisaboutlazarus -msgid "About Lazarus" -msgstr "Apie Lazarus" - -#: lazarusidestrconsts:lisversion -msgid "Version" -msgstr "Versija" - -#: lazarusidestrconsts:lisdate -msgid "Date" -msgstr "Data" - -#: lazarusidestrconsts:lissvnrevision -msgid "SVN Revision: " -msgstr "SVN poversijis:" - -#: lazarusidestrconsts:lisclose -msgid "&Close" -msgstr "&Užverti" - -#: lazarusidestrconsts:lisaboutlazarusmsg -msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." -msgstr "Licenzija: GPL/LGPL%sLazarus yra IKA (integruota kūrimo aplinka), skirtas su FreePascal kurti (vizualinėms bei konsolės) programoms. FreePascal yra (L)GPL tipo paskalio ir objektinio paskalio kompiliatorius, jis dirba Linux, Windows, Mac OS X, FreeBSD ir kitose operacinėse sistemose.%sLazarus yra trūkstamoji galvosukio dalis, kuri jums leidžia visose paminėtose platformose kurti programas aplinkoje panašioje į Delphi. IKA yra GPK (greitas programų kūrimas) įrankis, kuriame yra formų konstruktorius.%sLazarus auga, todėl mums reikia daugiau kūrėjų." - -#: lazarusidestrconsts:lisaboutnocontributors -msgid "Cannot find contributors list." -msgstr "Nepavyko rasti talkininkų sąrašo" - -#: lazarusidestrconsts:lisunitnamealreadyexistscap -msgid "Unitname already in project" -msgstr "Modulio vardas jau paminėtas projekte" - -#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming -msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "Modulis %s%s%s jau egzistuoja.%sPaspaudus \"Ignoruoti\" bus pervadyjama,%spaspaudus \"Atsisakyti\" šis pirminis kodas nebus išsaugotas,%so paspaudus \"Nutraukti\" bus nutrauktas visas išsaugojimo procesas." - -#: lazarusidestrconsts:lisforcerenaming -msgid "Force renaming" -msgstr "Vistiek pervardyti" - -#: lazarusidestrconsts:liscancelrenaming -msgid "Cancel renaming" -msgstr "Atsisakyti pervardyjimo" - -#: lazarusidestrconsts:lisabortall -msgid "Abort all" -msgstr "Nutraukti viską" - -#: lazarusidestrconsts:lisinvalidpascalidentifiercap -msgid "Invalid Pascal Identifier" -msgstr "Klaidingas paskalio identifikatorius" - -#: lazarusidestrconsts:lisinvalidpascalidentifiertext -msgid "The name \"%s\" is not a valid pascal identifier." -msgstr "Vardas \"%s\" nėra paskalio identifikatorius." - -#: lazarusidestrconsts:liscopyerror -msgid "Copy Error" -msgstr "Klaida kopijuojant" - -#: lazarusidestrconsts:lishintopen -msgid "Open" -msgstr "Atverti" - -#: lazarusidestrconsts:lishintsave -msgid "Save" -msgstr "Išsaugoti" - -#: lazarusidestrconsts:lishintsaveall -msgid "Save all" -msgstr "Išsaugoti visus" - -#: lazarusidestrconsts:lishinttoggleformunit -msgid "Toggle Form/Unit" -msgstr "Rodyti formą arba modulį" - -#: lazarusidestrconsts:lishintviewunits -msgid "View Units" -msgstr "Rodyti modulius" - -#: lazarusidestrconsts:lishintviewforms -msgid "View Forms" -msgstr "Rodyti formas" - -#: lazarusidestrconsts:lishintrun -msgid "Run" -msgstr "Startuoti" - -#: lazarusidestrconsts:lishintpause -msgid "Pause" -msgstr "Pauzė" - -#: lazarusidestrconsts:lishintstepinto -msgid "Step Into" -msgstr "Žengti gilyn" - -#: lazarusidestrconsts:lishintstepover -msgid "Step Over" -msgstr "Žengti virš" - -#: lazarusidestrconsts:lisgplnotice -msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." - -#: lazarusidestrconsts:lislgplnotice -msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." - -#: lazarusidestrconsts:lismodifiedlgplnotice -msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." - -#: lazarusidestrconsts:dlgbaknosubdirectory -msgid "(no subdirectory)" -msgstr "(pakatalogio nėra)" - -#: lazarusidestrconsts:dlgsearchcaption -msgid "Searching..." -msgstr "Ieškoma..." - -#: lazarusidestrconsts:dlgsearchabort -msgid "Search terminated by user." -msgstr "Iešką nutraukė naudotojas." - -#: lazarusidestrconsts:lissmatches -msgid "Matches" -msgstr "Atitikmenys" - -#: lazarusidestrconsts:lisssearching -msgid "Searching" -msgstr "Ieškoma" - -#: lazarusidestrconsts:lisssearchtext -msgid "Search text" -msgstr "Teksto paieška" - -#: lazarusidestrconsts:dlgdesktop -msgid "Desktop" -msgstr "Darbastalis" - -#: lazarusidestrconsts:dlgwindows -msgid "Windows" -msgstr "Langai" - -#: lazarusidestrconsts:dlgfrmeditor -msgid "Form Editor" -msgstr "Formų konstruktorius" - -#: lazarusidestrconsts:dlgobjinsp -msgid "Object Inspector" -msgstr "Objektų inspektorius" - -#: lazarusidestrconsts:dlgenvfiles -msgid "Files" -msgstr "Failai" - -#: lazarusidestrconsts:lisignorebinaries -msgid "Ignore binaries" -msgstr "Praleisti dvejetainius failus" - -#: lazarusidestrconsts:lissimplesyntax -msgid "Simple Syntax" -msgstr "Paprasta sintaksė" - -#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta -msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" -msgstr "Įprastai filtre nurodomas reguliarusis reiškinys. Paprastojoje sintaksėje taškas \".\" įra įprastas simbolis, žvaigždė \"*\" atitinka betką, klaustukas \"?\" atitinka vieną kažkokį simbolį, kablelis arba kabliataškis atskiria alternatyvas. Pavyzdžiui: prasta sintaksė *.pas;*pp atitinka ^(.*\\.pas|.*\\.pp)$" - -#: lazarusidestrconsts:lisuseexcludefilter -msgid "Use Exclude Filter" -msgstr "Naudoti neįtraukimo filtrą" - -#: lazarusidestrconsts:lisexcludefilter -msgid "Exclude Filter" -msgstr "Neįtraukimo filtras" - -#: lazarusidestrconsts:lisprojectinformation -msgid "Project Information" -msgstr "Informacija apie projektą" - -#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles -msgid "Save editor info of non project files" -msgstr "Išsaugoti redaktoriaus informaciją apie projektui nepriklausančius failus" - -#: lazarusidestrconsts:lissaveinfoofclosededitorfiles -msgid "Save info of closed editor files" -msgstr "Išsaugoti informaciją apie užvertus redaktoriaus failus" - -#: lazarusidestrconsts:lisuseincludefilter -msgid "Use Include Filter" -msgstr "Naudoti įterpimo filtrą" - -#: lazarusidestrconsts:lisincludefilter -msgid "Include Filter" -msgstr "Įterpimo filtras" - -#: lazarusidestrconsts:dlgenvbckup -msgid "Backup" -msgstr "Atsarginė kopija" - -#: lazarusidestrconsts:dlgnaming -msgid "Naming" -msgstr "Vardų suteikimas" - -#: lazarusidestrconsts:lislazdoc -msgid "LazDoc" -msgstr "LazDoc" - -#: lazarusidestrconsts:lisokbtn -msgid "Ok" -msgstr "Tinka" - -#: lazarusidestrconsts:dlgcancel -msgid "Cancel" -msgstr "Atsisakyti" - -#: lazarusidestrconsts:liskmclassic -msgid "Classic" -msgstr "Klasikinis" - -#: lazarusidestrconsts:lispefilename -msgid "Filename:" -msgstr "Failo vardas:" - -#: lazarusidestrconsts:lispeunitname -msgid "Unitname:" -msgstr "Modulio vardas:" - -#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses -msgid "The unitname is used when the IDE extends uses clauses." -msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą." - -#: lazarusidestrconsts:lispetheunitnameisusedwhentheideextendsusesclauses -msgid "The unitname is used when the IDE extends uses clauses." -msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą." - -#: lazarusidestrconsts:lispeinvalidunitfilename -msgid "Invalid unit filename" -msgstr "Klaidingas modulio failo vardas" - -#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas -msgid "A pascal unit must have the extension .pp or .pas" -msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" - -#: lazarusidestrconsts:lispeapascalunitmusthavetheextensionpporpas -msgid "A pascal unit must have the extension .pp or .pas" -msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" - -#: lazarusidestrconsts:lispeinvalidunitname -msgid "Invalid unitname" -msgstr "Klaidingas modulio vardas" - -#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier -msgid "The unitname is not a valid pascal identifier." -msgstr "Modulio vardas nėra paskalio identifikatorius." - -#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni -msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" -msgstr "Modulio ir failo vardai nesutampa.%Pavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"." - -#: lazarusidestrconsts:lispetheunitnameisnotavalidpascalidentifier -msgid "The unitname is not a valid pascal identifier." -msgstr "Modulio vardas nėra paskalio identifikatorius." - -#: lazarusidestrconsts:lispeconflictfound -msgid "Conflict found" -msgstr "Aptiktas konfliktas" - -#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile -msgid "There is already an unit with this name.%sFile: %s" -msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s" - -#: lazarusidestrconsts:lispethereisalreadyanunitwiththisnamefile -msgid "There is already an unit with this name.%sFile: %s" -msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s" - -#: lazarusidestrconsts:lispeunitnameandfilenamedonotmatchexampleunit1pasanduni -msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" -msgstr "Modulio ir failo vardai nesutampa.%Pavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"." - -#: lazarusidestrconsts:lisok -msgid "&Ok" -msgstr "&Tinka" - -#: lazarusidestrconsts:liscmparameter -msgid "Parameter" -msgstr "Parametras" - -#: lazarusidestrconsts:lisctpleaseselectamacro -msgid "please select a macro" -msgstr "pažymėkite makrokomandą" - -#: lazarusidestrconsts:lisa2pcreatenewfile -msgid "Create new file" -msgstr "Kurti naują failą" - -#: lazarusidestrconsts:dlgenvlanguage -msgid "Language" -msgstr "Kalba" - -#: lazarusidestrconsts:dlgautosave -msgid "Auto save" -msgstr "Automatinis išsaugojimas" - -#: lazarusidestrconsts:dlgedfiles -msgid "Editor files" -msgstr "Redaktoriaus failai" - -#: lazarusidestrconsts:dlgenvproject -msgid "Project" -msgstr "Projektas" - -#: lazarusidestrconsts:liscodebrowser -msgid "Code browser" -msgstr "Kodo naršyklė" - -#: lazarusidestrconsts:dlgintvinsec -msgid "Interval in secs" -msgstr "Intervalas sekundėmis" - -#: lazarusidestrconsts:dlgdesktopfiles -msgid "Desktop files" -msgstr "Darbastalio failai" - -#: lazarusidestrconsts:dlgsavedfile -msgid "Save desktop settings to file" -msgstr "Įrašyti darbastalio nustatas faile" - -#: lazarusidestrconsts:dlgloaddfile -msgid "Load desktop settings from file" -msgstr "Įkelti darbastalio nuostatas iš failo" - -#: lazarusidestrconsts:dlgminimizeallonminimizemain -msgid "Minimize all on minimize main" -msgstr "Suskleidžiant pagrindinį suskleisti visus" - -#: lazarusidestrconsts:dlghideideonrun -msgid "Hide IDE windows on run" -msgstr "Startuojant programą slėpti IKA langus" - -#: lazarusidestrconsts:dlgpalhints -msgid "Hints for component palette" -msgstr "Sufleriai komponenčių paletei" - -#: lazarusidestrconsts:lischeckchangesondiskwithloading -msgid "Check changes on disk with loading" -msgstr "Įkeliant ieškoti pasikeitimų diske" - -#: lazarusidestrconsts:dlgspbhints -msgid "Hints for main speed buttons (open, save, ...)" -msgstr "Sufleriai pagrindiniams spartos mygtukams (\"Atverti\", \"Išsaugoti\", ...)" - -#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick -msgid "Double click on messages jumps (otherwise: single click)" -msgstr "Spustelėjus dukart ant pranešimo peršoks į pranešamą vietą (kitaip - vienąkart)" - -#: lazarusidestrconsts:dlgwinpos -msgid "Window Positions" -msgstr "Langų pozicijos" - -#: lazarusidestrconsts:dlgmainmenu -msgid "Main Menu" -msgstr "Pagrindinis meniu" - -#: lazarusidestrconsts:dlgsrcedit -msgid "Source Editor" -msgstr "Pirminio kodo redaktorius" - -#: lazarusidestrconsts:dlgmsgs -msgid "Messages" -msgstr "Pranešimai" - -#: lazarusidestrconsts:dlgprojfiles -msgid "Project files" -msgstr "Projekto failai" - -#: lazarusidestrconsts:dlgenvtype -msgid "Type" -msgstr "Tipas" - -#: lazarusidestrconsts:dlgenvnone -msgid "None" -msgstr "Joks" - -#: lazarusidestrconsts:dlgsmbfront -msgid "Symbol in front (.~pp)" -msgstr "Simbolis priekyje (.~pp)" - -#: lazarusidestrconsts:lisnobackupfiles -msgid "No backup files" -msgstr "Nedaryti atsarginių kopijų" - -#: lazarusidestrconsts:dlgsmbbehind -msgid "Symbol behind (.pp~)" -msgstr "Simbolis gale (.pp~)" - -#: lazarusidestrconsts:dlgsmbcounter -msgid "Counter (.pp;1)" -msgstr "Skaitliukas (.pp.1)" - -#: lazarusidestrconsts:dlgcustomext -msgid "User defined extension (.pp.xxx)" -msgstr "Naudotojo nurodytas prievardis (.pp.xxx)" - -#: lazarusidestrconsts:dlgbckupsubdir -msgid "Same name (in subdirectory)" -msgstr "Tokspat vardas (pakatalogyje)" - -#: lazarusidestrconsts:dlgedcustomext -msgid "User defined extension" -msgstr "Naudotojo nurodytas prievardis" - -#: lazarusidestrconsts:dlgmaxcntr -msgid "Maximum counter" -msgstr "Skaitliuko riba" - -#: lazarusidestrconsts:dlgedbsubdir -msgid "Sub directory" -msgstr "Pakatalogis" - -#: lazarusidestrconsts:dlgenvotherfiles -msgid "Other files" -msgstr "Kiti failai" - -#: lazarusidestrconsts:dlgmaxrecentfiles -msgid "Max recent files" -msgstr "Maksimalus atvertų failų sąrašo ilgis" - -#: lazarusidestrconsts:dlgmaxrecentprojs -msgid "Max recent project files" -msgstr "Maksimalus atvertų projektų sąrašo ilgis" - -#: lazarusidestrconsts:dlgqopenlastprj -msgid "Open last project at start" -msgstr "Startuojant atverti paskutinisyk atvertą projektą" - -#: lazarusidestrconsts:dlglazarusdir -msgid "Lazarus directory (default for all projects)" -msgstr "Lazarus katalogas (numatytas visiems projektams)" - -#: lazarusidestrconsts:dlgfpcpath -msgid "Compiler path (e.g. %s)" -msgstr "Kompiliatoriaus failas (pvz.: %s)" - -#: lazarusidestrconsts:dlgfpcsrcpath -msgid "FPC source directory" -msgstr "FPC pirminio kodo katalogas" - -#: lazarusidestrconsts:dlgmakepath -msgid "Make path" -msgstr "Programos make failas" - -#: lazarusidestrconsts:dlgdebugtype -msgid "Debugger type and path" -msgstr "Derintuvės tipas ir failas" - -#: lazarusidestrconsts:dlgtestprjdir -msgid "Directory for building test projects" -msgstr "Katalogas testo projektų darymui" - -#: lazarusidestrconsts:dlgqshowgrid -msgid "Show grid" -msgstr "Rodyti tinklelį" - -#: lazarusidestrconsts:dlgqshowborderspacing -msgid "Show border spacing" -msgstr "Rodyti rėmelio plotį" - -#: lazarusidestrconsts:dlggridcolor -msgid "Grid color" -msgstr "Tinklelio spalva" - -#: lazarusidestrconsts:dlgqsnaptogrid -msgid "Snap to grid" -msgstr "Pritraukti prie tinklelio taškų" - -#: lazarusidestrconsts:dlggridx -msgid "Grid size X" -msgstr "Tinklelio tarpai X" - -#: lazarusidestrconsts:dlggridxhint -msgid "Horizontal grid step size" -msgstr "Horizontalūs tarpai tarp tinklelio taškų" - -#: lazarusidestrconsts:dlggridy -msgid "Grid size Y" -msgstr "Tinklelio tarpai Y" - -#: lazarusidestrconsts:dlggridyhint -msgid "Vertical grid step size" -msgstr "Vertikalūs tarpai tarp tinklelio taškų" - -#: lazarusidestrconsts:dlgguidelines -msgid "Show Guide Lines" -msgstr "Rodyti pagalbines linijas" - -#: lazarusidestrconsts:dlgsnapguidelines -msgid "Snap to Guide Lines" -msgstr "Pritraukti prie pagalbinių linijų" - -#: lazarusidestrconsts:dlglefttopclr -msgid "color for left, top" -msgstr "Apatinės bei viršutinės spalva" - -#: lazarusidestrconsts:dlgrightbottomclr -msgid "color for right, bottom" -msgstr "Kairiosios bei dešiniosios spalva" - -#: lazarusidestrconsts:dlgshowcaps -msgid "Show component captions" -msgstr "Rodyti komponenčių antraštes" - -#: lazarusidestrconsts:dlgshowedrhints -msgid "Show editor hints" -msgstr "Redaktoriuje rodyti informacinius langelius" - -#: lazarusidestrconsts:dlgautoform -msgid "Auto create form when opening unit" -msgstr "Atveriant modulį formą sukurti automatiškai" - -#: lazarusidestrconsts:dlgrightclickselects -msgid "Right Click selects" -msgstr "Dešinysis pelės spustelėjimas pažymi" - -#: lazarusidestrconsts:dlggrabbercolor -msgid "Grabber color" -msgstr "Rankenėlės spalva" - -#: lazarusidestrconsts:dlgmarkercolor -msgid "Marker color" -msgstr "Žymeklio spalva" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidle -msgid "Reduce designer painting" -msgstr "Sumažinti paišymą konstruktoriuje" - -#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu -msgid "Paint designer items only on idle (reduce overhead for slow computers)" -msgstr "Piešti tik IKA esančius konstruktoriaus elementus (sumažina lėtų kompiuterių apkrovą)" - -#: lazarusidestrconsts:dlgenvgrid -msgid "Grid" -msgstr "Tinklelis" - -#: lazarusidestrconsts:dlgenvlguidelines -msgid "Guide lines" -msgstr "Pagalbinės linijos" - -#: lazarusidestrconsts:dlgenvmisc -msgid "Miscellaneous" -msgstr "Įvairūs" - -#: lazarusidestrconsts:dlgruberbandselectioncolor -msgid "Selection" -msgstr "Žymėjimas" - -#: lazarusidestrconsts:dlgruberbandcreationcolor -msgid "Creation" -msgstr "Kūrimas" - -#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds -msgid "Select grand childs" -msgstr "Žymėti provaikius" - -#: lazarusidestrconsts:dlgrubberbandgroup -msgid "Rubber band" -msgstr "Žymėjimo rėmelis" - -#: lazarusidestrconsts:dlgpasext -msgid "Default pascal extension" -msgstr "Numatytas paskalio prievardis" - -#: lazarusidestrconsts:dlgcharcasefileact -msgid "Save As - auto rename pascal files lower case" -msgstr "Išsaugant kitaip paskalio failus automatiškai pervardyti mažosiomis raidėmis" - -#: lazarusidestrconsts:dlgambigfileact -msgid "Ambiguous file action:" -msgstr "Esant neaiškiam failui:" - -#: lazarusidestrconsts:dlgenvask -msgid "Ask" -msgstr "Klausti" - -#: lazarusidestrconsts:dlgautodel -msgid "Auto delete file" -msgstr "Failą ištrinti automatiškai" - -#: lazarusidestrconsts:dlgautoren -msgid "Auto rename file lowercase" -msgstr "Failą automatiškai pervardyti mažosiomis raidėmis" - -#: lazarusidestrconsts:dlgnoautomaticrenaming -msgid "no automatic renaming" -msgstr "Automatiškai nepervardyti" - -#: lazarusidestrconsts:dlgambigwarn -msgid "Warn on compile" -msgstr "Perspėti prieš kompiliuojant" - -#: lazarusidestrconsts:dlgignoreverb -msgid "Ignore" -msgstr "Ignoruoti" - -#: lazarusidestrconsts:dlgbackcolor -msgid "Background" -msgstr "Fonas" - -#: lazarusidestrconsts:dlgsubpropkcolor -msgid "Subpropertes" -msgstr "Posavybės" - -#: lazarusidestrconsts:dlgreferencecolor -msgid "Reference" -msgstr "Paminėjimas" - -#: lazarusidestrconsts:dlgvaluecolor -msgid "Value" -msgstr "Reikšmė" - -#: lazarusidestrconsts:liswladd -msgid "&Add" -msgstr "Pri&dėti" - -#: lazarusidestrconsts:liswlproperties -msgid "&Properties" -msgstr "&Savybės" - -#: lazarusidestrconsts:liswlenabled -msgid "&Enabled" -msgstr "Į&galintas" - -#: lazarusidestrconsts:liswldelete -msgid "&Delete" -msgstr "&Pašalinti" - -#: lazarusidestrconsts:liswldisableall -msgid "D&isable All" -msgstr "Pasyv&inti visus" - -#: lazarusidestrconsts:liswlenableall -msgid "E&nable All" -msgstr "Įgali&nti visus" - -#: lazarusidestrconsts:liswldeleteall -msgid "De&lete All" -msgstr "Paša&linti visus" - -#: lazarusidestrconsts:dlgdefvaluecolor -msgid "Default value" -msgstr "Numatyta reikšmė" - -#: lazarusidestrconsts:dlgpropnamecolor -msgid "Property name" -msgstr "Savybės vardas" - -#: lazarusidestrconsts:dlgoimiscellaneous -msgid "Miscellaneous" -msgstr "Įvairūs" - -#: lazarusidestrconsts:dlgoiitemheight -msgid "Item height" -msgstr "Elemento aukštis" - -#: lazarusidestrconsts:lisshowhintsinobjectinspector -msgid "Show hints in Object Inspector" -msgstr "Rodyti informacinius langelius objektų inspektoriuje" - -#: lazarusidestrconsts:dlgenvcolors -msgid "Colors" -msgstr "Spalvos" - -#: lazarusidestrconsts:dlgenvbackuphelpnote -msgid "Notes: Project files are all files in the project directory" -msgstr "Pastaba: projekto failai - visi failai, esantys projekto kataloge" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename -msgid "Invalid compiler filename" -msgstr "Klaidingas kompiliatoriaus failas" - -#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg -msgid "The compiler file \"%s\" is not an executable." -msgstr "Kompiliatoriaus failas \"%s\" nėra paleidžiamasis." - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename -msgid "Invalid make filename" -msgstr "Klaidingas make failas" - -#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg -msgid "The make file \"%s\" is not an executable." -msgstr "Programos make failas \"%s\" nėra vykdomasis." - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename -msgid "Invalid debugger filename" -msgstr "Klaidingas derintuvės failas" - -#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg -msgid "The debugger file \"%s\" is not an executable." -msgstr "Derintuvės failas \"%s\" nėra paleidžiamasis." - -#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound -msgid "Directory not found" -msgstr "Katalogas nerastas" - -#: lazarusidestrconsts:lisinstallationfailed -msgid "Installation failed" -msgstr "Diegimas nepavyko" - -#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati -msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" -msgstr "Nepavyko kompiliuoti paketą %s%s%s .%sPašalinti jį iš diegimo sarašo?" - -#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg -msgid "Lazarus directory \"%s\" not found." -msgstr "Nerastas Lazarus katalogas \"%s\"." - -#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir -msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." -msgstr "Lazarus katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"lcl\", \"debugger\", \"designer\", \"components\", ... ." - -#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg -msgid "FPC source directory \"%s\" not found." -msgstr "Nerastas FPC pirminio kodo katalogas \"%s\"." - -#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir -msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." -msgstr "FPC pirminio kodo katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"rtl\", \"packages\", \"compiler\", ... ." - -#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg -msgid "Test directory \"%s\" not found." -msgstr "Nerastas testo katalogas \"%s\"." - -#: lazarusidestrconsts:dlgeddisplay -msgid "Display" -msgstr "Ekranas" - -#: lazarusidestrconsts:liseotabwidths -msgid "Tab widths" -msgstr "Tabuliatoriaus plotis" - -#: lazarusidestrconsts:dlgkeymapping -msgid "Key Mappings" -msgstr "Klavišų priskyrimai" - -#: lazarusidestrconsts:dlgedcolor -msgid "Color" -msgstr "Spalva" - -#: lazarusidestrconsts:dlgkeymappingerrors -msgid "Key mapping errors" -msgstr "Klavišų priskyrimų klaidos" - -#: lazarusidestrconsts:dlgedback -msgid "Back" -msgstr "Atgal" - -#: lazarusidestrconsts:dlgreport -msgid "Report" -msgstr "Ataskaita" - -#: lazarusidestrconsts:dlgednoerr -msgid "No errors in key mapping found." -msgstr "Klavišų priskyrimuose klaidų nerasta." - -#: lazarusidestrconsts:dlgdeltemplate -msgid "Delete template " -msgstr "Pašalinti šabloną" - -#: lazarusidestrconsts:dlgchscodetempl -msgid "Choose code template file (*.dci)" -msgstr "Rinkitės kodo šablono failą (*.dci)" - -#: lazarusidestrconsts:dlgallfiles -msgid "All files" -msgstr "Visi failai" - -#: lazarusidestrconsts:lissavefileas -msgid "Save file as" -msgstr "Išsaugoti failą kaip" - -#: lazarusidestrconsts:lisopenexistingfile -msgid "Open existing file" -msgstr "Atverti failą" - -#: lazarusidestrconsts:lislazarusunit -msgid "Lazarus unit" -msgstr "Lazarus modulis" - -#: lazarusidestrconsts:lislazarusinclude -msgid "Lazarus include file" -msgstr "Lazarus įdedamasis failas" - -#: lazarusidestrconsts:lislazarusproject -msgid "Lazarus project" -msgstr "Lazarus projektas" - -#: lazarusidestrconsts:lislazarusform -msgid "Lazarus form" -msgstr "Lazarus forma" - -#: lazarusidestrconsts:lislazaruspackage -msgid "Lazarus package" -msgstr "Lazarus paketas" - -#: lazarusidestrconsts:lislazarusprojectsource -msgid "Lazarus project source" -msgstr "Lazarus projekto pirminis kodas" - -#: lazarusidestrconsts:dlgaltsetclmode -msgid "Alt-Key sets column mode" -msgstr "Nuspaudus Alt klavišą - žymimi stulpeliai" - -#: lazarusidestrconsts:dlgalwaysvisiblecaret -msgid "Always visible caret" -msgstr "Žymeklis matomas nuolat" - -#: lazarusidestrconsts:dlgautoident -msgid "Auto indent" -msgstr "Automatinė įtrauka" - -#: lazarusidestrconsts:dlgbrachighlight -msgid "Bracket highlighting" -msgstr "Paryškinti porinius skliaustus" - -#: lazarusidestrconsts:dlgdragdroped -msgid "Drag Drop editing" -msgstr "Redaguojant tekstą galima nuvilkti" - -#: lazarusidestrconsts:dlgdropfiles -msgid "Drop files" -msgstr "Failus galima nuvilkti" - -#: lazarusidestrconsts:dlggroupundo -msgid "Group Undo" -msgstr "Grupinis grąžinimas" - -#: lazarusidestrconsts:dlghalfpagescroll -msgid "Half page scroll" -msgstr "Slikti tik per puse lapo" - -#: lazarusidestrconsts:dlgkeepcaretx -msgid "Keep caret X position" -msgstr "Išlaikyti žymeklio X poziciją" - -#: lazarusidestrconsts:dlgpersistentcaret -msgid "Persistent caret" -msgstr "Nuolatinis žymeklis" - -#: lazarusidestrconsts:dlgcaretskipsselection -msgid "Caret skips selection" -msgstr "Nuo žymėjimo atitrūkstantis žymeklis" - -#: lazarusidestrconsts:dlgrightmousemovescursor -msgid "Right mouse moves caret" -msgstr "Spragtelėjus dešinį pelės mygtuką perkeliamas žymeklis" - -#: lazarusidestrconsts:dlgscrollbyoneless -msgid "Scroll by one less" -msgstr "Slenkant per lapą slinkti viena eilute mažiau" - -#: lazarusidestrconsts:dlgscrollpastendfile -msgid "Scroll past end of file" -msgstr "Failo pabaiga nesustabdo slinkties" - -#: lazarusidestrconsts:dlgscrollpastendline -msgid "Scroll past end of line" -msgstr "Eilutės pabaiga nesustabdo slinkties" - -#: lazarusidestrconsts:dlgclosebuttonsnotebook -msgid "Show close buttons in notebook" -msgstr "Redaktoriaus kortelėse rodyti \"Užverti\" mygtukus" - -#: lazarusidestrconsts:dlgshowscrollhint -msgid "Show scroll hint" -msgstr "Slenkant rodyti informacinį langelį" - -#: lazarusidestrconsts:dlgmouselinks -msgid "Mouse links" -msgstr "Aktyvuoti saitą su Ctrl ir pele" - -#: lazarusidestrconsts:dlgshowgutterhints -msgid "Show gutter hints" -msgstr "Rodyti kairiosios paraštės informacinius langelius" - -#: lazarusidestrconsts:dlgsmarttabs -msgid "Smart tabs" -msgstr "Gudrus tabuliatorius" - -#: lazarusidestrconsts:dlgtabstospaces -msgid "Tabs to spaces" -msgstr "Vietoj tabuliatoriaus - tarpo simboliai" - -#: lazarusidestrconsts:dlgtabindent -msgid "Tab indents blocks" -msgstr "Tabuliatorius įtraukia blokus" - -#: lazarusidestrconsts:dlgtrimtrailingspaces -msgid "Trim trailing spaces" -msgstr "Eilučių galuose pašalinti tarpo simbolius" - -#: lazarusidestrconsts:dlgundoaftersave -msgid "Undo after save" -msgstr "Išsaugojus grąžinimas neišvalomas" - -#: lazarusidestrconsts:dlgdoubleclickline -msgid "Double click line" -msgstr "Spragtelėjus dukart pažymima visa eilutė" - -#: lazarusidestrconsts:dlgfindtextatcursor -msgid "Find text at cursor" -msgstr "Ieškoti ties žymekliu esančio teksto" - -#: lazarusidestrconsts:dlgusesyntaxhighlight -msgid "Use syntax highlight" -msgstr "Paryškinti sintaksę" - -#: lazarusidestrconsts:dlgusecodefolding -msgid "Code folding" -msgstr "Kodo suvėrimas" - -#: lazarusidestrconsts:dlgcopywordatcursoroncopynone -msgid "Copy word on copy none" -msgstr "Kai kopijuojant nieks nepažymėta- kopijuoti žodį" - -#: lazarusidestrconsts:dlghomekeyjumpstoneareststart -msgid "Home key jumps to nearest start" -msgstr "Spustelėjus \"Home\", žymeklis peršoks į artimiausią pradžią" - -#: lazarusidestrconsts:dlgblockindent -msgid "Block indent" -msgstr "Blokų įtrauka" - -#: lazarusidestrconsts:dlgundolimit -msgid "Undo limit" -msgstr "Grąžinimų riba" - -#: lazarusidestrconsts:dlgtabwidths -msgid "Tab widths" -msgstr "Tabuliatoriaus ilgis" - -#: lazarusidestrconsts:dlgmargingutter -msgid "Margin and gutter" -msgstr "Paraštės" - -#: lazarusidestrconsts:dlgvisiblerightmargin -msgid "Visible right margin" -msgstr "Dešinioji paraštė matoma" - -#: lazarusidestrconsts:dlgvisiblegutter -msgid "Visible gutter" -msgstr "Kairioji paraštė matoma" - -#: lazarusidestrconsts:dlgshowlinenumbers -msgid "Show line numbers" -msgstr "Rodyti eilučių numerius" - -#: lazarusidestrconsts:dlgshowcompilinglinenumbers -msgid "Show line numbers" -msgstr "Rodyti eilučių numerius" - -#: lazarusidestrconsts:dlgrightmargin -msgid "Right margin" -msgstr "Dešinioji paraštė" - -#: lazarusidestrconsts:dlgrightmargincolor -msgid "Right margin color" -msgstr "Dešiniosios paraštės spalva" - -#: lazarusidestrconsts:dlggutterwidth -msgid "Gutter width" -msgstr "Kairiosios paraštės plotis" - -#: lazarusidestrconsts:dlgguttercolor -msgid "Gutter color" -msgstr "Kairiosios paraštės spalva" - -#: lazarusidestrconsts:dlgeditorfont -msgid "Editor font" -msgstr "Redaktoriaus šriftas" - -#: lazarusidestrconsts:dlgdefaulteditorfont -msgid "Default editor font" -msgstr "Numatytas redaktoriaus šriftas" - -#: lazarusidestrconsts:dlgeditorfontheight -msgid "Editor font height" -msgstr "Redaktoriaus šrifto dydis" - -#: lazarusidestrconsts:dlgextralinespacing -msgid "Extra line spacing" -msgstr "Papildomas tarpas tarp eilučių" - -#: lazarusidestrconsts:dlgkeymappingscheme -msgid "Key Mapping Scheme" -msgstr "Klavišų priskyrimo schema" - -#: lazarusidestrconsts:dlgcheckconsistency -msgid "Check consistency" -msgstr "Tikrinti darną" - -#: lazarusidestrconsts:lisedoptschoosescheme -msgid "Choose Scheme" -msgstr "Rinkitės derinį" - -#: lazarusidestrconsts:dlgedhintcommand -msgid "Hint: click on the command you want to edit" -msgstr "Užuomina: spustelkite kairį pelės mygtuką ant komandos, kurią norite keisti" - -#: lazarusidestrconsts:dlglang -msgid "Language" -msgstr "Kalba" - -#: lazarusidestrconsts:dlgclrscheme -msgid "Color Scheme" -msgstr "Spalvų derinys" - -#: lazarusidestrconsts:dlgfileexts -msgid "File extensions" -msgstr "Failų prievardžiai" - -#: lazarusidestrconsts:dlgedelement -msgid "Element" -msgstr "Elementas" - -#: lazarusidestrconsts:dlgsetelementdefault -msgid "Set element to default" -msgstr "Priskirti numatytą reikšmę" - -#: lazarusidestrconsts:dlgsetallelementdefault -msgid "Set all elements to default" -msgstr "Visiems priskirti numatytą reikšmę" - -#: lazarusidestrconsts:dlgforecolor -msgid "Foreground color" -msgstr "Priekinė spalva" - -#: lazarusidestrconsts:dlgedusedefcolor -msgid "Use default color" -msgstr "Naudoti numatytą spalvą" - -#: lazarusidestrconsts:dlgtextattributes -msgid "Text attributes" -msgstr "Teksto atributai" - -#: lazarusidestrconsts:dlgedbold -msgid "Bold" -msgstr "Pusjuodis" - -#: lazarusidestrconsts:dlgedital -msgid "Italic" -msgstr "Kursyvas" - -#: lazarusidestrconsts:dlgedunder -msgid "Underline" -msgstr "Pabraukimas" - -#: lazarusidestrconsts:dlgedidcomlet -msgid "Identifier completion" -msgstr "Identifikatoriaus užbaigimas" - -#: lazarusidestrconsts:dlgedcodeparams -msgid "Code parameters" -msgstr "Kodo parametrai" - -#: lazarusidestrconsts:dlgtooltipeval -msgid "Tooltip expression evaluation" -msgstr "Reiškinio įverčio informacinis langelis" - -#: lazarusidestrconsts:dlgtooltiptools -msgid "Tooltip symbol Tools" -msgstr "Simbolio įrankių informacinis langelis" - -#: lazarusidestrconsts:dlgeddelay -msgid "Delay" -msgstr "Delsa" - -#: lazarusidestrconsts:dlgtimesecondunit -msgid "sec" -msgstr "s." - -#: lazarusidestrconsts:dlgedcodetempl -msgid "Code templates" -msgstr "Kodo šablonai" - -#: lazarusidestrconsts:dlgtplfname -msgid "Template file name" -msgstr "Šablono failo vardas" - -#: lazarusidestrconsts:dlgedadd -msgid "Add..." -msgstr "Pridėti..." - -#: lazarusidestrconsts:dlgededit -msgid "Edit..." -msgstr "Keisti..." - -#: lazarusidestrconsts:dlgeddelete -msgid "Delete" -msgstr "Pašalinti" - -#: lazarusidestrconsts:dlgindentcodeto -msgid "Indent code to" -msgstr "Įtraukti kodą pagal" - -#: lazarusidestrconsts:dlgcodetoolstab -msgid "Code Tools" -msgstr "Kodo pagalbininkai" - -#: lazarusidestrconsts:lisautomaticfeatures -msgid "Automatic features" -msgstr "Automatinės ypatybės" - -#: lazarusidestrconsts:dlgcfdividerdrawlevel -msgid "Divider Draw Level" -msgstr "Skirtuko rodymo lygis" - -#: lazarusidestrconsts:dlgcodetoolsopts -msgid "CodeTools Options" -msgstr "CodeTools parinktys" - -#: lazarusidestrconsts:dlgcodecreation -msgid "Code Creation" -msgstr "Kodo kūrimas" - -#: lazarusidestrconsts:dlgwordspolicies -msgid "Words" -msgstr "Žodžiai" - -#: lazarusidestrconsts:dlglinesplitting -msgid "Line Splitting" -msgstr "Eilučių laužymas" - -#: lazarusidestrconsts:dlgspacenotcosmos -msgid "Space" -msgstr "Tarpo simbolis" - -#: lazarusidestrconsts:dlgidentifiercompletion -msgid "Identifier completion" -msgstr "Identifikatoriaus užbaigimas" - -#: lazarusidestrconsts:dlgadditionalsrcpath -msgid "Additional Source search path for all projects (.pp;.pas)" -msgstr "Papildomi visų projektų keliai iki pirminio kodo" - -#: lazarusidestrconsts:dlgjumpingetc -msgid "Jumping (e.g. Method Jumping)" -msgstr "Šokinėjimas (pvz. tarp metodų)" - -#: lazarusidestrconsts:dlgadjusttopline -msgid "Adjust top line due to comment in front" -msgstr "Turi matytis ir komentaras" - -#: lazarusidestrconsts:dlgcentercursorline -msgid "Center Cursor Line" -msgstr "Žymeklis ekrano centre" - -#: lazarusidestrconsts:dlgcursorbeyondeol -msgid "Cursor beyond EOL" -msgstr "Žymeklis peržengia EOL" - -#: lazarusidestrconsts:dlgclassinsertpolicy -msgid "Class part insert policy" -msgstr "Klasės dalies įterpimo politika" - -#: lazarusidestrconsts:dlgalphabetically -msgid "Alphabetically" -msgstr "Pagal abėcėlę" - -#: lazarusidestrconsts:dlgcdtlast -msgid "Last" -msgstr "Gale" - -#: lazarusidestrconsts:dlgmixmethodsandproperties -msgid "Mix methods and properties" -msgstr "Maišyti metodus su savybėm" - -#: lazarusidestrconsts:dlgforwardprocsinsertpolicy -msgid "Procedure insert policy" -msgstr "Procedūros įterpimo politika" - -#: lazarusidestrconsts:dlglast -msgid "Last (i.e. at end of source)" -msgstr "Pačiame gale" - -#: lazarusidestrconsts:dlginfrontofmethods -msgid "In front of methods" -msgstr "Priešais metodus" - -#: lazarusidestrconsts:dlgbehindmethods -msgid "Behind methods" -msgstr "Po metodų" - -#: lazarusidestrconsts:dlgforwardprocskeeporder -msgid "Keep order of procedures" -msgstr "Išlaikyti procedūrų eilę" - -#: lazarusidestrconsts:dlgmethodinspolicy -msgid "Method insert policy" -msgstr "Metodo įterpimo policija" - -#: lazarusidestrconsts:dlgcdtclassorder -msgid "Class order" -msgstr "Klasės eilė" - -#: lazarusidestrconsts:dlgkeywordpolicy -msgid "Keyword policy" -msgstr "Raktažodžio politika" - -#: lazarusidestrconsts:dlgcdtlower -msgid "lowercase" -msgstr "Mažosiomis raidėmis" - -#: lazarusidestrconsts:dlgcdtuppercase -msgid "UPPERCASE" -msgstr "Didžiosiomis raidėmis" - -#: lazarusidestrconsts:dlg1up2low -msgid "Lowercase, first letter up" -msgstr "Mažosiomis raidėmis, pirmoji - didžioji" - -#: lazarusidestrconsts:dlgidentifierpolicy -msgid "Identifier policy" -msgstr "Identifikatoriaus politika" - -#: lazarusidestrconsts:dlgpropertycompletion -msgid "Property completion" -msgstr "\"Property\" užbaigimas" - -#: lazarusidestrconsts:lisheadercommentforclass -msgid "Header comment for class" -msgstr "Antraštinis komentaras klasei" - -#: lazarusidestrconsts:dlgcompleteproperties -msgid "Complete properties" -msgstr "Užbaigti savybes" - -#: lazarusidestrconsts:dlgcdtreadprefix -msgid "Read prefix" -msgstr "\"Read\" prefiksas" - -#: lazarusidestrconsts:dlgcdtwriteprefix -msgid "Write prefix" -msgstr "\"Write\" prefiksas" - -#: lazarusidestrconsts:dlgcdtstoredpostfix -msgid "Stored postfix" -msgstr "\"Stored\" postfiksas" - -#: lazarusidestrconsts:dlgcdtvariableprefix -msgid "Variable prefix" -msgstr "Kintamojo prefiksas" - -#: lazarusidestrconsts:dlgsetpropertyvariable -msgid "Set property Variable" -msgstr "\"Set\" kintamojo vardas" - -#: lazarusidestrconsts:dlgmaxlinelength -msgid "Max line length:" -msgstr "Maksimalus eilutės ilgis:" - -#: lazarusidestrconsts:dlgnotsplitlinefront -msgid "Do not split line In front of:" -msgstr "Nelaužti eilutės priešais:" - -#: lazarusidestrconsts:dlgnotsplitlineafter -msgid "Do not split line after:" -msgstr "Nelaužti eilutės po:" - -#: lazarusidestrconsts:dlgcdtpreview -msgid "Preview (Max line length = 1)" -msgstr "Peržiūra (maksimalus eilutės ilgis - 1)" - -#: lazarusidestrconsts:dlginsspacefront -msgid "Insert space in front of" -msgstr "Įterpti tarpą priešais" - -#: lazarusidestrconsts:dlginsspaceafter -msgid "Insert space after" -msgstr "Iterpti tarpą po" - -#: lazarusidestrconsts:dlgwrdpreview -msgid "Preview" -msgstr "Peržiūra" - -#: lazarusidestrconsts:dlgaddsemicolon -msgid "Add semicolon" -msgstr "Pridėti kabliataškį" - -#: lazarusidestrconsts:locwndsrceditor -msgid "Lazarus Source Editor" -msgstr "Lazarus pirminio kodo redaktorius" - -#: lazarusidestrconsts:dlgcompileroptions -msgid "Compiler Options" -msgstr "Kompiliatoriaus parinktys" - -#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented -msgid "Online Help not yet implemented" -msgstr "Kontekstinis žinynas dar neįgyvendintas" - -#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav -msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "Spustelėje dešinį pelės mygtuką ant medžio elemento iššoks meniu su visomis galimomis paketo funkcijomis." - -#: lazarusidestrconsts:dlgsearchpaths -msgid "Paths" -msgstr "Keliai" - -#: lazarusidestrconsts:dlgcoparsing -msgid "Parsing" -msgstr "Analizė" - -#: lazarusidestrconsts:dlgcodegeneration -msgid "Code" -msgstr "Kodas" - -#: lazarusidestrconsts:dlgcolinking -msgid "Linking" -msgstr "Saistymas" - -#: lazarusidestrconsts:dlgcomessages -msgid "Messages" -msgstr "Pranešimai" - -#: lazarusidestrconsts:dlgcoother -msgid "Other" -msgstr "Kiti" - -#: lazarusidestrconsts:dlgcoinherited -msgid "Inherited" -msgstr "Paveldėta" - -#: lazarusidestrconsts:dlgcocompilation -msgid "Compilation" -msgstr "Kompiliacija" - -#: lazarusidestrconsts:lisbrowseforcompiler -msgid "Browse for Compiler (%s)" -msgstr "Nurodyti kompiliatorių (%s)" - -#: lazarusidestrconsts:lisunitoutputdirectory -msgid "Unit Output directory" -msgstr "Modulio išvesties katalogas" - -#: lazarusidestrconsts:lisselectanode -msgid "Select a node" -msgstr "Pažymėkit mazgą" - -#: lazarusidestrconsts:dlgshowcompileroptions -msgid "Show compiler options" -msgstr "Rodyti kompiliatoriaus parinktis" - -#: lazarusidestrconsts:dlgcoopts -msgid "Options: " -msgstr "Parinktys: " - -#: lazarusidestrconsts:dlgcostyle -msgid "Style:" -msgstr "Stilius:" - -#: lazarusidestrconsts:lisnocompileroptionsinherited -msgid "No compiler options inherited." -msgstr "Nėra paveldėtų kompiliatoriaus parinkčių." - -#: lazarusidestrconsts:lisunitpath -msgid "unit path" -msgstr "kelias iki modulio" - -#: lazarusidestrconsts:lisincludepath -msgid "include path" -msgstr "kelias iki įterpinių" - -#: lazarusidestrconsts:lisobjectpath -msgid "object path" -msgstr "kelias iki objekto" - -#: lazarusidestrconsts:lislibrarypath -msgid "library path" -msgstr "kelias iki bibliotekos" - -#: lazarusidestrconsts:lislinkeroptions -msgid "linker options" -msgstr "saistyklės parinktys" - -#: lazarusidestrconsts:liscustomoptions -msgid "custom options" -msgstr "naudotojo parinktys" - -#: lazarusidestrconsts:dlgcoasis -msgid "As-Is" -msgstr "Kaip yra" - -#: lazarusidestrconsts:dlgsyntaxoptions -msgid "Syntax options" -msgstr "Sintaksės parinktys" - -#: lazarusidestrconsts:dlgdelphi2ext -msgid "Delphi 2 Extensions" -msgstr "Delphi 2 plėtiniai" - -#: lazarusidestrconsts:dlgcocops -msgid "C Style Operators (*=, +=, /= and -=)" -msgstr "C stiliaus operatoriai (*=, +=, /= bei -=)" - -#: lazarusidestrconsts:dlgassertcode -msgid "Include Assertion Code" -msgstr "Įterpti \"Assertion\" kodą" - -#: lazarusidestrconsts:dlglabelgoto -msgid "Allow LABEL and GOTO" -msgstr "Galimi LABEL ir GOTO" - -#: lazarusidestrconsts:dlgcppinline -msgid "C++ Styled INLINE" -msgstr "C stiliaus INLINE" - -#: lazarusidestrconsts:dlgcmacro -msgid "C Style Macros (global)" -msgstr "C stiliaus makrokomandos (globaliai)" - -#: lazarusidestrconsts:dlgbp7cptb -msgid "TP/BP 7.0 Compatible" -msgstr "Suderinamumas su TP/BP 7.0" - -#: lazarusidestrconsts:dlginitdoneonly -msgid "Constructor name must be 'init' (destructor must be 'done')" -msgstr "Konstruktoriaus vardas turi būti \"init\" (destruktoriaus - \"done\")" - -#: lazarusidestrconsts:dlgstatickeyword -msgid "Static Keyword in Objects" -msgstr "Objektuose statiniai raktažodžiai" - -#: lazarusidestrconsts:dlgdeplhicomp -msgid "Delphi Compatible" -msgstr "Suderinamumas su Delphi" - -#: lazarusidestrconsts:dlgcoansistr -msgid "Use Ansi Strings" -msgstr "Naudoti ANSI eilutes" - -#: lazarusidestrconsts:dlggpccomp -msgid "GPC (GNU Pascal Compiler) Compatible" -msgstr "Suderinamumas su GPC (GNU Pascal Compiler)" - -#: lazarusidestrconsts:dlgcounitstyle -msgid "Unit Style:" -msgstr "Modulio stilius:" - -#: lazarusidestrconsts:dlgcosmartlinkable -msgid "Smart Linkable" -msgstr "Saistoma sumaniai" - -#: lazarusidestrconsts:dlgcochecks -msgid "Checks:" -msgstr "Tikrinti:" - -#: lazarusidestrconsts:dlgcorange -msgid "Range" -msgstr "Rėžį" - -#: lazarusidestrconsts:dlgcooverflow -msgid "Overflow" -msgstr "Perpildymą" - -#: lazarusidestrconsts:dlgcostack -msgid "Stack" -msgstr "Dėklą" - -#: lazarusidestrconsts:dlgheapsize -msgid "Heap Size" -msgstr "Krūvos dydį" - -#: lazarusidestrconsts:dlgcogenerate -msgid "Generate:" -msgstr "Generuoti:" - -#: lazarusidestrconsts:dlgconormal -msgid "Normal Code" -msgstr "Normalų kodą" - -#: lazarusidestrconsts:dlgcofast -msgid "Faster Code" -msgstr "Greitesnį kodą" - -#: lazarusidestrconsts:dlgcosmaller -msgid "Smaller Code" -msgstr "Mažesnį kodą" - -#: lazarusidestrconsts:dlgtargetproc -msgid "Target i386" -msgstr "Paskirtis i386" - -#: lazarusidestrconsts:dlgtargetplatform -msgid "Target Platform:" -msgstr "Paskirties platforma:" - -#: lazarusidestrconsts:dlgoptimiz -msgid "Optimizations:" -msgstr "Optimizacija:" - -#: lazarusidestrconsts:dlgcokeepvarsreg -msgid "Keep certain variables in registers" -msgstr "Registre laikyti dažniausiai naudojamus kintamuosius" - -#: lazarusidestrconsts:dlguncertopt -msgid "Uncertain Optimizations" -msgstr "Neužtikrinta optimizacija" - -#: lazarusidestrconsts:dlglevelnoneopt -msgid "Level 0 (no extra Optimizations)" -msgstr "0 lygis (optimizacijos nėra)" - -#: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (quick and debugger friendly)" -msgstr "1 lygis (įprastų instrukcijų sekos keičiamos greitesniais ekvivalentais)" - -#: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + quick optimizations)" -msgstr "2 lygis (1 lygis + registro duomenų bereikalingų pakartotinų įkėlimų eliminavimas)" - -#: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + slow optimizations)" -msgstr "3 lygis (2 lygis +kitos laiką ryjančios optimizacijos)" - -#: lazarusidestrconsts:dlgtargetos -msgid "Target OS" -msgstr "Paskirties OS" - -#: lazarusidestrconsts:dlgtargetcpu -msgid "Target CPU" -msgstr "Paskirties procesorius:" - -#: lazarusidestrconsts:dlgcodebugging -msgid "Debugging:" -msgstr "Derinimas:" - -#: lazarusidestrconsts:dlgcogdb -msgid "Generate Debugging Info For GDB (Slows Compiling)" -msgstr "Kurti \"GDB\" skirtą derinimo informaciją (sulėtins kompiliavimą)" - -#: lazarusidestrconsts:dlgcodbx -msgid "Generate Debugging Info For DBX (Slows Compiling)" -msgstr "Kurti \"DBX\" skirtą derinimo informaciją (sulėtins kompiliavimą)" - -#: lazarusidestrconsts:dlglnumsbct -msgid "Display Line Numbers in Run-time Error Backtraces" -msgstr "Rodyti eilučių numerius veikos metu įvykusių klaidų pėdsako pranešimuose" - -#: lazarusidestrconsts:dlgcoheaptrc -msgid "Use Heaptrc Unit" -msgstr "Naudoti \"Heaptrc\" modulį" - -#: lazarusidestrconsts:dlgcovalgrind -msgid "Generate code for valgrind" -msgstr "Kurti \"valgrind\" skirtą kodą" - -#: lazarusidestrconsts:dlggprof -msgid "Generate code for gprof" -msgstr "Kurti \"gprof\" skirtą kodą" - -#: lazarusidestrconsts:dlgcostrip -msgid "Strip Symbols From Executable" -msgstr "Pašalinti simbolius iš vykdomojo failo" - -#: lazarusidestrconsts:dlglinklibraries -msgid "Link Style:" -msgstr "Saistymo stilius:" - -#: lazarusidestrconsts:dlglinksmart -msgid "Link Smart" -msgstr "Saistyti sumaniai" - -#: lazarusidestrconsts:dlgpassoptslinker -msgid "Pass Options To The Linker (Delimiter is space)" -msgstr "Perduoti parinktis saistyklei (atskirta kabliataškiais)" - -#: lazarusidestrconsts:liscotargetosspecificoptions -msgid "Target OS specific options" -msgstr "Paskirties OS specifinės parinktys" - -#: lazarusidestrconsts:dlgverbosity -msgid "Verbosity during compilation:" -msgstr "Pranešimų gausa kompiliuojant:" - -#: lazarusidestrconsts:dlgcoshowerr -msgid "Show Errors" -msgstr "Rodyti klaidas" - -#: lazarusidestrconsts:dlgshowwarnings -msgid "Show Warnings" -msgstr "Rodyti perspėjimus" - -#: lazarusidestrconsts:dlgshownotes -msgid "Show Notes" -msgstr "Rodyti pastabas" - -#: lazarusidestrconsts:dlgshowhint -msgid "Show Hints" -msgstr "Rodyti užuominas" - -#: lazarusidestrconsts:dlgshowgeneralinfo -msgid "Show general info" -msgstr "Rodyti pagrindinę informaciją" - -#: lazarusidestrconsts:dlgshowprocserror -msgid "Show all procs on error" -msgstr "Įvykus klaidai rodyti visus procedūrų paskelbimus" - -#: lazarusidestrconsts:dlgshoweverything -msgid "Show everything" -msgstr "Rodyti viską" - -#: lazarusidestrconsts:dlgshowsummary -msgid "Show summary" -msgstr "Rodyti apibendrinimą" - -#: lazarusidestrconsts:dlgshowdebuginfo -msgid "Show debug info" -msgstr "Rodyti derinimo informaciją" - -#: lazarusidestrconsts:dlgshowusedfiles -msgid "Show used files" -msgstr "Rodyti naudojamus failus" - -#: lazarusidestrconsts:dlgshowtriedfiles -msgid "Show tried files" -msgstr "Rodyti apibrėžtas makrokomandas" - -#: lazarusidestrconsts:dlgshowdefinedmacros -msgid "Show defined macros" -msgstr "Rodyti " - -#: lazarusidestrconsts:dlgshowcompiledprocedures -msgid "Show compiled procedures" -msgstr "Rodyti kompiliuotas procedūras" - -#: lazarusidestrconsts:dlgshowconditionals -msgid "Show conditionals" -msgstr "Rodyti sąlygines instrukcijas" - -#: lazarusidestrconsts:dlgshowexecutableinfo -msgid "Show executable info (Win32 only)" -msgstr "Rodyti vykdomosios bylos informaciją (tik Win32)" - -#: lazarusidestrconsts:dlgshownothing -msgid "Show nothing (only errors)" -msgstr "Slėpti viską (išskyrus klaidas)" - -#: lazarusidestrconsts:dlgwritefpclogo -msgid "Write an FPC logo" -msgstr "Įrašyti FPC logotipą" - -#: lazarusidestrconsts:dlghintsunused -msgid "Show Hints for unused units in main source" -msgstr "Rodyti užuominas apie pagrindiniame pirminiame kode nenaudojamus modulius" - -#: lazarusidestrconsts:dlghintsparametersendernotused -msgid "Show Hints for parameter \"Sender\" not used" -msgstr "Rodyti užuominas apie nenaudojamus \"Sender\" parametrus" - -#: lazarusidestrconsts:dlgconfigfiles -msgid "Config Files:" -msgstr "Nustatymų failai:" - -#: lazarusidestrconsts:dlgusefpccfg -msgid "Use standard Compiler Config File (fpc.cfg)" -msgstr "Naudoti standartinį kompiliatoriaus nustatymų failą (fpc.cfg)" - -#: lazarusidestrconsts:dlgusecustomconfig -msgid "Use addional Compiler Config File" -msgstr "Naudoti papildomą kompiliatoriaus nustatymų failą" - -#: lazarusidestrconsts:liscustomoptions2 -msgid "Custom options" -msgstr "Naudotojo parinktys" - -#: lazarusidestrconsts:dlgstopafternrerr -msgid "Stop after number of errors:" -msgstr "Po kelių klaidų sustoti:" - -#: lazarusidestrconsts:dlgotherunitfiles -msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" -msgstr "Kitų modulių failai (-Fu) (atskirti kabliataškiais)" - -#: lazarusidestrconsts:dlgcoincfiles -msgid "Include Files (-Fi):" -msgstr "Įterpiami failai (-Fi):" - -#: lazarusidestrconsts:dlgcosources -msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" -msgstr "Kiti pirminiai kodai (.pp/.pas failai, skirta tik IKA, ne kompiliatoriui)" - -#: lazarusidestrconsts:dlgcolibraries -msgid "Libraries (-Fl):" -msgstr "Bibliotekos (-Fl):" - -#: lazarusidestrconsts:dlgcodebugpath -msgid "Debugger path addition (none):" -msgstr "Papildomas kelias iki derintuvės (joks):" - -#: lazarusidestrconsts:liscompiler -msgid "Compiler" -msgstr "Kompiliatorius" - -#: lazarusidestrconsts:listofpcpath -msgid "Path:" -msgstr "Failas:" - -#: lazarusidestrconsts:liscoskipcallingcompiler -msgid "Skip calling Compiler" -msgstr "Nešaukti kompiliatoriaus" - -#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile -msgid "Ambiguous additional compiler config file" -msgstr "Neaiškus papildomas kompiliatoriaus nustatymų failas" - -#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena -msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." -msgstr "Perspėjimas: papildomo kompiliatoriaus nustatymų failo vardas yra toks pat kaip ir FreePascal ieškomo standartinio nustatymų failo. Dėl to, praleidžiant standartinį nustatymų failą, bus analizuojamas TIK papildomas nustatymų failas." +#: lazarusidestrconsts:lisa2pisnotavalidunitname +msgid "%s%s%s is not a valid unit name." +msgstr "%s%s%s yra klaidingas modulio vardas." #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "%s%sJei esate tikras kad to reikia, spustelkit \"Tinka\"." -#: lazarusidestrconsts:liscocallon -msgid "Call on:" -msgstr "Iššaukti kai:" +#: lazarusidestrconsts:lispkgsysfilename +msgid "%s%sFile Name: %s%s%s" +msgstr "%s%sFailo vardas: %s%s%s" -#: lazarusidestrconsts:liscocalloncompile -msgid "Compile" -msgstr "Kompiliuojama" +#: lazarusidestrconsts:lisunabletochangeclassofto +msgid "%s%sUnable to change class of %s to %s" +msgstr "%s%sNepavyko %s klasę pakeisti į %s" -#: lazarusidestrconsts:liscocallonbuild -msgid "Build" -msgstr "Daroma" +#: lazarusidestrconsts:lispkgsysunitname +msgid "%s%sUnit Name: %s%s%s" +msgstr "%s%sModulio vardas: %s%s%s" -#: lazarusidestrconsts:liscocallonrun -msgid "Run" -msgstr "Startuojama" +#: lazarusidestrconsts:lispckeditpage +msgid "%s, Page: %s" +msgstr "%s, lapas: %s" -#: lazarusidestrconsts:liscoexecuteafter -msgid "Execute after" -msgstr "Startuoti po" +#: lazarusidestrconsts:liscodetoolsdefsautogenerated +msgid "%s, auto generated" +msgstr "%s, sukurtas automatiškai" -#: lazarusidestrconsts:liscoexecutebefore -msgid "Execute before" -msgstr "Startuoti prieš" +#: lazarusidestrconsts:liscodetoolsdefsprojectspecific +msgid "%s, project specific" +msgstr "%s, priklauso nuo projekto" -#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages -msgid "Additional compiler options inherited from packages" -msgstr "Papildomi iš paketų paveldėtos kompiliatoriaus parinktys" +#: lazarusidestrconsts:lisuereadonly +msgid "%s/ReadOnly" +msgstr "%s/Tik skaitymui" -#: lazarusidestrconsts:liscocommand -msgid "Command:" -msgstr "Komanda:" +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage +msgid "%sAdding new Dependency for package %s: package %s%s" +msgstr "%sPaketui %s priskiriamas naujas priklausinys: paketas %s%s" -#: lazarusidestrconsts:liscoscanforfpcmessages -msgid "Scan for FPC messages" -msgstr "Ieškoti FPC pranešimų" +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage +msgid "%sAdding new Dependency for project %s: package %s%s" +msgstr "%sProjektui %s priskiriamas naujas priklausinys: paketas %s%s" -#: lazarusidestrconsts:liscoscanformakemessages -msgid "Scan for Make messages" -msgstr "Ieškoti Make pranešimų" +#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu +msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." +msgstr "%sAbu paketai yra susiję. Tai reiškia, kad kažkuris iš paketų naudoja kitą, arba juos abu naudoja kažkuris kitas paketas." -#: lazarusidestrconsts:liscoshowallmessages -msgid "Show all messages" -msgstr "Rodyti visus pranešimus" +#: lazarusidestrconsts:lisoipdescriptiondescription +msgid "%sDescription: %s" +msgstr "%sAprašymas: %s" -#: lazarusidestrconsts:dlgunitoutp -msgid "Unit output directory (-FU):" -msgstr "Modulio išvesties katalogas (-FU):" +#: lazarusidestrconsts:lisa2pexistingfile +msgid "%sExisting file: %s%s%s" +msgstr "%sEgzistuojantis failas: %s%s%s" -#: lazarusidestrconsts:liscodefault -msgid "default (%s)" -msgstr "numatytas (%s)" +#: lazarusidestrconsts:lisseeprojectprojectinspector +msgid "%sSee Project -> Project Inspector" +msgstr "%sŽiūrėkit \"Projektas -> Projekto inspektorius\"" -#: lazarusidestrconsts:dlgbutapply -msgid "Apply" -msgstr "Pritaikyti" +#: lazarusidestrconsts:lispckexplstate +msgid "%sState: " +msgstr "%sBūsena: " -#: lazarusidestrconsts:dlgcoshowoptions -msgid "Show Options" -msgstr "Rodyti parinktis" +#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof +msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" +msgstr "%sŠie moduliai bus įtraukti į naudojamųjų modulių sąrašą%s%s:%s%s%s" -#: lazarusidestrconsts:dlgcoloadsave -msgid "Load/Save" -msgstr "Įkelti/išsaugoti" +#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound +msgid "%sThis package is installed, but the lpk file was not found" +msgstr "%sŠis paketas įdiegtas, tačiau nerastas lpk failas" -#: lazarusidestrconsts:dlgmainviewforms -msgid "View project forms" -msgstr "Rodyti projekto formas" +#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated +msgid "%sThis package was automatically created" +msgstr "%sŠis paketas sukurtas automatiškai" -#: lazarusidestrconsts:dlgmainviewunits -msgid "View project units" -msgstr "Rodyti projekto modulius" +#: lazarusidestrconsts:lisnone +msgid "%snone" +msgstr "%snieks" -#: lazarusidestrconsts:dlgmultiselect -msgid "Multi Select" -msgstr "Pažymėti kelis" - -#: lazarusidestrconsts:dlgprojectoptions -msgid "Project Options" -msgstr "Projekto parinktys" - -#: lazarusidestrconsts:dlgpoapplication -msgid "Application" -msgstr "Taikomoji programa" - -#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra -msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "Taikomoji programa%sVizualinė LCL/FreePascal programa. Programos failu automatiškai rūpinsis Lazarus." - -#: lazarusidestrconsts:dlgpofroms -msgid "Forms" -msgstr "Formos" - -#: lazarusidestrconsts:dlgpomisc -msgid "Miscellaneous" -msgstr "Įvairūs" - -#: lazarusidestrconsts:dlgposavesession -msgid "Session" -msgstr "Sesija" - -#: lazarusidestrconsts:dlgapplicationsettings -msgid "Application Settings" -msgstr "Programos nuostatos" - -#: lazarusidestrconsts:dlgpotitle -msgid "Title:" -msgstr "Antraštė:" - -#: lazarusidestrconsts:dlgpooutputsettings -msgid "Output Settings" -msgstr "Išvesties nuostatos" - -#: lazarusidestrconsts:dlgpotargetfilename -msgid "Target file name:" -msgstr "Būsimo failo vardas:" - -#: lazarusidestrconsts:dlgpouseappbundle -msgid "Use Application Bundle for running and debugging (darwin only)" -msgstr "Startui ir derinimui naudoti programą-rišulį (tik dėl Darwin)" - -#: lazarusidestrconsts:dlgpousemanifest -msgid "Use manifest file to enable themes (windows only)" -msgstr "Naudoti manifest failą temų įgalinimui (tik dėl Windows)" - -#: lazarusidestrconsts:dlgautocreateforms -msgid "Auto-create forms:" -msgstr "Automatiškai kuriamos formos:" - -#: lazarusidestrconsts:dlgavailableforms -msgid "Available forms:" -msgstr "Esamos formos:" - -#: lazarusidestrconsts:dlgautocreatenewforms -msgid "When creating new forms, add them to auto-created forms" -msgstr "Kuriant nauja formą, ją įdėti į automatiškai kuriamų formų sąrašą" - -#: lazarusidestrconsts:dlgsaveeditorinfo -msgid "Save editor info for closed files" -msgstr "Išsaugoti redaktoriaus informaciją apie užvertus failus" - -#: lazarusidestrconsts:dlgsaveeditorinfoproject -msgid "Save editor info only for project files" -msgstr "Išsaugoti redaktoriaus informaciją tik apie projekto failus" - -#: lazarusidestrconsts:lismainunitispascalsource -msgid "Main Unit is Pascal Source" -msgstr "Pagrindinis modulis yra Paskalio pirminis kodas" - -#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject -msgid "Main Unit has Uses Section containing all Units of project" -msgstr "Pagrindiniame modulyje yra sekcija \"Uses\", kurioje paminėti visi projekto moduliai" - -#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements -msgid "Main Unit has Application.CreateForm statements" -msgstr "Pagrindiniame modulyje yra sakinių \"Application.CreateForm\"" - -#: lazarusidestrconsts:lismainunithasapplicationtitlestatements -msgid "Main Unit has Application.Title statements" -msgstr "Pagrindiniame modulyje yra sakinių \"Application.Title\"" - -#: lazarusidestrconsts:lisprojectisrunnable -msgid "Project is runnable" -msgstr "Projektas yra vykdomasis" - -#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged -msgid "Always build (even if nothing changed)" -msgstr "Visada daryti (net jei nėra pakeitimų)" - -#: lazarusidestrconsts:dlgrunparameters -msgid "Run parameters" -msgstr "Starto parametrai" - -#: lazarusidestrconsts:dlgrunolocal -msgid "Local" -msgstr "Vietiniai" - -#: lazarusidestrconsts:dlgrunoenvironment -msgid "Environment" -msgstr "Aplinka" - -#: lazarusidestrconsts:dlghostapplication -msgid "Host application" -msgstr "Programa-šeimininkė" - -#: lazarusidestrconsts:dlgcommandlineparams -msgid "Command line parameters (without application name)" -msgstr "Komandinės eilutės parametrai (be programos vardo)" - -#: lazarusidestrconsts:dlguselaunchingapp -msgid "Use launching application" -msgstr "Naudoti paleidžiančiąją programą" - -#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox -msgid "Launching application" -msgstr "Paleidžiančioji programa" - -#: lazarusidestrconsts:dlgroworkingdirectory -msgid "Working directory" -msgstr "Darbinis katalogas" - -#: lazarusidestrconsts:dlgrunodisplay -msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" -msgstr "Ekranas (neskirta win32; pvz.: 198.112.45.11:0, x.org:1, hydra:0.1)" - -#: lazarusidestrconsts:dlgrunousedisplay -msgid "Use display" -msgstr "Dirbti ekrane" - -#: lazarusidestrconsts:dlgrunosystemvariables -msgid "System variables" -msgstr "Sistemos kintamieji" - -#: lazarusidestrconsts:dlgrunovariable -msgid "Variable" -msgstr "Kintamasis" - -#: lazarusidestrconsts:dlgrunovalue -msgid "Value" -msgstr "Reikšmė" - -#: lazarusidestrconsts:dlgrunouseroverrides -msgid "User overrides" -msgstr "Naudotojo pakeitimai" - -#: lazarusidestrconsts:dlgincludesystemvariables -msgid "Include system variables" -msgstr "Pridėti sistemos kintamuosius" - -#: lazarusidestrconsts:dlgdirectorydoesnotexist -msgid "Directory does not exist" -msgstr "Katalogas nerastas" - -#: lazarusidestrconsts:lisrunparamsfilenotexecutable -msgid "File not executable" -msgstr "Failas nėra vykdomasis" - -#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable -msgid "The host application %s%s%s is not executable." -msgstr "Programa-šeimininkas %s%s%s nėra vykdomasis failas." - -#: lazarusidestrconsts:dlgthedirectory -msgid "The directory \"" -msgstr "Katalogas \"" - -#: lazarusidestrconsts:dlgdoesnotexist -msgid "\" does not exist." -msgstr "\" neegzistuoja" - -#: lazarusidestrconsts:dlgtexttofing -msgid "&Text to Find" -msgstr "Ieškomasis &tekstas" - -#: lazarusidestrconsts:dlgreplacewith -msgid "&Replace With" -msgstr "&Pakeisti šiuo" - -#: lazarusidestrconsts:dlgfropts -msgid "Options" -msgstr "Parinktys" - -#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor -msgid "When this file is active in source editor ..." -msgstr "Kai šis failas pirminio kodo redaktoriuje aktyvus..." - -#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead -msgid "On build project execute the Build File command instead" -msgstr "Darant projektą, ištikro vykdyti komandą \"Kurti failą\"" - -#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead -msgid "On run project execute the Run File command instead" -msgstr "Startuojant projektą, ištikro vykdyti komandą \"Startuoti failą\"" - -#: lazarusidestrconsts:liscefilter -msgid "(Filter)" -msgstr "(Filtras)" - -#: lazarusidestrconsts:dlgcasesensitive -msgid "Case Sensitive" -msgstr "Paisyti raidžių lygio" - -#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda -msgid "Distinguish big and small letters e.g. A and a" -msgstr "Ieškant skirti didžiąsias ir mažąsias raides" - -#: lazarusidestrconsts:dlgwholewordsonly -msgid "Whole Words Only" -msgstr "Tik ištisų žodžių" - -#: lazarusidestrconsts:lisonlysearchforwholewords -msgid "Only search for whole words" -msgstr "Ieškoti tik ištisų žodžių" - -#: lazarusidestrconsts:dlgregularexpressions -msgid "Regular Expressions" -msgstr "Reguliarusis reiškinys" - -#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme -msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "Teksto paieškai ir pakeitimui galima naudoti reguliariojo reiškinio sintaksę (labai panašiai kaip ir Perl)" - -#: lazarusidestrconsts:dlgmultiline -msgid "Multiline" -msgstr "Kelios eilutės" - -#: lazarusidestrconsts:lisallowsearchingformultiplelines -msgid "Allow searching for multiple lines" -msgstr "Ar galima keleto eilučių paieška" - -#: lazarusidestrconsts:dlgpromptonreplace -msgid "Prompt On Replace" -msgstr "Reikalauti patvirtinimo" - -#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext -msgid "Ask before replacing each found text" -msgstr "Klausti patvirtinimo kiekvienąkart prieš pakeičiant rastą tekstą" - -#: lazarusidestrconsts:dlgsrorigin -msgid "Origin" -msgstr "Pradžia" - -#: lazarusidestrconsts:dlgfromcursor -msgid "From Cursor" -msgstr "Nuo žymeklio" - -#: lazarusidestrconsts:dlgentirescope -msgid "Entire Scope" -msgstr "Visoje srityje" - -#: lazarusidestrconsts:dlgscope -msgid "Scope" -msgstr "Sritis" - -#: lazarusidestrconsts:liswithrequiredpackages -msgid "With required packages" -msgstr "Su reikiamais paketais" - -#: lazarusidestrconsts:lislevels -msgid "Levels" -msgstr "Lygiai" - -#: lazarusidestrconsts:lisshowpackages -msgid "Show packages" -msgstr "Rodyti paketus" - -#: lazarusidestrconsts:lisshowunits -msgid "Show units" -msgstr "Rodyti modulius" - -#: lazarusidestrconsts:lisshowidentifiers -msgid "Show identifiers" -msgstr "Rodyti identifikatorius" - -#: lazarusidestrconsts:lisfilter -msgid "Filter" -msgstr "Filtras" - -#: lazarusidestrconsts:lisprivate -msgid "Private" -msgstr "Private" - -#: lazarusidestrconsts:lisprotected -msgid "Protected" -msgstr "Protected" - -#: lazarusidestrconsts:lisexpandallpackages -msgid "Expand all packages" -msgstr "Išsklaeisti visus paketus" - -#: lazarusidestrconsts:liscollapseallpackages -msgid "Collapse all packages" -msgstr "Suskleisti visus paketus" - -#: lazarusidestrconsts:lisexpandallunits -msgid "Expand all units" -msgstr "Išskleiti visus modulius" - -#: lazarusidestrconsts:liscollapseallunits -msgid "Collapse all units" -msgstr "Suskleisti visus modulius" - -#: lazarusidestrconsts:lisexpandallclasses -msgid "Expand all classes" -msgstr "Išskleisti visas klases" - -#: lazarusidestrconsts:liscollapseallclasses -msgid "Collapse all classes" -msgstr "Suskleisti visas klases" - -#: lazarusidestrconsts:lisexport -msgid "Export ..." -msgstr "Eksportas..." - -#: lazarusidestrconsts:lisbegins -msgid "begins" -msgstr "prasideda" - -#: lazarusidestrconsts:lisidentifierbeginswith -msgid "Identifier begins with ..." -msgstr "Identifikatorius prasideda..." - -#: lazarusidestrconsts:lisunitnamebeginswith -msgid "Unit name begins with ..." -msgstr "Modulio vardas prasideda..." - -#: lazarusidestrconsts:lispackagenamebeginswith -msgid "Package name begins with ..." -msgstr "Paketo vardas prasideda..." - -#: lazarusidestrconsts:liscontains -msgid "contains" -msgstr "yra" - -#: lazarusidestrconsts:lisidentifiercontains -msgid "Identifier contains ..." -msgstr "Identifikatoriuje yra..." - -#: lazarusidestrconsts:lisunitnamecontains -msgid "Unit name contains ..." -msgstr "Modulio varde yra..." - -#: lazarusidestrconsts:lispackagenamecontains -msgid "Package name contains ..." -msgstr "Paketo varde yra..." - -#: lazarusidestrconsts:lisfriincurrentunit -msgid "in current unit" -msgstr "šiame modulyje" - -#: lazarusidestrconsts:lisfriinmainproject -msgid "in main project" -msgstr "pagrindiniame projekte" - -#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit -msgid "in project/package owning current unit" -msgstr "projekte/pakete, kuriam priklauso šis modulis" - -#: lazarusidestrconsts:lisfriinallopenpackagesandprojects -msgid "in all open packages and projects" -msgstr "visuose atvertuose paketuose ir projektuose" - -#: lazarusidestrconsts:lisfrirenameallreferences -msgid "Rename all References" -msgstr "Pervardyti visus surastus" - -#: lazarusidestrconsts:dlgglobal -msgid "Global" -msgstr "Globaliai" - -#: lazarusidestrconsts:dlgselectedtext -msgid "Selected Text" -msgstr "Pažymėtame tekste" - -#: lazarusidestrconsts:dlgdirection -msgid "Direction" -msgstr "Kryptis" - -#: lazarusidestrconsts:lisfrforwardsearch -msgid "Forward search" -msgstr "Ieškoti pirmyn" - -#: lazarusidestrconsts:lisfrbackwardsearch -msgid "Backward search" -msgstr "Iekoti atgal" - -#: lazarusidestrconsts:dlgupword -msgid "Up" -msgstr "Viršun" - -#: lazarusidestrconsts:dlgdownword -msgid "Down" -msgstr "Apačion" - -#: lazarusidestrconsts:dlgreplaceall -msgid "Replace &All" -msgstr "Pakeisti &visus" - -#: lazarusidestrconsts:dlggetposition -msgid "Get position" -msgstr "Sužinoti poziciją" - -#: lazarusidestrconsts:dlgleftpos -msgid "Left:" -msgstr "Kairė:" - -#: lazarusidestrconsts:dlgwidthpos -msgid "Width:" -msgstr "Plotis:" - -#: lazarusidestrconsts:dlgtoppos -msgid "Top:" -msgstr "Viršus:" - -#: lazarusidestrconsts:dlgheightpos -msgid "Height:" -msgstr "Aukštis:" - -#: lazarusidestrconsts:rsiwpusewindowmanagersetting -msgid "Use windowmanager setting" -msgstr "Naudoti langų tvarkytuvės nuostatas" - -#: lazarusidestrconsts:rsiwpdefault -msgid "Default" -msgstr "Numatytas" - -#: lazarusidestrconsts:rsiwprestorewindowgeometry -msgid "Restore window geometry" -msgstr "Atstatyti lango geometriją" - -#: lazarusidestrconsts:rsiwpdocked -msgid "Docked" -msgstr "Įstatytas" - -#: lazarusidestrconsts:rsiwpcustomposition -msgid "Custom position" -msgstr "Nurodytas dydis" - -#: lazarusidestrconsts:rsiwprestorewindowsize -msgid "Restore window size" -msgstr "Atstatyti lango dydį" - -#: lazarusidestrconsts:liscodeexplorer -msgid "Code Explorer" -msgstr "Kodo tyrinėtojas" - -#: lazarusidestrconsts:uemfinddeclaration -msgid "&Find Declaration" -msgstr "Ieškoti kur &paskelbta" - -#: lazarusidestrconsts:uemopenfileatcursor -msgid "&Open file at cursor" -msgstr "Atverti ties žymekliu nurodytą &failą" - -#: lazarusidestrconsts:uemprocedurejump -msgid "Procedure Jump" -msgstr "Rodyti procedūros paskelbimą arba jos kodą" - -#: lazarusidestrconsts:uemclosepage -msgid "&Close Page" -msgstr "&Užverti lapą" - -#: lazarusidestrconsts:uemcut -msgid "Cut" -msgstr "Iškirpti" - -#: lazarusidestrconsts:uemcopy -msgid "Copy" -msgstr "Kopijuoti" - -#: lazarusidestrconsts:uempaste -msgid "Paste" -msgstr "Įdėti" - -#: lazarusidestrconsts:uemcopyfilename -msgid "Copy filename" -msgstr "Kopijuoti failo vardą" - -#: lazarusidestrconsts:uemgotobookmark -msgid "&Goto Bookmark" -msgstr "&Rodyti žymę" - -#: lazarusidestrconsts:uemsetfreebookmark -msgid "Set a free Bookmark" -msgstr "Padėti laisvą žymę" - -#: lazarusidestrconsts:uemnextbookmark -msgid "Goto next Bookmark" -msgstr "Rodyti tolesnę žymę" - -#: lazarusidestrconsts:uemprevbookmark -msgid "Goto previous Bookmark" -msgstr "Rodyti ankstesnę žymę" - -#: lazarusidestrconsts:uembookmarkn -msgid "Bookmark" -msgstr "Žymė" - -#: lazarusidestrconsts:lisopenlfm -msgid "Open %s" -msgstr "Atverti %s" - -#: lazarusidestrconsts:uemsetbookmark -msgid "&Set Bookmark" -msgstr "Pa&dėti žymę" - -#: lazarusidestrconsts:uemreadonly -msgid "Read Only" -msgstr "Tik skaitymui" - -#: lazarusidestrconsts:uemshowlinenumbers -msgid "Show Line Numbers" -msgstr "Rodyti eilučių numerius" - -#: lazarusidestrconsts:uemshowunitinfo -msgid "Unit Info" -msgstr "Informacija apie modulį" - -#: lazarusidestrconsts:uemdebugword -msgid "Debug" -msgstr "Derinimas" +#: lazarusidestrconsts:liswladd +msgid "&Add" +msgstr "Pri&dėti" #: lazarusidestrconsts:uemaddbreakpoint msgid "&Add Breakpoint" msgstr "Padėti st&abdos tašką" -#: lazarusidestrconsts:uemaddwatchatcursor -msgid "Add &Watch At Cursor" -msgstr "&Stebėti esantį ties žymekliu" +#: lazarusidestrconsts:lisclose +msgid "&Close" +msgstr "&Užverti" + +#: lazarusidestrconsts:uemclosepage +msgid "&Close Page" +msgstr "&Užverti lapą" + +#: lazarusidestrconsts:lismenucomponents +msgid "&Components" +msgstr "K&omponentai" + +#: lazarusidestrconsts:liswldelete +msgid "&Delete" +msgstr "&Pašalinti" + +#: lazarusidestrconsts:lismenuedit +msgid "&Edit" +msgstr "&Keisti" + +#: lazarusidestrconsts:liswlenabled +msgid "&Enabled" +msgstr "Į&galintas" + +#: lazarusidestrconsts:lismenufile +msgid "&File" +msgstr "&Failas" + +#: lazarusidestrconsts:uemfinddeclaration +msgid "&Find Declaration" +msgstr "Ieškoti kur &paskelbta" + +#: lazarusidestrconsts:uemgotobookmark +msgid "&Goto Bookmark" +msgstr "&Rodyti žymę" + +#: lazarusidestrconsts:lismenuhelp +msgid "&Help" +msgstr "Žin&ynas" + +#: lazarusidestrconsts:lisplistobjects +msgid "&Objects" +msgstr "&Objektai" + +#: lazarusidestrconsts:lisok +msgid "&Ok" +msgstr "&Tinka" + +#: lazarusidestrconsts:uemopenfileatcursor +msgid "&Open file at cursor" +msgstr "Atverti ties žymekliu nurodytą &failą" + +#: lazarusidestrconsts:lismenuproject +msgid "&Project" +msgstr "Projek&tas" + +#: lazarusidestrconsts:liswlproperties +msgid "&Properties" +msgstr "&Savybės" + +#: lazarusidestrconsts:dlgreplacewith +msgid "&Replace With" +msgstr "&Pakeisti šiuo" + +#: lazarusidestrconsts:lismenurun +msgid "&Run" +msgstr "&Startuoti" #: lazarusidestrconsts:uemruntocursor msgid "&Run to Cursor" msgstr "S&tartuoti iki žymeklio" -#: lazarusidestrconsts:uemviewcallstack -msgid "View Call Stack" -msgstr "Rodyti kreipčių dėklą" +#: lazarusidestrconsts:lismenusearch +msgid "&Search" +msgstr "&Paieška" -#: lazarusidestrconsts:uemmoveeditorleft -msgid "Move Editor Left" -msgstr "Perkelti redaktorių kairėn" +#: lazarusidestrconsts:uemsetbookmark +msgid "&Set Bookmark" +msgstr "Pa&dėti žymę" -#: lazarusidestrconsts:uemmoveeditorright -msgid "Move Editor Right" -msgstr "Perkelti redaktorių dešinėn" +#: lazarusidestrconsts:dlgtexttofing +msgid "&Text to Find" +msgstr "Ieškomasis &tekstas" -#: lazarusidestrconsts:uemrefactor -msgid "Refactoring" -msgstr "Pertvarkymas" +#: lazarusidestrconsts:lismenutools +msgid "&Tools" +msgstr "Įra&nkiai" -#: lazarusidestrconsts:uemcompletecode -msgid "Complete Code" -msgstr "Pabaigti kodą" +#: lazarusidestrconsts:lismenuview +msgid "&View" +msgstr "&Rodymas" -#: lazarusidestrconsts:uemencloseselection -msgid "Enclose Selection" -msgstr "Apgaubti pažymėtąjį" +#: lazarusidestrconsts:lismenuwindows +msgid "&Windows" +msgstr "&Langai" -#: lazarusidestrconsts:uemextractproc -msgid "Extract Procedure" -msgstr "Ištraukti procedūrą" +#: lazarusidestrconsts:liscefilter +msgid "(Filter)" +msgstr "(Filtras)" -#: lazarusidestrconsts:ueminvertassignment -msgid "Invert Assignment" -msgstr "Sukeisti priskyrimą" +#: lazarusidestrconsts:dlgbaknosubdirectory +msgid "(no subdirectory)" +msgstr "(pakatalogio nėra)" -#: lazarusidestrconsts:uemfindidentifierreferences -msgid "Find Identifier References" -msgstr "Ieškoti identifikatoriaus įrašų" +#: lazarusidestrconsts:listmunknownmacro +msgid "(unknown macro: %s)" +msgstr "(nežinoma makrokomanda: %s)" -#: lazarusidestrconsts:uemrenameidentifier -msgid "Rename Identifier" -msgstr "Pervardyti identifikatorių" +#: lazarusidestrconsts:lisplistall +msgid "" +msgstr "" -#: lazarusidestrconsts:uemeditorproperties -msgid "Editor properties" -msgstr "Redaktoriaus savybės" +#: lazarusidestrconsts:lislazdocnotagcaption +msgid "" +msgstr "" -#: lazarusidestrconsts:uenotimplcap -msgid "Not implemented yet" -msgstr "Dar neįgyvendinta" +#: lazarusidestrconsts:lisplistnone +msgid "" +msgstr "" -#: lazarusidestrconsts:uenotimpltext -msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" -msgstr "Jei jūs galite mums padėti įgyvendinti šią ypatybę, tada rašykite į lazarus@miraclec.com" +#: lazarusidestrconsts:lisa2pchooseanexistingfile +msgid "" +msgstr "" -#: lazarusidestrconsts:uenotimplcapagain -msgid "I told You: Not implemented yet" -msgstr "Aš tau sakau: dar neįgyvendinta." +#: lazarusidestrconsts:lismodifiedlgplnotice +msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -#: lazarusidestrconsts:uefilerocap -msgid "File is readonly" -msgstr "Failas tik skaitymui" +#: lazarusidestrconsts:lislgplnotice +msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -#: lazarusidestrconsts:uefilerotext1 -msgid "The file \"" -msgstr "Failas \"" +#: lazarusidestrconsts:lisgplnotice +msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." -#: lazarusidestrconsts:uefilerotext2 -msgid "\" is not writable." -msgstr "\" nėra skirtas rašymui" +#: lazarusidestrconsts:lisctdefnovariableselected +msgid "" +msgstr "" -#: lazarusidestrconsts:uemodified -msgid "Modified" -msgstr "Pakeista" +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "%s negali turėti TControl klasių.%sĮ jį galima dėti tik nevizualines komponentes." -#: lazarusidestrconsts:uepreadonly -msgid "Readonly" -msgstr "Tik skaitymui" +#: lazarusidestrconsts:lisafilealreadyexistsreplaceit +msgid "A file %s%s%s already exists.%sReplace it?" +msgstr "Failas %s%s%s jau egzistuoja.%sPerrašyti?" -#: lazarusidestrconsts:uepins -msgid "INS" -msgstr "ĮTERPTI" +#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas +msgid "A pascal unit must have the extension .pp or .pas" +msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" -#: lazarusidestrconsts:uepovr -msgid "OVR" -msgstr "KEISTI" +#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound +msgid "A required packages was not found. See package graph." +msgstr "Nerasti reikiami paketai. Žvilgterėkit į paketų grafą." -#: lazarusidestrconsts:lisuefontwith -msgid "Font without UTF-8" -msgstr "Ne UTF-8 šriftas" +#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi +msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." +msgstr "Įprastas Paskalio programos failas.%sŠitai galite naudoti greitam bei grubiam testui.%sGeriau kurkite naują projektą." -#: lazarusidestrconsts:lisuethecurre -msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." -msgstr "Dabartinis redaktoriaus šriftas nėra suderintas su UTF-8 koduote, o jūsų sistema naudoja būtent šią koduotę.%sTai reiškia kad ne ASCII simboliai greičiausiai bus rodomi klaidingai.%sKitą šriftą galite pasirinkti redaktoriaus parinktyse." +#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename +msgid "A valid tool needs at least a title and a filename." +msgstr "Įrankiui mažų mažiausia reikia pavadinimo ir failo vardo." -#: lazarusidestrconsts:lisuedonotsho -msgid "Do not show this message again." -msgstr "Daugiau neberodyti šio pranešimo." +#: lazarusidestrconsts:lispdabort +msgid "Abort" +msgstr "Nutraukti" -#: lazarusidestrconsts:lisinvalidmultiselection -msgid "Invalid multiselection" -msgstr "Klaidingas daugybinis pažymėjimas" +#: lazarusidestrconsts:lismenuabortbuild +msgid "Abort Build" +msgstr "Nutraukti darymą" -#: lazarusidestrconsts:lisunableconvertbinarystreamtotext -msgid "Unable convert binary stream to text" -msgstr "Nepavyko dvejetainį srautą konvertuoti į tekstą" +#: lazarusidestrconsts:lisabortall +msgid "Abort all" +msgstr "Nutraukti viską" -#: lazarusidestrconsts:lisunabletostreamselectedcomponents -msgid "Unable to stream selected components" -msgstr "Pažymėtųjų komponenčių persiųsti srautu nepavyko." +#: lazarusidestrconsts:lisabortallloading +msgid "Abort all loading" +msgstr "Nutraukti visą įkėlimo procesą" -#: lazarusidestrconsts:liscannotcopytoplevelcomponent -msgid "Can not copy top level component." -msgstr "Aukščiausiame lygyje esančių komponenčių kopijuoti negalima." +#: lazarusidestrconsts:liskmabortbuilding +msgid "Abort building" +msgstr "Nutraukti darymą" -#: lazarusidestrconsts:liscopyingawholeformisnotimplemented -msgid "Copying a whole form is not implemented." -msgstr "Visos formos kopijavimas dar nėra įgyvendintas." +#: lazarusidestrconsts:lisabortloadingproject +msgid "Abort loading project" +msgstr "Nutraukti projekto įkrovą" -#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent -msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "Rašant pažymėtąją komponentę %s:%s įvyko klaida:%s%s" +#: lazarusidestrconsts:lisabortwholeloading +msgid "Abort whole loading" +msgstr "Nutraukti įkėlimą" -#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe -msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "Konvertuojant pažymėtosios komponentės %s:%s dvejetainį srautą įvyko klaida:%s%s" +#: lazarusidestrconsts:lismenutemplateabout +msgid "About" +msgstr "Apie" -#: lazarusidestrconsts:lisunablecopycomponentstoclipboard -msgid "Unable copy components to clipboard" -msgstr "Komponentę kopijuoti į iškarpinę nepavyko" +#: lazarusidestrconsts:lisaboutlazarus +msgid "About Lazarus" +msgstr "Apie Lazarus" -#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli -msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "Komponentę srautu kopijuojant į iškarpinę įvyko klaida:%s%s" +#: lazarusidestrconsts:srvk_accept +msgid "Accept" +msgstr "Accept" -#: lazarusidestrconsts:liserrorin -msgid "Error in %s" -msgstr "%s klaida" +#: lazarusidestrconsts:lisacknowledgements +msgid "Acknowledgements" +msgstr "Padėkos" -#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename -msgid "There is already another component with the name %s%s%s." -msgstr "Jau yra komponentas tokiu vardu %s%s%s." +#: lazarusidestrconsts:liscodetoolsdefsaction +msgid "Action: %s" +msgstr "Veiksmas: %s" -#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated -msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" -msgstr "Klasės %s%s%s%s komponentų redaktorius, iššauktas veiksmažodžio #%s %s%s%s,%spadarė klaidą:%s%s%s%s" +#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme +msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" +msgstr "Teksto paieškai ir pakeitimui galima naudoti reguliariojo reiškinio sintaksę (labai panašiai kaip ir Perl)" -#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror -msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" -msgstr "Klasės %s%s%skomponentų redaktorius padarė klaidą:%s%s%s%s" +#: lazarusidestrconsts:liscodetempladd +msgid "Add" +msgstr "Pridėti" -#: lazarusidestrconsts:fdinvalidmultiselectiontext -msgid "Multiselected components must be of a single form." -msgstr "Kelios pažymėtos komponentės turi būti toje pačioje formoje." +#: lazarusidestrconsts:lisaddtoproject +msgid "Add %s to project?" +msgstr "Įdėti %s į projektą?" -#: lazarusidestrconsts:lisinvaliddelete -msgid "Invalid delete" -msgstr "Klaidingas šalinimas" +#: lazarusidestrconsts:uemaddwatchatcursor +msgid "Add &Watch At Cursor" +msgstr "&Stebėti esantį ties žymekliu" -#: lazarusidestrconsts:listherootcomponentcannotbedeleted -msgid "The root component can not be deleted." -msgstr "Šakninio komponento negalima Pašalinti." +#: lazarusidestrconsts:lisa2paddfile +msgid "Add File" +msgstr "Pridėti failą" + +#: lazarusidestrconsts:lisa2paddfiles +msgid "Add Files" +msgstr "Pridėti failus" + +#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist +msgid "Add LFM, LRS files, if they exist" +msgstr "Pridėti esamus LFM bei LRS failus" + +#: lazarusidestrconsts:lisa2paddunit +msgid "Add Unit" +msgstr "Pridėti modulį" + +#: lazarusidestrconsts:lismenuaddcurunittopkg +msgid "Add active unit to a package" +msgstr "Įdėti aktyvųjį modulį į paketą" + +#: lazarusidestrconsts:liskmaddactiveunittoproject +msgid "Add active unit to project" +msgstr "Įdėti į projektą aktyvųjį modulį" + +#: lazarusidestrconsts:lispckeditaddanitem +msgid "Add an item" +msgstr "Pridėti elementą" + +#: lazarusidestrconsts:liskmaddbreakpoint +msgid "Add break point" +msgstr "Padėti stabdos tašką" + +#: lazarusidestrconsts:lismenuaddbreakpoint +msgid "Add breakpoint" +msgstr "Padėti stabdos tašką" + +#: lazarusidestrconsts:liscodetempladdcodetemplate +msgid "Add code template" +msgstr "Pridėti kodo šabloną" + +#: lazarusidestrconsts:lismenuaddtoproject +msgid "Add editor file to Project" +msgstr "Redaktoriaus failą įdėti į projektą" + +#: lazarusidestrconsts:lisprojaddeditorfile +msgid "Add editor files" +msgstr "Pridėti redaktoriaus failus" + +#: lazarusidestrconsts:lisaf2paddfiletoapackage +msgid "Add file to a package" +msgstr "Įdėti į paketą" + +#: lazarusidestrconsts:lisprojaddaddfiletoproject +msgid "Add file to project:" +msgstr "Įdėti failą į projektą:" + +#: lazarusidestrconsts:lisprojaddfiles +msgid "Add files" +msgstr "Pridėti failus" + +#: lazarusidestrconsts:lisa2paddfilestopackage +msgid "Add files to package" +msgstr "Įdėti failus į paketą" + +#: lazarusidestrconsts:srkmecaddjumppoint +msgid "Add jump point" +msgstr "Pridėti peršokimo tašką" + +#: lazarusidestrconsts:lismenuaddjumppointtohistory +msgid "Add jump point to history" +msgstr "Peršokimo tašką įdėti istorijon" + +#: lazarusidestrconsts:lislazdocaddlinkbutton +msgid "Add link" +msgstr "Pridėti nuorodą" + +#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects +msgid "Add options to dependent packages and projects" +msgstr "Įdėti parinktis į priklausomus paketus bei projektus" + +#: lazarusidestrconsts:lislazdocaddpathbutton +msgid "Add path" +msgstr "Pridėti kelią" + +#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects +msgid "Add paths to dependent packages/projects" +msgstr "Įdėti kelius į priklausomus paketus/projektus" + +#: lazarusidestrconsts:dlgaddsemicolon +msgid "Add semicolon" +msgstr "Pridėti kabliataškį" + +#: lazarusidestrconsts:lisoifaddtofavouriteproperties +msgid "Add to favourite properties" +msgstr "Pridėti prie mėgstamiausiųjų savybių" + +#: lazarusidestrconsts:lisa2paddtopackage +msgid "Add to package" +msgstr "Įdėti į paketą" + +#: lazarusidestrconsts:lisprojaddtoproject +msgid "Add to project" +msgstr "Įdėti į projektą" + +#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit +msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." +msgstr "Pridėti modulį prie paketo naudojamų modulių. Pasyvinkite tik tiems moduliams, kurių jokiu būdu nereikia kompiliuoti." + +#: lazarusidestrconsts:liskmaddwatch +msgid "Add watch" +msgstr "Pridėti stebimąjį" + +#: lazarusidestrconsts:lismenuaddwatch +msgid "Add watch ..." +msgstr "Pridėti stebimąjį..." + +#: lazarusidestrconsts:dlgedadd +msgid "Add..." +msgstr "Pridėti..." + +#: lazarusidestrconsts:dlgadditionalsrcpath +msgid "Additional Source search path for all projects (.pp;.pas)" +msgstr "Papildomi visų projektų keliai iki pirminio kodo" + +#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages +msgid "Additional compiler options inherited from packages" +msgstr "Papildomi iš paketų paveldėtos kompiliatoriaus parinktys" + +#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp +msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" +msgstr "Ieškoti ir kituose failuose (pvz.: /path/*.pas;/path2/*.pp)" + +#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath +msgid "Additional search path" +msgstr "Papildomi paieškos keliai" + +#: lazarusidestrconsts:dlgadjusttopline +msgid "Adjust top line due to comment in front" +msgstr "Turi matytis ir komentaras" + +#: lazarusidestrconsts:rslanguageafrikaans +msgid "Afrikaans" +msgstr "Afrikiečių" #: lazarusidestrconsts:fdmalignword msgid "Align" msgstr "Lygiuotė" -#: lazarusidestrconsts:fdmmirrorhorizontal -msgid "Mirror horizontal" -msgstr "Apsukti horizontaliai" +#: lazarusidestrconsts:lisalignment +msgid "Alignment" +msgstr "Lygiuotė" -#: lazarusidestrconsts:fdmmirrorvertical -msgid "Mirror vertical" -msgstr "Apsukti vertikaliai" +#: lazarusidestrconsts:lisallfiles +msgid "All Files" +msgstr "Visi failai" -#: lazarusidestrconsts:fdmscaleword -msgid "Scale" -msgstr "Mastelis" +#: lazarusidestrconsts:lisallblockslooksok +msgid "All blocks looks ok." +msgstr "Visi blokai geri." -#: lazarusidestrconsts:fdmsizeword -msgid "Size" -msgstr "Dydis" +#: lazarusidestrconsts:dlgallfiles +msgid "All files" +msgstr "Visi failai" -#: lazarusidestrconsts:fdmtaborder -msgid "Tab order..." -msgstr "Tabuliatoriaus eilė..." +#: lazarusidestrconsts:lisedtdefallpackages +msgid "All packages" +msgstr "Visi paketai" -#: lazarusidestrconsts:fdmorder -msgid "Order" -msgstr "Eilė" +#: lazarusidestrconsts:lisedtdefsallprojects +msgid "All projects" +msgstr "Visi projektai" -#: lazarusidestrconsts:fdmordermovetofront -msgid "Move to front" -msgstr "Perkelti į priekį" +#: lazarusidestrconsts:dlglabelgoto +msgid "Allow LABEL and GOTO" +msgstr "Galimi LABEL ir GOTO" -#: lazarusidestrconsts:fdmordermovetoback -msgid "Move to back" -msgstr "Perkelti į galą" +#: lazarusidestrconsts:lisallowsearchingformultiplelines +msgid "Allow searching for multiple lines" +msgstr "Ar galima keleto eilučių paieška" -#: lazarusidestrconsts:fdmorderforwardone -msgid "Forward one" -msgstr "Vienu pirmyn" +#: lazarusidestrconsts:dlgalphabetically +msgid "Alphabetically" +msgstr "Pagal abėcėlę" -#: lazarusidestrconsts:fdmorderbackone -msgid "Back one" -msgstr "Vienu atgal" +#: lazarusidestrconsts:srkm_alt +msgid "Alt" +msgstr "Alt" -#: lazarusidestrconsts:fdmdeleteselection -msgid "Delete selection" -msgstr "Pašalinti pažymėtą" - -#: lazarusidestrconsts:lischangeclass -msgid "Change Class" -msgstr "Pakeisti klasę" - -#: lazarusidestrconsts:fdmsnaptogridoption -msgid "Option: Snap to grid" -msgstr "Parinktis: pritraukti prie tinklelio taškų" - -#: lazarusidestrconsts:lisviewsourcelfm -msgid "View Source (.lfm)" -msgstr "Rodyti pirminį kodą (.lfm)" - -#: lazarusidestrconsts:fdmsaveformasxml -msgid "Save form as xml" -msgstr "Išsaugoti formą kaip xml" - -#: lazarusidestrconsts:fdmsnaptoguidelinesoption -msgid "Option: Snap to guide lines" -msgstr "Parinktis: pritraukti prie pagalbinių linijų" - -#: lazarusidestrconsts:fdmshowoptions -msgid "Show Options for form editing" -msgstr "Formos konstravimo parinktys" - -#: lazarusidestrconsts:srkmeditkeys -msgid "Edit Keys" -msgstr "Keisti klavišus" - -#: lazarusidestrconsts:srkmcommand -msgid "Command:" -msgstr "Komanda:" - -#: lazarusidestrconsts:srkmconflic -msgid "Conflict " -msgstr "Konfliktas" - -#: lazarusidestrconsts:srkmconflicw -msgid " conflicts with " -msgstr " konfliktuoja su " - -#: lazarusidestrconsts:srkmcommand1 -msgid " command1 \"" -msgstr "komanda 1 \"" - -#: lazarusidestrconsts:srkmcommand2 -msgid " command2 \"" -msgstr "komanda 2 \"" - -#: lazarusidestrconsts:srkmeditforcmd -msgid "Edit keys for command" -msgstr "Keisti klavišus komandai" - -#: lazarusidestrconsts:srkmkey -msgid "Key (or 2 keys combination)" -msgstr "Klavišas (arba dviejų kombinacija)" - -#: lazarusidestrconsts:srkmgrabkey -msgid "Grab key" -msgstr "Susekti klavišą" - -#: lazarusidestrconsts:srkmgrabsecondkey -msgid "Grab second key" -msgstr "Susekti kitą klavišą" - -#: lazarusidestrconsts:srkmpresskey -msgid "Please press a key ..." -msgstr "Spustelkit kokį nors klavišą..." +#: lazarusidestrconsts:dlgaltsetclmode +msgid "Alt-Key sets column mode" +msgstr "Nuspaudus Alt klavišą - žymimi stulpeliai" #: lazarusidestrconsts:srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "Alternatyvusis klavišas (arba dviejų kombinacija)" -#: lazarusidestrconsts:srkmalreadyconnected -msgid " The key \"%s\" is already connected to \"%s\"." -msgstr "Klavišas \"%s\" jau yra surištas su \"%s\"." +#: lazarusidestrconsts:lisbfalwaysbuildbeforerun +msgid "Always Build before Run" +msgstr "Prieš startuojant visada daryti" -#: lazarusidestrconsts:srkmecwordleft -msgid "Move cursor word left" -msgstr "Perkelti žymeklį žodžiu kairiau" +#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged +msgid "Always build (even if nothing changed)" +msgstr "Visada daryti (net jei nėra pakeitimų)" -#: lazarusidestrconsts:srkmecwordright -msgid "Move cursor word right" -msgstr "Perkelti žymeklį žodžiu dešiniau" +#: lazarusidestrconsts:dlgalwaysvisiblecaret +msgid "Always visible caret" +msgstr "Žymeklis matomas nuolat" -#: lazarusidestrconsts:srkmeclinestart -msgid "Move cursor to line start" -msgstr "Perkelti žymeklį į eilutės pradžia" +#: lazarusidestrconsts:lisa2pambiguousancestortype +msgid "Ambiguous Ancestor Type" +msgstr "Neaiškus protėvio tipas" -#: lazarusidestrconsts:srkmeclineend -msgid "Move cursor to line end" -msgstr "Perkelti žymeklį į eilutės pabaigą" +#: lazarusidestrconsts:lisa2pambiguousclassname +msgid "Ambiguous Class Name" +msgstr "Neaiškus klasės vardas" -#: lazarusidestrconsts:srkmecpageup -msgid "Move cursor up one page" -msgstr "Perkelti žymeklį lapu aukščiau" +#: lazarusidestrconsts:lisa2pambiguousunitname +msgid "Ambiguous Unit Name" +msgstr "Neaiškus modulio vardas" -#: lazarusidestrconsts:srkmecpagedown -msgid "Move cursor down one page" -msgstr "Perkelti žymeklį lapu žemiau" +#: lazarusidestrconsts:lisambiguousunitfound +msgid "Ambiguous Unit found" +msgstr "Rastas neaiškus modulis" -#: lazarusidestrconsts:srkmecpageleft -msgid "Move cursor left one page" -msgstr "Perkelti žymeklį lapu kairiau" +#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile +msgid "Ambiguous additional compiler config file" +msgstr "Neaiškus papildomas kompiliatoriaus nustatymų failas" -#: lazarusidestrconsts:srkmecpageright -msgid "Move cursor right one page" -msgstr "Perkelti žymeklį lapu dešiniau" +#: lazarusidestrconsts:dlgambigfileact +msgid "Ambiguous file action:" +msgstr "Esant neaiškiam failui:" -#: lazarusidestrconsts:srkmecpagetop -msgid "Move cursor to top of page" -msgstr "Perkelti žymeklį į lapo pradžią" +#: lazarusidestrconsts:lisambiguousfilefound +msgid "Ambiguous file found" +msgstr "Rastas neaiškus failas" -#: lazarusidestrconsts:srkmecpagebottom -msgid "Move cursor to bottom of page" -msgstr "Perkelti žymeklį į lapo pabaigą" +#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete +msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" +msgstr "Rastas neaiškus failas: %s%s%s%sŠis failas gali būti supainiotas su %s%s%s%s%sIštrinti neaiškųjį failą?" -#: lazarusidestrconsts:srkmeceditortop -msgid "Move cursor to absolute beginning" -msgstr "Perkelti žymeklį į absoliučią pradžią" +#: lazarusidestrconsts:lisambiguousfilesfound +msgid "Ambiguous files found" +msgstr "Rastas neaiškus failas" -#: lazarusidestrconsts:srkmeceditorbottom -msgid "Move cursor to absolute end" -msgstr "Perkelti žymeklį į absoliučią pabaigą" +#: lazarusidestrconsts:lispkgmangambiguousunitsfound +msgid "Ambiguous units found" +msgstr "Rasti neaiškūs moduliai" -#: lazarusidestrconsts:srkmecgotoxy -msgid "Goto XY" -msgstr "Eiti į poziciją" +#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro +msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" +msgstr "Paskutinio starto metu įkeliant projektą %s įvyko klaida!%s%sVėl įkelti šį projektą?" -#: lazarusidestrconsts:srkmecselleft -msgid "SelLeft" -msgstr "Žymėti simboliu kairiau" +#: lazarusidestrconsts:lisa2pancestortype +msgid "Ancestor Type" +msgstr "Protėvio tipas" -#: lazarusidestrconsts:srkmecselright -msgid "SelRight" -msgstr "Žymėti simboliu dešiniau" +#: lazarusidestrconsts:lisanchoreditornocontrolselected +msgid "Anchor Editor - no control selected" +msgstr "Prieraišų redaktorius - nėra pažymėtų komponenčių" -#: lazarusidestrconsts:srkmecselup -msgid "Select Up" -msgstr "Žymėti eilute aukščiau" +#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace +msgid "Anchor to bottom side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno apatiniojo krašto" -#: lazarusidestrconsts:srkmecseldown -msgid "Select Down" -msgstr "Žymėti eilute žemiau" +#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace +msgid "Anchor to left side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno kairiojo krašto" -#: lazarusidestrconsts:srkmecselwordleft -msgid "Select Word Left" -msgstr "Žymėti žodžiu kairiau" +#: lazarusidestrconsts:lisanchortorightsidekeepborderspace +msgid "Anchor to right side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno dešiniojo krašto" -#: lazarusidestrconsts:srkmecselwordright -msgid "Select Word Right" -msgstr "Žymėti žodžiu dešiniau" +#: lazarusidestrconsts:lisanchortotopsidekeepborderspace +msgid "Anchor to top side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno viršutiniojo krašto" -#: lazarusidestrconsts:srkmecsellinestart -msgid "Select Line Start" -msgstr "Žymėti iki eilutės pradžios" +#: lazarusidestrconsts:lisanchorsofselectedcontrols +msgid "Anchors of selected controls" +msgstr "Pažymėtos komponentės prieraišos" -#: lazarusidestrconsts:srkmecsellineend -msgid "Select Line End" -msgstr "Žymėti iki eilutės galo" +#: lazarusidestrconsts:lismakeresstrappendtosection +msgid "Append to section" +msgstr "Tiesiog pridėti" -#: lazarusidestrconsts:srkmecselpageup -msgid "Select Page Up" -msgstr "Žymėti lapu aukščiau" +#: lazarusidestrconsts:dlgpoapplication +msgid "Application" +msgstr "Taikomoji programa" -#: lazarusidestrconsts:srkmecselpagedown -msgid "Select Page Down" -msgstr "Žymėti lapu žemiau" +#: lazarusidestrconsts:dlgapplicationsettings +msgid "Application Settings" +msgstr "Programos nuostatos" -#: lazarusidestrconsts:srkmecselpageleft -msgid "Select Page Left" -msgstr "Žymėti lapu kairiau" +#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra +msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." +msgstr "Taikomoji programa%sVizualinė LCL/FreePascal programa. Programos failu automatiškai rūpinsis Lazarus." -#: lazarusidestrconsts:srkmecselpageright -msgid "Select Page Right" -msgstr "Žymėti lapu dešiniau" +#: lazarusidestrconsts:dlgbutapply +msgid "Apply" +msgstr "Pritaikyti" -#: lazarusidestrconsts:srkmecselpagetop -msgid "Select Page Top" -msgstr "Žymėti iki lapo viršaus" +#: lazarusidestrconsts:lispckeditapplychanges +msgid "Apply changes" +msgstr "Pritaikyti keitimus" -#: lazarusidestrconsts:srkmecselpagebottom -msgid "Select Page Bottom" -msgstr "Žymėti iki lapo apačios" +#: lazarusidestrconsts:rslanguagearabic +msgid "Arabic" +msgstr "Arabų" -#: lazarusidestrconsts:srkmecseleditortop -msgid "Select to absolute beginning" -msgstr "Žymėti iki absoliučios pradžios" +#: lazarusidestrconsts:dlgcoasis +msgid "As-Is" +msgstr "Kaip yra" -#: lazarusidestrconsts:srkmecseleditorbottom -msgid "Select to absolute end" -msgstr "Žymėti iki absoliučios pabaigos" +#: lazarusidestrconsts:lissortselascending +msgid "Ascending" +msgstr "Didėjanti" -#: lazarusidestrconsts:srkmecselgotoxy -msgid "Select Goto XY" -msgstr "Žymėti ir eiti į XY" +#: lazarusidestrconsts:dlgenvask +msgid "Ask" +msgstr "Klausti" -#: lazarusidestrconsts:srkmecselectall -msgid "Select All" -msgstr "Žymėti viską" +#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext +msgid "Ask before replacing each found text" +msgstr "Klausti patvirtinimo kiekvienąkart prieš pakeičiant rastą tekstą" -#: lazarusidestrconsts:srkmecdeletelastchar -msgid "Delete Last Char" -msgstr "Pašalinti paskutinį simbolį" +#: lazarusidestrconsts:liscodetoolsoptsat +msgid "At" +msgstr "Simbolis eta" -#: lazarusidestrconsts:srkmecdeletechar -msgid "Delete char at cursor" -msgstr "Pašalinti simbolį ties žymekliu" +#: lazarusidestrconsts:lispckoptsauthor +msgid "Author:" +msgstr "Autorius:" -#: lazarusidestrconsts:srkmecdeleteword -msgid "Delete to end of word" -msgstr "Pašalinti iki žodžio pabaigos" +#: lazarusidestrconsts:dlgautoform +msgid "Auto create form when opening unit" +msgstr "Atveriant modulį formą sukurti automatiškai" -#: lazarusidestrconsts:srkmecdeletelastword -msgid "Delete to start of word" -msgstr "Pašalinti iki žodžio pradžios" +#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly +msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." +msgstr "Negalima keisti automatiškai sukurtų mazgų,%stačiau jie gali turėti neautomatiškai sukurtų mazgų-sūnų." -#: lazarusidestrconsts:srkmecdeletebol -msgid "Delete to beginning of line" -msgstr "Pašalinti iki eilutės pradžios" +#: lazarusidestrconsts:dlgautodel +msgid "Auto delete file" +msgstr "Failą ištrinti automatiškai" -#: lazarusidestrconsts:srkmecdeleteeol -msgid "Delete to end of line" -msgstr "Pašalinti iki eilutės pabaigos" +#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited +msgid "Auto generated nodes can not be edited." +msgstr "Negalima keisti automatiškai sukurtų mazgų." -#: lazarusidestrconsts:srkmecdeleteline -msgid "Delete current line" -msgstr "Pašalinti šią veikiamąją eilutę" +#: lazarusidestrconsts:dlgautoident +msgid "Auto indent" +msgstr "Automatinė įtrauka" -#: lazarusidestrconsts:srkmecclearall -msgid "Delete whole text" -msgstr "Pašalinti visą tekstą" +#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall +msgid "Auto rebuild when rebuilding all" +msgstr "Daryti automatiškai kai daromi visi" + +#: lazarusidestrconsts:dlgautoren +msgid "Auto rename file lowercase" +msgstr "Failą automatiškai pervardyti mažosiomis raidėmis" + +#: lazarusidestrconsts:dlgautosave +msgid "Auto save" +msgstr "Automatinis išsaugojimas" + +#: lazarusidestrconsts:dlgautocreateforms +msgid "Auto-create forms:" +msgstr "Automatiškai kuriamos formos:" + +#: lazarusidestrconsts:lispckexplautocreated +msgid "AutoCreated" +msgstr "sukurtas automatiškai" + +#: lazarusidestrconsts:rslanguageautomatic +msgid "Automatic (or english)" +msgstr "Automatiškai (arba anglų)" + +#: lazarusidestrconsts:lisautomaticfeatures +msgid "Automatic features" +msgstr "Automatinės ypatybės" + +#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild +msgid "Automatically increment version on build" +msgstr "Padarius, automatiškai didinti versijos numerį" + +#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages +msgid "Automatically installed packages" +msgstr "Automatiškai įdiegti paketai" + +#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded +msgid "Automatically rebuild as needed" +msgstr "Automatiškai daryti kai reikia" + +#: lazarusidestrconsts:dlgavailableforms +msgid "Available forms:" +msgstr "Esamos formos:" + +#: lazarusidestrconsts:lisavailablepackages +msgid "Available packages" +msgstr "Galimi paketai" + +#: lazarusidestrconsts:dlgedback +msgid "Back" +msgstr "Atgal" + +#: lazarusidestrconsts:fdmorderbackone +msgid "Back one" +msgstr "Vienu atgal" + +#: lazarusidestrconsts:dlgbackcolor +msgid "Background" +msgstr "Fonas" + +#: lazarusidestrconsts:srvk_back +msgid "Backspace" +msgstr "Backspace" + +#: lazarusidestrconsts:dlgenvbckup +msgid "Backup" +msgstr "Atsarginė kopija" + +#: lazarusidestrconsts:lisbackupfilefailed +msgid "Backup file failed" +msgstr "Nepavyko padaryti failo atsarginę kopiją" + +#: lazarusidestrconsts:lisfrbackwardsearch +msgid "Backward search" +msgstr "Iekoti atgal" + +#: lazarusidestrconsts:dlgbehindmethods +msgid "Behind methods" +msgstr "Po metodų" + +#: lazarusidestrconsts:lispkgfiletypebinary +msgid "Binary" +msgstr "Dvejetainis" + +#: lazarusidestrconsts:liscodetoolsdefsblock +msgid "Block" +msgstr "Blokas" + +#: lazarusidestrconsts:dlgblockindent +msgid "Block indent" +msgstr "Blokų įtrauka" + +#: lazarusidestrconsts:dlgedbold +msgid "Bold" +msgstr "Pusjuodis" + +#: lazarusidestrconsts:uembookmarkn +msgid "Bookmark" +msgstr "Žymė" + +#: lazarusidestrconsts:lisborderspace +msgid "BorderSpace" +msgstr "Kraštinės plotis" + +#: lazarusidestrconsts:lisaroundborderspacehint +msgid "Borderspace around the control. The other four borderspaces are added to this value." +msgstr "" +"Pagrindinis kraštinės plotis apie komponentę.\n" +"Ši reikšmė bus pridedama prie kitų kraštinių pločių" + +#: lazarusidestrconsts:lisbottomgroupboxcaption +msgid "Bottom anchoring" +msgstr "Apačios prieraiša" + +#: lazarusidestrconsts:lisbottomborderspacespinedithint +msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." +msgstr "" +"Apatinės kraštinės plotis.\n" +"Ši reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą apatinės kraštinės plotį" + +#: lazarusidestrconsts:lisbottomspaceequally +msgid "Bottom space equally" +msgstr "Tolygiai rikiuoti pagal apatinius kraštus" + +#: lazarusidestrconsts:lisbottoms +msgid "Bottoms" +msgstr "Sutapdinti apatinius kraštus" + +#: lazarusidestrconsts:dlgbrachighlight +msgid "Bracket highlighting" +msgstr "Paryškinti porinius skliaustus" + +#: lazarusidestrconsts:lismenubeaklinesinselection +msgid "Break Lines in selection" +msgstr "Laužyti eilutes pažymėtoje srityje" #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" @@ -4855,101 +887,2461 @@ msgstr "Laužti eilutę bei perkelti žymeklį" msgid "Break line, leave cursor" msgstr "Laužti eilutę, neperkeliant žymeklio" +#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions +msgid "Break on Lazarus Exceptions" +msgstr "Stabdyti esant Lazarus išimtinei situacijai" + +#: lazarusidestrconsts:lismenuviewbreakpoints +msgid "BreakPoints" +msgstr "Stabdos taškai" + +#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint +msgid "Breakpoint" +msgstr "Stabdos taškas" + +#: lazarusidestrconsts:lisa2pbrokendependencies +msgid "Broken Dependencies" +msgstr "Sugadintos priklausomybės" + +#: lazarusidestrconsts:lispkgmangbrokendependency +msgid "Broken dependency" +msgstr "Sugadinta priklausomybė" + +#: lazarusidestrconsts:lispatheditbrowse +msgid "Browse" +msgstr "Naršyti" + +#: lazarusidestrconsts:lisbrowseforcompiler +msgid "Browse for Compiler (%s)" +msgstr "Nurodyti kompiliatorių (%s)" + +#: lazarusidestrconsts:lismenubuild +msgid "Build" +msgstr "Daryti" + +#: lazarusidestrconsts:lislazbuildbuildcodetools +msgid "Build CodeTools" +msgstr "Daryti CodeTools" + +#: lazarusidestrconsts:lisbfbuildcommand +msgid "Build Command" +msgstr "Darymo komanda" + +#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools +msgid "Build Components (SynEdit, CodeTools)" +msgstr "Daryti komponentes (SynEdit, CodeTools)" + +#: lazarusidestrconsts:lislazbuildbuildexamples +msgid "Build Examples" +msgstr "Daryti pavyzdžius" + +#: lazarusidestrconsts:lismenubuildfile +msgid "Build File" +msgstr "Daryti failą" + +#: lazarusidestrconsts:lislazbuildbuildide +msgid "Build IDE" +msgstr "Daryti IKA" + +#: lazarusidestrconsts:lislazbuildbuildjitform +msgid "Build JITForm" +msgstr "Daryti JITForm" + +#: lazarusidestrconsts:lismenubuildlazarus +msgid "Build Lazarus" +msgstr "Daryti Lazarus" + +#: lazarusidestrconsts:lisbuildnumber +msgid "Build Number" +msgstr "Darymo numeris" + +#: lazarusidestrconsts:lislazbuildbuildsynedit +msgid "Build SynEdit" +msgstr "Daryti SynEdit" + +#: lazarusidestrconsts:lismenubuildall +msgid "Build all" +msgstr "Daryti visus" + +#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram +msgid "Build all files of project/program" +msgstr "Daryti visus projekto/programos failus" + +#: lazarusidestrconsts:srkmecbuildlazarus +msgid "Build lazarus" +msgstr "Daryti Lazarus" + +#: lazarusidestrconsts:lisbuildnewproject +msgid "Build new project" +msgstr "Daryti naująjį projektą" + +#: lazarusidestrconsts:liskmbuildprojectprogram +msgid "Build project/program" +msgstr "Daryti projektą/programą" + +#: lazarusidestrconsts:dlgcmacro +msgid "C Style Macros (global)" +msgstr "C stiliaus makrokomandos (globaliai)" + +#: lazarusidestrconsts:dlgcocops +msgid "C Style Operators (*=, +=, /= and -=)" +msgstr "C stiliaus operatoriai (*=, +=, /= bei -=)" + +#: lazarusidestrconsts:dlgcppinline +msgid "C++ Styled INLINE" +msgstr "C stiliaus INLINE" + +#: lazarusidestrconsts:lismenuinsertcvskeyword +msgid "CVS keyword" +msgstr "CVS raktažodis" + +#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit +msgid "Call %sRegister%s procedure of selected unit" +msgstr "Iškviesti pažymėto modulio %sRegister%s procedūrą" + +#: lazarusidestrconsts:lismenuviewcallstack +msgid "Call Stack" +msgstr "Kreipčių dėklas" + +#: lazarusidestrconsts:liscocallon +msgid "Call on:" +msgstr "Iššaukti kai:" + +#: lazarusidestrconsts:liscannotcopytoplevelcomponent +msgid "Can not copy top level component." +msgstr "Aukščiausiame lygyje esančių komponenčių kopijuoti negalima." + +#: lazarusidestrconsts:liscannotcreatefile +msgid "Can not create file %s%s%s" +msgstr "Nepavyksta sukurti failą %s%s%s" + +#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit +msgid "Can not register components without unit" +msgstr "Negalima registruoti komponenčių be modulio" + +#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents +msgid "Can only change the class of TComponents." +msgstr "Galima keisti tik TComponen'ų klasę." + +#: lazarusidestrconsts:dlgcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lazarusidestrconsts:liscancelloadingthiscomponent +msgid "Cancel loading this component" +msgstr "Neįkelti šio komponento" + +#: lazarusidestrconsts:liscancelloadingunit +msgid "Cancel loading unit" +msgstr "Atsisakyti modulio įkėlimo" + +#: lazarusidestrconsts:liscancelrenaming +msgid "Cancel renaming" +msgstr "Atsisakyti pervardyjimo" + +#: lazarusidestrconsts:lisaboutnocontributors +msgid "Cannot find contributors list." +msgstr "Nepavyko rasti talkininkų sąrašo" + +#: lazarusidestrconsts:liscannotfindlazarusstarter +msgid "Cannot find lazarus starter:%s%s" +msgstr "Nepavyko rasti Lazarus startuotoją:%s%s" + +#: lazarusidestrconsts:srvk_capital +msgid "Capital" +msgstr "Caps Lock" + +#: lazarusidestrconsts:dlgcaretskipsselection +msgid "Caret skips selection" +msgstr "Nuo žymėjimo atitrūkstantis žymeklis" + +#: lazarusidestrconsts:lisdiffdlgcaseinsensitive +msgid "Case Insensitive" +msgstr "Skirti didžiąsias ir mažąsias raides" + +#: lazarusidestrconsts:dlgcasesensitive +msgid "Case Sensitive" +msgstr "Paisyti raidžių lygio" + +#: lazarusidestrconsts:lisfindfilecasesensitive +msgid "Case sensitive" +msgstr "Svarbu raidžių lygis" + +#: lazarusidestrconsts:rslanguagecatalan +msgid "Catalan" +msgstr "Katalanų" + +#: lazarusidestrconsts:dlgcentercursorline +msgid "Center Cursor Line" +msgstr "Žymeklis ekrano centre" + +#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling +msgid "Center control horizontally relative to the given sibling" +msgstr "Komponentę centruoti horizontaliai pagal nurodytą kaimyną" + +#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling +msgid "Center control vertically relative to the given sibling" +msgstr "Komponentę centruoti vertikaliai pagal nurodytą kaimyną" + +#: lazarusidestrconsts:liscenterinwindow +msgid "Center in window" +msgstr "Centruoti lange" + +#: lazarusidestrconsts:liscenters +msgid "Centers" +msgstr "Sutapdinti centrus" + +#: lazarusidestrconsts:liscodetemplchange +msgid "Change" +msgstr "Pakeisti" + +#: lazarusidestrconsts:lischangeclass +msgid "Change Class" +msgstr "Pakeisti klasę" + +#: lazarusidestrconsts:lisplistchangefont +msgid "Change Font" +msgstr "Keisti šriftą" + +#: lazarusidestrconsts:lischangeparent +msgid "Change parent ..." +msgstr "Pakeisti tėvą..." + +#: lazarusidestrconsts:lismenuinsertchangelogentry +msgid "ChangeLog entry" +msgstr "Pakeitimų žurnalo įrašas" + +#: lazarusidestrconsts:lisdiskdiffchangedfiles +msgid "Changed files:" +msgstr "Pakeisti failai:" + +#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies +msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." +msgstr "Keičiant paketo vardą ar versiją bus sugadintos priklausomybės. Keisti šias priklausomybes kaip priklauso?%sPaspaudus \"Taip\" bus pakeistos visos pateiktos priklausomybės.%sPaspaudus \"Ignoruoti\" priklausomybės bus sugadintos." + #: lazarusidestrconsts:srkmecchar msgid "Char" msgstr "Simbolis" -#: lazarusidestrconsts:srkmecimestr -msgid "Ime Str" -msgstr "IME eilutė" +#: lazarusidestrconsts:lischaractermap +msgid "Character Map" +msgstr "Simbolių lentelė" -#: lazarusidestrconsts:srkmeccut -msgid "Cut selection to clipboard" -msgstr "Pažymėtą iškirpti į iškarpinę" +#: lazarusidestrconsts:lismenuchecklfm +msgid "Check LFM file in editor" +msgstr "Tikrinti LFM failą redaktoriuje" -#: lazarusidestrconsts:srkmeccopy -msgid "Copy selection to clipboard" -msgstr "Pažymėtą kopijuoti į iškarpinę" +#: lazarusidestrconsts:lischeckchangesondiskwithloading +msgid "Check changes on disk with loading" +msgstr "Įkeliant ieškoti pasikeitimų diske" -#: lazarusidestrconsts:srkmecpaste -msgid "Paste clipboard to current position" -msgstr "Iš iškarpinės įdėti veikiamojoje vietoje" +#: lazarusidestrconsts:dlgcheckconsistency +msgid "Check consistency" +msgstr "Tikrinti darną" -#: lazarusidestrconsts:srkmecscrollup -msgid "Scroll up one line" -msgstr "Slinkti aukštyn per vieną eilutę" +#: lazarusidestrconsts:dlgcochecks +msgid "Checks:" +msgstr "Tikrinti:" -#: lazarusidestrconsts:srkmecscrolldown -msgid "Scroll down one line" -msgstr "Slinkti žemyn per vieną eilutę" +#: lazarusidestrconsts:rslanguagechinese +msgid "Chinese" +msgstr "Kiniečių" -#: lazarusidestrconsts:srkmecscrollleft -msgid "Scroll left one char" -msgstr "Slinkti kairėn per vieną simbolį" +#: lazarusidestrconsts:lispochoosepofiledirectory +msgid "Choose .po file directory" +msgstr "Nurodykit .po failo katalogą" -#: lazarusidestrconsts:srkmecscrollright -msgid "Scroll right one char" -msgstr "Slinkti dešinėn per vieną simbolį" +#: lazarusidestrconsts:lischoosedelphipackage +msgid "Choose Delphi package (*.dpk)" +msgstr "Nurodykit Delphi paketą (*.dpk)" -#: lazarusidestrconsts:srkmecinsertmode -msgid "Insert Mode" -msgstr "Įterpimo veiksena" +#: lazarusidestrconsts:lischoosedelphiproject +msgid "Choose Delphi project (*.dpr)" +msgstr "Nurodykit Delphi projektą (*.dpr)" -#: lazarusidestrconsts:srkmecoverwritemode -msgid "Overwrite Mode" -msgstr "Perrašymo veiksena" +#: lazarusidestrconsts:lischoosedelphiunit +msgid "Choose Delphi unit (*.pas)" +msgstr "Nurodykit Delphi modulį (*.pas)" -#: lazarusidestrconsts:srkmectogglemode -msgid "Toggle Mode" -msgstr "Perjungti veikseną" +#: lazarusidestrconsts:lisctdefchoosedirectory +msgid "Choose Directory" +msgstr "Parinkite katalogą" -#: lazarusidestrconsts:srkmecblockindent -msgid "Indent block" -msgstr "Suteikti blokui įtrauką" +#: lazarusidestrconsts:lischoosefpcsourcedir +msgid "Choose FPC source directory" +msgstr "Nurodykite FPC pirminio kodo katalogą" -#: lazarusidestrconsts:srkmecblockunindent -msgid "Unindent block" -msgstr "Naikinti bloko įtrauką" +#: lazarusidestrconsts:liskmchoosekeymappingscheme +msgid "Choose Keymapping scheme" +msgstr "Rinkitės klavišų priskyrimo schemą" -#: lazarusidestrconsts:srkmecshifttab -msgid "Shift Tab" -msgstr "Shift Tab" +#: lazarusidestrconsts:lischooselazarussourcedirectory +msgid "Choose Lazarus Directory" +msgstr "Nurodykite Lazarus katalogą" -#: lazarusidestrconsts:srkmecmatchbracket -msgid "Go to matching bracket" -msgstr "Eiti prie skliausto porininko" +#: lazarusidestrconsts:lisedoptschoosescheme +msgid "Choose Scheme" +msgstr "Rinkitės derinį" -#: lazarusidestrconsts:srkmecnormalselect -msgid "Normal selection mode" -msgstr "Įprasta žymėjimo veiksena" +#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty +msgid "Choose a base class for the favourite property %s%s%s." +msgstr "Mėgstamiausiąjai savybei %s%s%s parinkite bazinę klasę." -#: lazarusidestrconsts:srkmeccolumnselect -msgid "Column selection mode" -msgstr "Stulpelių žymėjimo veiksena" +#: lazarusidestrconsts:lischooseadifferentname +msgid "Choose a different name" +msgstr "Nurodykite kitokį vardą" -#: lazarusidestrconsts:srkmeclineselect -msgid "Line selection mode" -msgstr "Eilučių žymėjimo veiksena" +#: lazarusidestrconsts:dlgchscodetempl +msgid "Choose code template file (*.dci)" +msgstr "Rinkitės kodo šablono failą (*.dci)" + +#: lazarusidestrconsts:lischoosecompilerpath +msgid "Choose compiler filename (%s)" +msgstr "Nurorodykite kompiliatoriaus dailo vardą (%s)" + +#: lazarusidestrconsts:lischoosedebuggerpath +msgid "Choose debugger filename" +msgstr "Nurodykite derintuvės failo vardą" + +#: lazarusidestrconsts:lischoosedirectory +msgid "Choose directory" +msgstr "Nurodykite katalogą" + +#: lazarusidestrconsts:lischoosemakepath +msgid "Choose make path" +msgstr "Nurodykite make kelią" + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile +msgid "Choose one of these items to create a new File" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują failą" + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage +msgid "Choose one of these items to create a new Package" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują paketą" + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject +msgid "Choose one of these items to create a new Project" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują projektą" + +#: lazarusidestrconsts:lischooseprogramsourcepppaslpr +msgid "Choose program source (*.pp,*.pas,*.lpr)" +msgstr "Nurodykit programos pirminį kodą (*.pp, *.pas, *.lpr)" + +#: lazarusidestrconsts:lischoosestructuretoencloseselection +msgid "Choose structure to enclose selection" +msgstr "Nurodykite kokią struktūrą apgaubti pažymėtąjį kodą" + +#: lazarusidestrconsts:lischoosetestbuilddir +msgid "Choose the directory for tests" +msgstr "Nurodykite katalogą testams" + +#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies +msgid "Circle in package dependencies" +msgstr "Ratas paketo priklausiniuose" + +#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste +msgid "Class %s%s%s is not a registered component class.%sUnable to paste." +msgstr "Klasė %s%s%s nėra registruoto komponento klasė.%sĮdėti nepavyks." + +#: lazarusidestrconsts:lisoifclassnotfound +msgid "Class %s%s%s not found." +msgstr "Klasė %s%s%s nerasta." + +#: lazarusidestrconsts:lisa2pclassnamealreadyexists +msgid "Class Name already exists" +msgstr "Dubliuojasi klasės vardas " + +#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic +msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." +msgstr "Klasė konfliktuoja su .lfm failu:%smodulis %s%s naudoja modulį %s,%skuriame yra klasė %s, %stačiau ,lfm faile įrašyta visai kita klasė.%sModulyje gali būti tik viena vizualinė klasė.%s%sPekelkit į kitą modulį." + +#: lazarusidestrconsts:lisclassnotfound +msgid "Class not found" +msgstr "Klasė nerasta" + +#: lazarusidestrconsts:dlgcdtclassorder +msgid "Class order" +msgstr "Klasės eilė" + +#: lazarusidestrconsts:dlgclassinsertpolicy +msgid "Class part insert policy" +msgstr "Klasės dalies įterpimo politika" + +#: lazarusidestrconsts:liskmclassic +msgid "Classic" +msgstr "Klasikinis" + +#: lazarusidestrconsts:liscldircleandirectory +msgid "Clean Directory" +msgstr "Valyti katalogą" + +#: lazarusidestrconsts:liscleanlazarussource +msgid "Clean Lazarus Source" +msgstr "Apvalyti Lazarus katalogus" + +#: lazarusidestrconsts:lislazbuildcleanall +msgid "Clean all" +msgstr "Visiškas apvalymas" + +#: lazarusidestrconsts:lismenucleandirectory +msgid "Clean directory ..." +msgstr "Apvalyti katalogą..." + +#: lazarusidestrconsts:liscldircleansubdirectories +msgid "Clean sub directories" +msgstr "Valyti pakatalogius" + +#: lazarusidestrconsts:liscleanupunitpath +msgid "Clean up unit path?" +msgstr "Apvalyti modulio kelią?" + +#: lazarusidestrconsts:lislazbuildcleanbuild +msgid "Clean+Build" +msgstr "Apvalyti ir daryti" + +#: lazarusidestrconsts:srvk_clear +msgid "Clear" +msgstr "Clear" + +#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename +msgid "Clear dependency filename" +msgstr "Išvalyti priklausomo failo vardą" + +#: lazarusidestrconsts:lisuiclearincludedbyreference +msgid "Clear include cache" +msgstr "Išvalyti įtraukiamų failų podėlį" + +#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun +msgid "Clear log on run" +msgstr "Išvalyti žurnalą paleidžiant" + +#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff +msgid "Click on one of the above items to see the diff" +msgstr "Spustelėjus ant elemento bus parodytas jo diff" + +#: lazarusidestrconsts:lismenuclose +msgid "Close" +msgstr "Užverti" + +#: lazarusidestrconsts:liskmcloseall +msgid "Close All" +msgstr "Užverti visus" + +#: lazarusidestrconsts:lismenucloseproject +msgid "Close Project" +msgstr "Užverti projektą" + +#: lazarusidestrconsts:lismenucloseall +msgid "Close all editor files" +msgstr "Užverti visus redaktoriaus failus" + +#: lazarusidestrconsts:lissrclosepage +msgid "Close page" +msgstr "Užverti lapą" + +#: lazarusidestrconsts:liskmcloseproject +msgid "Close project" +msgstr "Užverti projektą" + +#: lazarusidestrconsts:dlgcodegeneration +msgid "Code" +msgstr "Kodas" + +#: lazarusidestrconsts:lismenuviewcodebrowser +msgid "Code Browser" +msgstr "Kodo naršyklė" + +#: lazarusidestrconsts:dlgcodecreation +msgid "Code Creation" +msgstr "Kodo kūrimas" + +#: lazarusidestrconsts:lismenuviewcodeexplorer +msgid "Code Explorer" +msgstr "Kodo tyrinėtojas" + +#: lazarusidestrconsts:lismenueditcodetemplates +msgid "Code Templates ..." +msgstr "Kodo šablonai..." + +#: lazarusidestrconsts:dlgcodetoolstab +msgid "Code Tools" +msgstr "Kodo pagalbininkai" + +#: lazarusidestrconsts:liscodebrowser +msgid "Code browser" +msgstr "Kodo naršyklė" + +#: lazarusidestrconsts:dlgusecodefolding +msgid "Code folding" +msgstr "Kodo suvėrimas" + +#: lazarusidestrconsts:dlgedcodeparams +msgid "Code parameters" +msgstr "Kodo parametrai" #: lazarusidestrconsts:srkmecautocompletion msgid "Code template completion" msgstr "Kodo šablono užbaigimas" -#: lazarusidestrconsts:srkmecuserfirst -msgid "User First" -msgstr "Pirma naudotojas" +#: lazarusidestrconsts:dlgedcodetempl +msgid "Code templates" +msgstr "Kodo šablonai" -#: lazarusidestrconsts:srkmecsetfreebookmark -msgid "Set a free Bookmark" -msgstr "Padėti laisva žymę" +#: lazarusidestrconsts:lisceocodeexplorer +msgid "CodeExplorer Options" +msgstr "Kodo tyrinėtojo parinktys" -#: lazarusidestrconsts:srkmecprevbookmark -msgid "Previous Bookmark" -msgstr "Ankstesnė žymė" +#: lazarusidestrconsts:liscodetools +msgid "CodeTools" +msgstr "CodeTools" -#: lazarusidestrconsts:srkmecnextbookmark -msgid "Next Bookmark" -msgstr "Tolesnė žymė" +#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc +msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" +msgstr "CodeTools - funkcijos ir įrankiai, skirti nagrinėti, naršyti ir keisti paskalio pirminį tekstą" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor +msgid "CodeTools Defines Editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview +msgid "CodeTools Defines Preview" +msgstr "CodeTools apibrėžčių peržiūra" + +#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues +msgid "CodeTools Directory Values" +msgstr "CodeTools katalogo reikšmės" + +#: lazarusidestrconsts:dlgcodetoolsopts +msgid "CodeTools Options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:lismenucodetoolsoptions +msgid "CodeTools Options ..." +msgstr "CodeTools parinktys..." + +#: lazarusidestrconsts:srkmcatcodetools +msgid "CodeTools commands" +msgstr "CodeTools komandos" + +#: lazarusidestrconsts:liskmcodetoolsdefineseditor +msgid "CodeTools defines editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:lismenucodetoolsdefineseditor +msgid "CodeTools defines editor ..." +msgstr "CodeTools apibrėžčių redaktorius..." + +#: lazarusidestrconsts:liskmcodetoolsoptions +msgid "CodeTools options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:srkmeccodetoolsdefinesed +msgid "Codetools defines editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:srkmeccodetoolsoptions +msgid "Codetools options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:liscollapseallclasses +msgid "Collapse all classes" +msgstr "Suskleisti visas klases" + +#: lazarusidestrconsts:liscollapseallpackages +msgid "Collapse all packages" +msgstr "Suskleisti visus paketus" + +#: lazarusidestrconsts:liscollapseallunits +msgid "Collapse all units" +msgstr "Suskleisti visus modulius" + +#: lazarusidestrconsts:lismenucollectpofil +msgid "Collect .po files" +msgstr "Surinkti .po failus" + +#: lazarusidestrconsts:liscodetoolsoptscolon +msgid "Colon" +msgstr "Dvitaškis" + +#: lazarusidestrconsts:dlgedcolor +msgid "Color" +msgstr "Spalva" + +#: lazarusidestrconsts:dlgclrscheme +msgid "Color Scheme" +msgstr "Spalvų derinys" + +#: lazarusidestrconsts:dlgenvcolors +msgid "Colors" +msgstr "Spalvos" + +#: lazarusidestrconsts:srkmeccolumnselect +msgid "Column selection mode" +msgstr "Stulpelių žymėjimo veiksena" + +#: lazarusidestrconsts:liscodetoolsoptscomma +msgid "Comma" +msgstr "Kablelis" + +#: lazarusidestrconsts:liscommandafter +msgid "Command after" +msgstr "Komanda po" + +#: lazarusidestrconsts:liscommandafterinvalid +msgid "Command after invalid" +msgstr "Klaidinga komanda esanti po" + +#: lazarusidestrconsts:liscommandafterpublishingmodule +msgid "Command after publishing module" +msgstr "Komanda po modulio paskelbimo" + +#: lazarusidestrconsts:srkmcatcmdcmd +msgid "Command commands" +msgstr "Menių \"Komandos\" komandos" + +#: lazarusidestrconsts:dlgcommandlineparams +msgid "Command line parameters (without application name)" +msgstr "Komandinės eilutės parametrai (be programos vardo)" + +#: lazarusidestrconsts:liscommandlineparamsofprogram +msgid "Command line parameters of program" +msgstr "Programos komandinės eilutės parametrai" + +#: lazarusidestrconsts:liscocommand +msgid "Command:" +msgstr "Komanda:" + +#: lazarusidestrconsts:lismenucommentselection +msgid "Comment selection" +msgstr "Uždėti komentarą pažymėtajam" + +#: lazarusidestrconsts:liscodetemplcomment +msgid "Comment:" +msgstr "Komentaras:" + +#: lazarusidestrconsts:dlgcocompilation +msgid "Compilation" +msgstr "Kompiliacija" + +#: lazarusidestrconsts:liscocalloncompile +msgid "Compile" +msgstr "Kompiliuojama" + +#: lazarusidestrconsts:liscompileidewithoutlinking +msgid "Compile IDE (without linking)" +msgstr "Kompiliuoti IKA (nesaistant)" + +#: lazarusidestrconsts:lispckeditcompileeverything +msgid "Compile everything?" +msgstr "Kompiliuoti viską?" + +#: lazarusidestrconsts:lispckeditcompilepackage +msgid "Compile package" +msgstr "Kompiliuoti paketą" + +#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition +msgid "CompiledSrcPath addition" +msgstr "Priedas prie CompiledSrcPath" + +#: lazarusidestrconsts:liscompiler +msgid "Compiler" +msgstr "Kompiliatorius" + +#: lazarusidestrconsts:dlgcompileroptions +msgid "Compiler Options" +msgstr "Kompiliatoriaus parinktys" + +#: lazarusidestrconsts:lismenucompileroptions +msgid "Compiler Options ..." +msgstr "Kompiliatoriaus parinktys..." + +#: lazarusidestrconsts:lispckeditcompileroptionsforpackage +msgid "Compiler Options for Package %s" +msgstr "Paketo %s kompiliavimo parinktys" + +#: lazarusidestrconsts:liscompileroptionsforproject +msgid "Compiler Options for Project: %s" +msgstr "Kompiliatoriaus parinktys projektui: %s" + +#: lazarusidestrconsts:liscompilererror +msgid "Compiler error" +msgstr "Kompiliatoriaus klaida" + +#: lazarusidestrconsts:liscompilerfilename +msgid "Compiler filename" +msgstr "Kompiliatoriaus failo vardas" + +#: lazarusidestrconsts:liskmcompileroptions +msgid "Compiler options" +msgstr "Kompiliatoriaus parinktys" + +#: lazarusidestrconsts:dlgfpcpath +msgid "Compiler path (e.g. %s)" +msgstr "Kompiliatoriaus failas (pvz.: %s)" + +#: lazarusidestrconsts:lismenucompletecode +msgid "Complete Code" +msgstr "Užbaigti kodą" + +#: lazarusidestrconsts:srkmeccompletecode +msgid "Complete code" +msgstr "Užbaigti kodą" + +#: lazarusidestrconsts:dlgcompleteproperties +msgid "Complete properties" +msgstr "Užbaigti savybes" + +#: lazarusidestrconsts:liscomponent +msgid "Component" +msgstr "Komponentė" + +#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined +msgid "Component Class %s%s%s already defined" +msgstr "Komponentės klasė %s%s%s jau paskelbta" + +#: lazarusidestrconsts:liscomponentnameiskeyword +msgid "Component name %s%s%s is keyword" +msgstr "Komponentės vardas %s%s%s kaip ir raktažodžio" + +#: lazarusidestrconsts:liscomponentnameisnotavalididentifier +msgid "Component name %s%s%s is not a valid identifier" +msgstr "Komponento vardas %s%s%s nėra identifikatorius" + +#: lazarusidestrconsts:lisfpcomponents +msgid "Components" +msgstr "Komponentės" + +#: lazarusidestrconsts:srkmcatcomponentsmenu +msgid "Components menu commands" +msgstr "Maniu \"Komponentės\" komandos" + +#: lazarusidestrconsts:liskmconfigbuildfile +msgid "Config %sBuild File%s" +msgstr "Derinti %sDaryti failą%s" + +#: lazarusidestrconsts:dlgconfigfiles +msgid "Config Files:" +msgstr "Nustatymų failai:" + +#: lazarusidestrconsts:lisconfigurebuildlazarus +msgid "Configure %sBuild Lazarus%s" +msgstr "Derinti %sDaryti Lazarus%s" + +#: lazarusidestrconsts:lisconfigurebuild +msgid "Configure Build %s" +msgstr "Derinti %s daryklę" + +#: lazarusidestrconsts:lismenuconfigbuildfile +msgid "Configure Build+Run File ..." +msgstr "Derinti \"Daryti ir startuoti failą\"..." + +#: lazarusidestrconsts:liskmconfigurehelp +msgid "Configure Help" +msgstr "Derinti žinyną" + +#: lazarusidestrconsts:lismenuconfigurehelp +msgid "Configure Help ..." +msgstr "Derinti žinyną..." + +#: lazarusidestrconsts:lismenuconfigurebuildlazarus +msgid "Configure \"Build Lazarus\" ..." +msgstr "Derinti \"Daryti Lazarus\"..." + +#: lazarusidestrconsts:liskmconfigurecustomcomponents +msgid "Configure custom components" +msgstr "Derinti naudotojo komponentes" + +#: lazarusidestrconsts:lismenuconfigcustomcomps +msgid "Configure custom components ..." +msgstr "Derinti naudotojo komponentes..." + +#: lazarusidestrconsts:lismenusettings +msgid "Configure custom tools ..." +msgstr "Derinti naudotojo įrankius..." + +#: lazarusidestrconsts:liskmconfigureinstalledpackages +msgid "Configure installed packages" +msgstr "Derinti įdiegtus paketus" + +#: lazarusidestrconsts:lismenueditinstallpkgs +msgid "Configure installed packages ..." +msgstr "Derinti įdiegtus paketus..." + +#: lazarusidestrconsts:lislazbuildconfirmbuild +msgid "Confirm Before ReBuild Lazarus" +msgstr "Klausti sutikimo prieš darant Lazarus" + +#: lazarusidestrconsts:lisconfirmchanges +msgid "Confirm changes" +msgstr "Patvirtinkit pakeitimus" + +#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency +msgid "Confirm deleting dependency" +msgstr "Patvirtinimas naikinat priklausomybę" + +#: lazarusidestrconsts:lisprojinspconfirmremovingfile +msgid "Confirm removing file" +msgstr "Patvirtinimas šalinant failą" + +#: lazarusidestrconsts:srkmconflic +msgid "Conflict " +msgstr "Konfliktas" + +#: lazarusidestrconsts:lispeconflictfound +msgid "Conflict found" +msgstr "Aptiktas konfliktas" + +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + +#: lazarusidestrconsts:dlginitdoneonly +msgid "Constructor name must be 'init' (destructor must be 'done')" +msgstr "Konstruktoriaus vardas turi būti \"init\" (destruktoriaus - \"done\")" + +#: lazarusidestrconsts:lismenutemplatecontents +msgid "Contents" +msgstr "Turinys" + +#: lazarusidestrconsts:lismenucontexthelp +msgid "Context sensitive Help" +msgstr "Kontekstinis žinynas" + +#: lazarusidestrconsts:liskmcontextsensitivehelp +msgid "Context sensitive help" +msgstr "Kontekstinis žinynas" + +#: lazarusidestrconsts:liscontinue +msgid "Continue" +msgstr "Tęsti" + +#: lazarusidestrconsts:liscontinuewithoutloadingform +msgid "Continue without loading form" +msgstr "Tęsti neįkeliant formos" + +#: lazarusidestrconsts:liscontributors +msgid "Contributors" +msgstr "Talkininkai" + +#: lazarusidestrconsts:srvk_control +msgid "Control" +msgstr "Ctrl" + +#: lazarusidestrconsts:liscontrolneedsparent +msgid "Control needs parent" +msgstr "Valdikliui reikia tėvo" + +#: lazarusidestrconsts:lismakeresstrconversionoptions +msgid "Conversion Options" +msgstr "Konvertavimo parinktys" + +#: lazarusidestrconsts:lisconversionerror +msgid "Conversion error" +msgstr "Klaida konvertuojant" + +#: lazarusidestrconsts:srvk_convert +msgid "Convert" +msgstr "Convert" + +#: lazarusidestrconsts:liskmconvertdfmfiletolfm +msgid "Convert DFM file to LFM" +msgstr "Konvertuoti DFM į LFM" + +#: lazarusidestrconsts:lismenuconvertdfmtolfm +msgid "Convert DFM file to LFM ..." +msgstr "Konvertuoti DFM failą į LFM..." + +#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage +msgid "Convert Delphi package to Lazarus package" +msgstr "Delphi paketą konvertuoti į Lazarus paketą" + +#: lazarusidestrconsts:lismenuconvertdelphipackage +msgid "Convert Delphi package to Lazarus package ..." +msgstr "Konvertuoti Delphi paketą į Lazarus paketą..." + +#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject +msgid "Convert Delphi project to Lazarus project" +msgstr "Konvertuoti Delphi projektą į Lazarus projektą" + +#: lazarusidestrconsts:lismenuconvertdelphiproject +msgid "Convert Delphi project to Lazarus project ..." +msgstr "Konvertuoti Delphi projektą į Lazarus projektą..." + +#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit +msgid "Convert Delphi unit to Lazarus unit" +msgstr "Konvertuoti Delphi modulį į Lazarus modulį" + +#: lazarusidestrconsts:lismenuconvertdelphiunit +msgid "Convert Delphi unit to Lazarus unit ..." +msgstr "Konvertuoti Delphi modulį į Lazarus modulį..." + +#: lazarusidestrconsts:liscodetoolsdefsconvertnode +msgid "Convert node" +msgstr "Konvertuoti mazgą" + +#: lazarusidestrconsts:srkmecselectiontabs2spaces +msgid "Convert tabs to spaces in selection" +msgstr "Pažymėjime tabuliatoriaus simbolius konvertuoti į tarpų simbolius" + +#: lazarusidestrconsts:lismenucopy +msgid "Copy" +msgstr "Kopijuoti" + +#: lazarusidestrconsts:liscopyerror +msgid "Copy Error" +msgstr "Klaida kopijuojant" + +#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard +msgid "Copy all and hidden messages to clipboard" +msgstr "Kopijuoti visus (ir paslėptus) pranešimus į iškarpinę" + +#: lazarusidestrconsts:liscopyallmessagestoclipboard +msgid "Copy all messages to clipboard" +msgstr "Kopijuoti visus pranešimus į iškarpinę" + +#: lazarusidestrconsts:liscopyerror2 +msgid "Copy error" +msgstr "Klaida kopijuojant" + +#: lazarusidestrconsts:uemcopyfilename +msgid "Copy filename" +msgstr "Kopijuoti failo vardą" + +#: lazarusidestrconsts:lisldcopyfrominherited +msgid "Copy from inherited" +msgstr "Kopijuoti iš paveldo" + +#: lazarusidestrconsts:lisplistcopymethodtoclipboard +msgid "Copy method name to the clipboard" +msgstr "Metodo vardą kopijuoti į iškarpinę" + +#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard +msgid "Copy selected Components to clipboard" +msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:lisdsgcopycomponents +msgid "Copy selected components to clipboard" +msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:liscopyselectedmessagestoclipboard +msgid "Copy selected messages to clipboard" +msgstr "Kopijuoti pažymėtus pranešimus į iškarpinę" + +#: lazarusidestrconsts:srkmeccopy +msgid "Copy selection to clipboard" +msgstr "Pažymėtą kopijuoti į iškarpinę" + +#: lazarusidestrconsts:dlgcopywordatcursoroncopynone +msgid "Copy word on copy none" +msgstr "Kai kopijuojant nieks nepažymėta- kopijuoti žodį" + +#: lazarusidestrconsts:liscopyingawholeformisnotimplemented +msgid "Copying a whole form is not implemented." +msgstr "Visos formos kopijavimas dar nėra įgyvendintas." + +#: lazarusidestrconsts:dlgsmbcounter +msgid "Counter (.pp;1)" +msgstr "Skaitliukas (.pp.1)" + +#: lazarusidestrconsts:lisnpcreate +msgid "Create" +msgstr "Sukurti" + +#: lazarusidestrconsts:lismenucreatepofile +msgid "Create .po files" +msgstr "Kurti .po failus" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory +msgid "Create Defines for %s Directory" +msgstr "Sukurti apibrėžtis %s katalogui" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject +msgid "Create Defines for %s Project" +msgstr "Sukurti apibrėžtis projektui %s" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler +msgid "Create Defines for Free Pascal Compiler" +msgstr "Sukurti apibrėžtis FreePascal kompiliatoriui" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources +msgid "Create Defines for Free Pascal SVN Sources" +msgstr "Sukurti apibrėžtis FreePascal SVN pirminiam kodui" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir +msgid "Create Defines for Lazarus Directory" +msgstr "Sukurti apibr4=tis Lazarus katalogui" + +#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory +msgid "Create FPC Macros and paths for a fpc project directory" +msgstr "Sukurti FPC makrokomandas ir kelius FPC projekto katalogui" + +#: lazarusidestrconsts:lismenucreatelazdocfiles +msgid "Create LazDoc files" +msgstr "Kurti LazDoc failus" + +#: lazarusidestrconsts:lispckeditcreatemakefile +msgid "Create Makefile" +msgstr "Sukurti Makefile" + +#: lazarusidestrconsts:lismenueditorcreatesubmenu +msgid "Create Submenu" +msgstr "Sukurti pomenių" + +#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained +msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują cgi programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype +msgid "Create a new editor file.%sChoose a type." +msgstr "Kurti naują redaktoriaus failą.%sNurodykite jo tipą." + +#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile +msgid "Create a new empty text file." +msgstr "Kurti naują tuščią teksto failą." + +#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication +msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują grafinę programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit +msgid "Create a new pascal unit." +msgstr "Kurti naują paskalio modulį." + +#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram +msgid "Create a new program." +msgstr "Kurti naują programą." + +#: lazarusidestrconsts:lisnewdlgcreateanewprogram +msgid "Create a new program.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnpcreateanewproject +msgid "Create a new project" +msgstr "Kurti naują projektą" + +#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype +msgid "Create a new project.%sChoose a type." +msgstr "Kurti naują projektą.%sNurodykite jo tipą." + +#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun +msgid "Create a new standard package.%sA package is a collection of units and components." +msgstr "Kurti naują standartinį paketą.%sPaketas- tai modulių bei komponentų rinkinys." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform +msgid "Create a new unit with a LCL form." +msgstr "Kurti naują modulį su LCL forma." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule +msgid "Create a new unit with a datamodule." +msgstr "Kurti naują modulį su duomenų moduliu." + +#: lazarusidestrconsts:liscreateaprojectfirst +msgid "Create a project first!" +msgstr "Pirma sukurkite projektą!" + +#: lazarusidestrconsts:lisa2pcreatenewfile +msgid "Create new file" +msgstr "Kurti naują failą" + +#: lazarusidestrconsts:liscreatenewproject +msgid "Create new project" +msgstr "Kurti naują projektą" + +#: lazarusidestrconsts:dlgruberbandcreationcolor +msgid "Creation" +msgstr "Kūrimas" + +#: lazarusidestrconsts:srkm_ctrl +msgid "Ctrl" +msgstr "Ctrl" + +#: lazarusidestrconsts:lisedtdefcurrentproject +msgid "Current Project" +msgstr "Veikiamasis projektas" + +#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory +msgid "Current Project Directory" +msgstr "Veikiamasis projekto katalogas" + +#: lazarusidestrconsts:lismenuinsertdatetime +msgid "Current date and time" +msgstr "Dabartinė data ir laikas" + +#: lazarusidestrconsts:lismenuinsertusername +msgid "Current username" +msgstr "Dabartinis naudotojo vardas" + +#: lazarusidestrconsts:dlgcursorbeyondeol +msgid "Cursor beyond EOL" +msgstr "Žymeklis peržengia EOL" + +#: lazarusidestrconsts:liscursorcolumnincurrenteditor +msgid "Cursor column in current editor" +msgstr "Žymeklio stulpelis veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:srkmcatcursormoving +msgid "Cursor moving commands" +msgstr "Žymeklio perkėlimo komandos" + +#: lazarusidestrconsts:liscursorrowincurrenteditor +msgid "Cursor row in current editor" +msgstr "Žymeklio eilutė veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:lispckoptscustom +msgid "Custom" +msgstr "Naudotojo" + +#: lazarusidestrconsts:liscustomprogram +msgid "Custom Program" +msgstr "naudotojo programa" + +#: lazarusidestrconsts:liscustomprogramafreepascalprogram +msgid "Custom Program%sA freepascal program." +msgstr "Naudotojo programa%sFreePascal programa." + +#: lazarusidestrconsts:liskeycatcustom +msgid "Custom commands" +msgstr "Kitos komandos" + +#: lazarusidestrconsts:lismakeresstrcustomidentifier +msgid "Custom identifier" +msgstr "Naudotojo identifikatorius" + +#: lazarusidestrconsts:liscustomoptions2 +msgid "Custom options" +msgstr "Naudotojo parinktys" + +#: lazarusidestrconsts:rsiwpcustomposition +msgid "Custom position" +msgstr "Nurodytas dydis" + +#: lazarusidestrconsts:srkmeccustomtool +msgid "Custom tool %d" +msgstr "Naudotojo įrankis %d" + +#: lazarusidestrconsts:lismenucut +msgid "Cut" +msgstr "Iškirpti" + +#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard +msgid "Cut selected Components to clipboard" +msgstr "Iškirpti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:lisdsgcutcomponents +msgid "Cut selected components to clipboard" +msgstr "Iškirpti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:srkmeccut +msgid "Cut selection to clipboard" +msgstr "Pažymėtą iškirpti į iškarpinę" + +#: lazarusidestrconsts:liswldisableall +msgid "D&isable All" +msgstr "Pasyv&inti visus" + +#: lazarusidestrconsts:lishlpoptsdatabases +msgid "Databases" +msgstr "Duomenų bazės" + +#: lazarusidestrconsts:lisdate +msgid "Date" +msgstr "Data" + +#: lazarusidestrconsts:liswldeleteall +msgid "De&lete All" +msgstr "Paša&linti visus" + +#: lazarusidestrconsts:uemdebugword +msgid "Debug" +msgstr "Derinimas" + +#: lazarusidestrconsts:lismenuviewdebugoutput +msgid "Debug output" +msgstr "Derinimo išvestis" + +#: lazarusidestrconsts:lismenudebugwindows +msgid "Debug windows" +msgstr "Derinimo langai" + +#: lazarusidestrconsts:lismendebuggeroptions +msgid "Debugger Options ..." +msgstr "Derintuvės parinktys..." + +#: lazarusidestrconsts:lisdebuggererror +msgid "Debugger error" +msgstr "Derintuvės klaida" + +#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate +msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." +msgstr "Derintuvės klaida%sAmen! Derintuvė praranda stabilumą!%sNedelsdami išsaugokite darbo rezultatus!%sSpauskite \"Stabdyti\", ir tikėkitės kad viskas baigsis laimingai..." + +#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions +msgid "Debugger general options" +msgstr "Derintuvės pagrindinės parinktys" + +#: lazarusidestrconsts:lisdebuggerinvalid +msgid "Debugger invalid" +msgstr "Netinkama derintuvė" + +#: lazarusidestrconsts:dlgcodebugpath +msgid "Debugger path addition (none):" +msgstr "Papildomas kelias iki derintuvės (joks):" + +#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific +msgid "Debugger specific options (depends on type of debugger)" +msgstr "Derintuvės specifinės parinktys (priklauso nuo derintuvės tipo)" + +#: lazarusidestrconsts:dlgdebugtype +msgid "Debugger type and path" +msgstr "Derintuvės tipas ir failas" + +#: lazarusidestrconsts:dlgcodebugging +msgid "Debugging:" +msgstr "Derinimas:" + +#: lazarusidestrconsts:rsiwpdefault +msgid "Default" +msgstr "Numatytas" + +#: lazarusidestrconsts:dlgdefaulteditorfont +msgid "Default editor font" +msgstr "Numatytas redaktoriaus šriftas" + +#: lazarusidestrconsts:dlgpasext +msgid "Default pascal extension" +msgstr "Numatytas paskalio prievardis" + +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "Numatyta reikšmė" + +#: lazarusidestrconsts:liscodetoolsdefsdefine +msgid "Define" +msgstr "Apibrėžti" + +#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse +msgid "Define Recurse" +msgstr "Rekursyviai apibrėžti" + +#: lazarusidestrconsts:lisctdefdefinetemplates +msgid "Define templates" +msgstr "Apibrėžčių šablonai" + +#: lazarusidestrconsts:dlgeddelay +msgid "Delay" +msgstr "Delsa" + +#: lazarusidestrconsts:dlgeddelete +msgid "Delete" +msgstr "Pašalinti" + +#: lazarusidestrconsts:lismenueditordeletefromtemplate +msgid "Delete From Template..." +msgstr "Pašalinti iš šablono..." + +#: lazarusidestrconsts:lismenueditordeleteitem +msgid "Delete Item" +msgstr "Pašalinti elementą" + +#: lazarusidestrconsts:srkmecdeletelastchar +msgid "Delete Last Char" +msgstr "Pašalinti paskutinį simbolį" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile +msgid "Delete Old Package File?" +msgstr "Ištrinti seną paketo failą?" + +#: lazarusidestrconsts:lisdeleteallthesefiles +msgid "Delete all these files?" +msgstr "Pašalinti visus šiuos failus?" + +#: lazarusidestrconsts:lisdeleteambiguousfile +msgid "Delete ambiguous file?" +msgstr "Ištrinti neaiškųjį failą?" + +#: lazarusidestrconsts:srkmecdeletechar +msgid "Delete char at cursor" +msgstr "Pašalinti simbolį ties žymekliu" + +#: lazarusidestrconsts:srkmecdeleteline +msgid "Delete current line" +msgstr "Pašalinti šią veikiamąją eilutę" + +#: lazarusidestrconsts:lisprojinspdeletedependencyfor +msgid "Delete dependency for %s?" +msgstr "Naikinti %s priklausomybę?" + +#: lazarusidestrconsts:lispkgmangdeletefailed +msgid "Delete failed" +msgstr "Nepavyko ištrinti" + +#: lazarusidestrconsts:lisdeletefilefailed +msgid "Delete file failed" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:liskmdeletelastchar +msgid "Delete last char" +msgstr "Pašalinti paskutinį simbolį" + +#: lazarusidestrconsts:lislazdocdeletelinkbutton +msgid "Delete link" +msgstr "Pašalinti nuorodą" + +#: lazarusidestrconsts:liscodetoolsdefsdeletenode +msgid "Delete node" +msgstr "Pašalinti mazgą" + +#: lazarusidestrconsts:lisdeleteoldfile +msgid "Delete old file %s%s%s?" +msgstr "Ištrinti senąjį failą %s%s%s?" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 +msgid "Delete old package file %s%s%s?" +msgstr "Ištrinti seną paketo failą %s%s%s?" + +#: lazarusidestrconsts:fdmdeleteselection +msgid "Delete selection" +msgstr "Pašalinti pažymėtą" + +#: lazarusidestrconsts:dlgdeltemplate +msgid "Delete template " +msgstr "Pašalinti šabloną" + +#: lazarusidestrconsts:srkmecdeletebol +msgid "Delete to beginning of line" +msgstr "Pašalinti iki eilutės pradžios" + +#: lazarusidestrconsts:srkmecdeleteeol +msgid "Delete to end of line" +msgstr "Pašalinti iki eilutės pabaigos" + +#: lazarusidestrconsts:srkmecdeleteword +msgid "Delete to end of word" +msgstr "Pašalinti iki žodžio pabaigos" + +#: lazarusidestrconsts:srkmecdeletelastword +msgid "Delete to start of word" +msgstr "Pašalinti iki žodžio pradžios" + +#: lazarusidestrconsts:srkmecclearall +msgid "Delete whole text" +msgstr "Pašalinti visą tekstą" + +#: lazarusidestrconsts:lisdeletingoffilefailed +msgid "Deleting of file %s%s%s failed." +msgstr "Nepavyko ištrinti failą %s%s%s." + +#: lazarusidestrconsts:dlgdelphi2ext +msgid "Delphi 2 Extensions" +msgstr "Delphi 2 plėtiniai" + +#: lazarusidestrconsts:dlgdeplhicomp +msgid "Delphi Compatible" +msgstr "Suderinamumas su Delphi" + +#: lazarusidestrconsts:lisdelphiproject +msgid "Delphi project" +msgstr "Delphi projektas" + +#: lazarusidestrconsts:lisa2pdependency +msgid "Dependency" +msgstr "Priklausomybės" + +#: lazarusidestrconsts:lispckeditdependencyproperties +msgid "Dependency Properties" +msgstr "Priklausomybių savybės" + +#: lazarusidestrconsts:lisprojadddependencyalreadyexists +msgid "Dependency already exists" +msgstr "Priklausomybė jau yra" + +#: lazarusidestrconsts:lispkgmangdependencywithoutowner +msgid "Dependency without Owner: %s" +msgstr "Priklausomybė neturi šeimininko: %s" + +#: lazarusidestrconsts:lissortseldescending +msgid "Descending" +msgstr "Mažėjanti" + +#: lazarusidestrconsts:listodoldescription +msgid "Description" +msgstr "Aprašymas" + +#: lazarusidestrconsts:lispckoptsdescriptionabstract +msgid "Description/Abstract" +msgstr "Aprašymas/Santrauka" + +#: lazarusidestrconsts:liscodetoolsdefsdescription +msgid "Description:" +msgstr "Aprašymas:" + +#: lazarusidestrconsts:lisoipdescription +msgid "Description: " +msgstr "Aprašymas:" + +#: lazarusidestrconsts:liskeycatdesigner +msgid "Designer commands" +msgstr "Konstruktoriaus komandos" + +#: lazarusidestrconsts:lispckoptsdesigntimeandruntime +msgid "Designtime and Runtime" +msgstr "Konstravimo bei vykdymo metu" + +#: lazarusidestrconsts:lispckoptsdesigntimeonly +msgid "Designtime only" +msgstr "Tik konstravimo metu" + +#: lazarusidestrconsts:dlgdesktop +msgid "Desktop" +msgstr "Darbastalis" + +#: lazarusidestrconsts:dlgdesktopfiles +msgid "Desktop files" +msgstr "Darbastalio failai" + +#: lazarusidestrconsts:lisaf2pdestinationpackage +msgid "Destination Package" +msgstr "Paskirties paketas" + +#: lazarusidestrconsts:lisdestinationdirectory +msgid "Destination directory" +msgstr "Paskirties katalogas" + +#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete +msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." +msgstr "Tikslo katalogas %s%s%s yra klaidingas.%sNurodykite pilną kelią." + +#: lazarusidestrconsts:lismenudiff +msgid "Diff" +msgstr "Diff" + +#: lazarusidestrconsts:liskmdiffeditorfiles +msgid "Diff editor files" +msgstr "Redaktoriaus failus apdoroti komanda Diff" + +#: lazarusidestrconsts:dlgdirection +msgid "Direction" +msgstr "Kryptis" + +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + +#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory +msgid "Directory" +msgstr "Katalogas" + +#: lazarusidestrconsts:dlgdirectorydoesnotexist +msgid "Directory does not exist" +msgstr "Katalogas nerastas" + +#: lazarusidestrconsts:dlgtestprjdir +msgid "Directory for building test projects" +msgstr "Katalogas testo projektų darymui" + +#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound +msgid "Directory not found" +msgstr "Katalogas nerastas" + +#: lazarusidestrconsts:lisfindfiledirectoryoptions +msgid "Directory options" +msgstr "Katalogo parinktys" + +#: lazarusidestrconsts:lisdiscardchanges +msgid "Discard changes" +msgstr "Neįrašyti pakeitimų" + +#: lazarusidestrconsts:dlgeddisplay +msgid "Display" +msgstr "Ekranas" + +#: lazarusidestrconsts:dlgrunodisplay +msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" +msgstr "Ekranas (neskirta win32; pvz.: 198.112.45.11:0, x.org:1, hydra:0.1)" + +#: lazarusidestrconsts:dlglnumsbct +msgid "Display Line Numbers in Run-time Error Backtraces" +msgstr "Rodyti eilučių numerius veikos metu įvykusių klaidų pėdsako pranešimuose" + +#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda +msgid "Distinguish big and small letters e.g. A and a" +msgstr "Ieškant skirti didžiąsias ir mažąsias raides" + +#: lazarusidestrconsts:dlgcfdividerdrawlevel +msgid "Divider Draw Level" +msgstr "Skirtuko rodymo lygis" + +#: lazarusidestrconsts:lisdonotclosetheide +msgid "Do not close the IDE" +msgstr "Neužveti IKA" + +#: lazarusidestrconsts:lisdonotclosetheproject +msgid "Do not close the project" +msgstr "Neužverti projekto" + +#: lazarusidestrconsts:lispodonotsaveanysessioninfo +msgid "Do not save any session info" +msgstr "Sesijos informacijos neišsaugoti" + +#: lazarusidestrconsts:lisdonotshowsplashscreen +msgid "Do not show splash screen" +msgstr "Nerodyti prisistatymo langelio" + +#: lazarusidestrconsts:lisuedonotsho +msgid "Do not show this message again." +msgstr "Daugiau neberodyti šio pranešimo." + +#: lazarusidestrconsts:dlgnotsplitlinefront +msgid "Do not split line In front of:" +msgstr "Nelaužti eilutės priešais:" + +#: lazarusidestrconsts:dlgnotsplitlineafter +msgid "Do not split line after:" +msgstr "Nelaužti eilutės po:" + +#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand +msgid "Do you really want to forget all changes to package %s and reload it from file?" +msgstr "Ar ištikro norite panaikinti visus keitimus pakete %s ir jį įkelti išnaujo?" + +#: lazarusidestrconsts:lisconfirmlazarusrebuild +msgid "Do you want to rebuild Lazarus?" +msgstr "Daryti Lazarus išnaujo?" + +#: lazarusidestrconsts:rsiwpdocked +msgid "Docked" +msgstr "Įstatytas" + +#: lazarusidestrconsts:lisdocumentationeditor +msgid "Documentation Editor" +msgstr "Dokumentacijos redaktorius" + +#: lazarusidestrconsts:lislazdocnodocumentation +msgid "Documentation entry does not exist" +msgstr "Dokumento įrašas neegzistuoja" + +#: lazarusidestrconsts:lissortseldomain +msgid "Domain" +msgstr "Sritis" + +#: lazarusidestrconsts:dlgdoubleclickline +msgid "Double click line" +msgstr "Spragtelėjus dukart pažymima visa eilutė" + +#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick +msgid "Double click on messages jumps (otherwise: single click)" +msgstr "Spustelėjus dukart ant pranešimo peršoks į pranešamą vietą (kitaip - vienąkart)" + +#: lazarusidestrconsts:dlgdownword +msgid "Down" +msgstr "Apačion" + +#: lazarusidestrconsts:dlgdragdroped +msgid "Drag Drop editing" +msgstr "Redaguojant tekstą galima nuvilkti" + +#: lazarusidestrconsts:dlgdropfiles +msgid "Drop files" +msgstr "Failus galima nuvilkti" + +#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe +msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" +msgstr "Vardai dubliuojasi: komponentas, vardu %s%s%s, jau yra paveldėtame komponente %s" + +#: lazarusidestrconsts:rslanguagedutch +msgid "Dutch" +msgstr "Olandų" + +#: lazarusidestrconsts:liswlenableall +msgid "E&nable All" +msgstr "Įgali&nti visus" + +#: lazarusidestrconsts:lismenuenvironent +msgid "E&nvironment" +msgstr "&Aplinka" + +#: lazarusidestrconsts:liscodetoolsdefsedit +msgid "Edit" +msgstr "Keisti" + +#: lazarusidestrconsts:liskmeditcodetemplates +msgid "Edit Code Templates" +msgstr "Keisti kodo šablonus" + +#: lazarusidestrconsts:lispckediteditgeneraloptions +msgid "Edit General Options" +msgstr "Keisti pagrindines parinktis" + +#: lazarusidestrconsts:srkmeditkeys +msgid "Edit Keys" +msgstr "Keisti klavišus" + +#: lazarusidestrconsts:lispckediteditoptionstocompilepackage +msgid "Edit Options to compile package" +msgstr "Keisti paketo kompiliavimo parinktis" + +#: lazarusidestrconsts:lisedtexttooledittool +msgid "Edit Tool" +msgstr "Keisti įrankį" + +#: lazarusidestrconsts:liscodetempleditcodetemplate +msgid "Edit code template" +msgstr "Keisti kodo šabloną" + +#: lazarusidestrconsts:lismenueditcontexthelp +msgid "Edit context sensitive Help" +msgstr "Redaktoriaus kontekstinis žinynas" + +#: lazarusidestrconsts:liskmeditcontextsensitivehelp +msgid "Edit context sensitive help" +msgstr "Keisti kontekstinį žinyną" + +#: lazarusidestrconsts:srkmeditforcmd +msgid "Edit keys for command" +msgstr "Keisti klavišus komandai" + +#: lazarusidestrconsts:lispvueditvirtualunit +msgid "Edit virtual unit" +msgstr "Keisti virtualų modulį" + +#: lazarusidestrconsts:dlgededit +msgid "Edit..." +msgstr "Keisti..." + +#: lazarusidestrconsts:dlgedfiles +msgid "Editor files" +msgstr "Redaktoriaus failai" + +#: lazarusidestrconsts:dlgeditorfont +msgid "Editor font" +msgstr "Redaktoriaus šriftas" + +#: lazarusidestrconsts:dlgeditorfontheight +msgid "Editor font height" +msgstr "Redaktoriaus šrifto dydis" + +#: lazarusidestrconsts:liskmeditoroptions +msgid "Editor options" +msgstr "Redaktoriaus parinktys" + +#: lazarusidestrconsts:lismenueditoroptions +msgid "Editor options ..." +msgstr "Redaktoriaus parinktys..." + +#: lazarusidestrconsts:uemeditorproperties +msgid "Editor properties" +msgstr "Redaktoriaus savybės" + +#: lazarusidestrconsts:dlgedelement +msgid "Element" +msgstr "Elementas" + +#: lazarusidestrconsts:liscodetoolsdefselse +msgid "Else" +msgstr "Else" + +#: lazarusidestrconsts:liscodetoolsdefselseif +msgid "ElseIf" +msgstr "ElseIf" + +#: lazarusidestrconsts:lisenablemacros +msgid "Enable Macros" +msgstr "Įgalinti makrokomandas" + +#: lazarusidestrconsts:lisenabled +msgid "Enabled" +msgstr "Veiksnus" + +#: lazarusidestrconsts:lisanchorenabledhint +msgid "Enabled = Include %s in Anchors" +msgstr "Veiksnus = %s įtraukti į prieraišų sąrašą" + +#: lazarusidestrconsts:lisenclose +msgid "Enclose" +msgstr "Apgaubti" + +#: lazarusidestrconsts:uemencloseselection +msgid "Enclose Selection" +msgstr "Apgaubti pažymėtąjį" + +#: lazarusidestrconsts:liskmencloseselection +msgid "Enclose selection" +msgstr "Apgaubti pažymėtąjį" + +#: lazarusidestrconsts:lismenuencloseselection +msgid "Enclose selection ..." +msgstr "Apgaubti pažymėtąjį..." + +#: lazarusidestrconsts:srvk_end +msgid "End" +msgstr "End" + +#: lazarusidestrconsts:rslanguageenglish +msgid "English" +msgstr "Anglų" + +#: lazarusidestrconsts:lismacropromptenterdata +msgid "Enter data" +msgstr "Įveskite duomenis" + +#: lazarusidestrconsts:lismacropromptenterrunparameters +msgid "Enter run parameters" +msgstr "Įveskite starto parametrus" + +#: lazarusidestrconsts:lisentertransla +msgid "Enter translation language" +msgstr "Įveskite vertimo kalbą" + +#: lazarusidestrconsts:dlgentirescope +msgid "Entire Scope" +msgstr "Visoje srityje" + +#: lazarusidestrconsts:dlgrunoenvironment +msgid "Environment" +msgstr "Aplinka" + +#: lazarusidestrconsts:srkmcatenvmenu +msgid "Environment menu commands" +msgstr "Meniu \"Aplinka\" komandos" + +#: lazarusidestrconsts:lismenugeneraloptions +msgid "Environment options ..." +msgstr "Aplinkos parinktys..." + +#: lazarusidestrconsts:liscodetemplerror +msgid "Error" +msgstr "Klaida" + +#: lazarusidestrconsts:lispkgmangerrorreadingpackage +msgid "Error Reading Package" +msgstr "Klaida skaitant paketo failą" + +#: lazarusidestrconsts:lispkgmangerrorwritingpackage +msgid "Error Writing Package" +msgstr "Klaida išsaugant paketą" + +#: lazarusidestrconsts:lisiecoerroraccessingxml +msgid "Error accessing xml" +msgstr "Klaida kreipiantis į XML" + +#: lazarusidestrconsts:lisiecoerroraccessingxmlfile +msgid "Error accessing xml file %s%s%s:%s%s" +msgstr "Įvyko klaida kreipiantis į XML falą %s%s%s:%s%s" + +#: lazarusidestrconsts:liserrorcreatingfile +msgid "Error creating file" +msgstr "Klaida kuriant failą" + +#: lazarusidestrconsts:liserrorcreatinglrs +msgid "Error creating lrs" +msgstr "Klaida kuriant LRS" + +#: lazarusidestrconsts:liserrordeletingfile +msgid "Error deleting file" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:liserrorin +msgid "Error in %s" +msgstr "%s klaida" + +#: lazarusidestrconsts:lisueerrorinregularexpression +msgid "Error in regular expression" +msgstr "Klaidingas reguliarusis reiškinys" + +#: lazarusidestrconsts:liserrorinitializingprogramserrors +msgid "Error initializing program%s%s%s%s%sError: %s" +msgstr "Įvyko klaida inicializuojant programą%s%s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisiecoerrorloadingxml +msgid "Error loading xml" +msgstr "Klaida įkeliant XML" + +#: lazarusidestrconsts:lisiecoerrorloadingxmlfile +msgid "Error loading xml file %s%s%s:%s%s" +msgstr "Įvyko klaida įkeliant XML failą %s%s%s:%s%s" + +#: lazarusidestrconsts:liserrormovingcomponent +msgid "Error moving component" +msgstr "Klaida perkeliant komponentę" + +#: lazarusidestrconsts:liserrormovingcomponent2 +msgid "Error moving component %s:%s" +msgstr "Įvyko klaida perkeliant komponentę %s:%s" + +#: lazarusidestrconsts:liserrorparsinglfmcomponentstream +msgid "Error parsing lfm component stream." +msgstr "Įvyko klaida analizuojant lfm komponentės srautą." + +#: lazarusidestrconsts:liscodetoolsdefserrorreading +msgid "Error reading %s%s%s%s%s" +msgstr "Įvyko klaida įkeliant %s%s%s%s%s" + +#: lazarusidestrconsts:lispkgmangerrorreadingfile +msgid "Error reading file" +msgstr "Klaida įkeliant failą" + +#: lazarusidestrconsts:lisdiskdifferrorreadingfile +msgid "Error reading file: %s" +msgstr "Klaida skaitant failą: %s" + +#: lazarusidestrconsts:liserrorreadingpackagelistfromfile +msgid "Error reading package list from file%s%s%s%s" +msgstr "Įvyko klaida įkeliant paketų sąrašą iš failo%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile +msgid "Error reading project info file %s%s%s%s%s" +msgstr "Įvyko klaida įkeliant informacijos apie projektą failą %s%s%s%s%s" + +#: lazarusidestrconsts:liserrorrenamingfile +msgid "Error renaming file" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting +msgid "Error while writing %s%s%s%s%s" +msgstr "Įvyko klaida rašant %s%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile +msgid "Error while writing project info file %s%s%s%s%s" +msgstr "Įvyko klaida rašant į informacijos apie projektą failą %s%s%s%s" + +#: lazarusidestrconsts:lispkgmangerrorwritingfile +msgid "Error writing file" +msgstr "Klaida rašant į failą" + +#: lazarusidestrconsts:liserrorwritingpackagelisttofile +msgid "Error writing package list to file%s%s%s%s" +msgstr "Įvyko klaida rašant paketo sąrašą į failą%s%s%s%s" + +#: lazarusidestrconsts:liserror +msgid "Error: " +msgstr "Klaida:" + +#: lazarusidestrconsts:liscompilererrorinvalidcompiler +msgid "Error: invalid compiler: %s" +msgstr "Klaida: klaidingas kompiliatorius: %s" + +#: lazarusidestrconsts:liserrors +msgid "Errors" +msgstr "Klaidos" + +#: lazarusidestrconsts:srvk_escape +msgid "Escape" +msgstr "Esc" + +#: lazarusidestrconsts:liskmevaluatemodify +msgid "Evaluate/Modify" +msgstr "Įvertinti/Modifikuoti" + +#: lazarusidestrconsts:lismenuevaluate +msgid "Evaluate/Modify ..." +msgstr "Įvertinti/Modifikuoti..." + +#: lazarusidestrconsts:lisdebugoptionsfrmeventlog +msgid "Event Log" +msgstr "Įvykių žurnalas" + +#: lazarusidestrconsts:lislazdocexampletag +msgid "Example" +msgstr "Pavyzdys" + +#: lazarusidestrconsts:lisexamples +msgid "Examples" +msgstr "Pavyzdžiai" + +#: lazarusidestrconsts:lisexcludefilter +msgid "Exclude Filter" +msgstr "Neįtraukimo filtras" + +#: lazarusidestrconsts:srvk_execute +msgid "Execute" +msgstr "Execute" + +#: lazarusidestrconsts:liscoexecuteafter +msgid "Execute after" +msgstr "Startuoti po" + +#: lazarusidestrconsts:liscoexecutebefore +msgid "Execute before" +msgstr "Startuoti prieš" + +#: lazarusidestrconsts:lisexecutingcommandafter +msgid "Executing command after" +msgstr "Startuojama komanda po" + +#: lazarusidestrconsts:lisexecutingcommandbefore +msgid "Executing command before" +msgstr "Startuojama komanda prieš" + +#: lazarusidestrconsts:lisexecutionpaused +msgid "Execution paused" +msgstr "Veika pristabdyta" + +#: lazarusidestrconsts:lisexecutionpausedadress +msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" +msgstr "Veika pristabdyta%s Adresas: $%s%s Procedūra: %s%s Failas: %s%s(Tarp kitko, kadanors čia turėtų pasirodyti asemblerio langas :)%s" + +#: lazarusidestrconsts:lisexecutionstopped +msgid "Execution stopped" +msgstr "Veika sustabdyta" + +#: lazarusidestrconsts:lisexecutionstoppedon +msgid "Execution stopped%s" +msgstr "Veika sustabdyta%s" + +#: lazarusidestrconsts:liscodetoolsdefsexit +msgid "Exit" +msgstr "Išeiti" + +#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave +msgid "Exit without Save" +msgstr "Išeiti neišsaugojus" + +#: lazarusidestrconsts:lisexpandallclasses +msgid "Expand all classes" +msgstr "Išskleisti visas klases" + +#: lazarusidestrconsts:lisexpandallpackages +msgid "Expand all packages" +msgstr "Išsklaeisti visus paketus" + +#: lazarusidestrconsts:lisexpandallunits +msgid "Expand all units" +msgstr "Išskleiti visus modulius" + +#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor +msgid "Expanded filename of current editor file" +msgstr "Veikiamojo redaktoriaus failo vardas su pilnu keliu iki jo" + +#: lazarusidestrconsts:lisexport +msgid "Export ..." +msgstr "Eksportas..." + +#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti +msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" +msgstr "Eksportuojamas failas %s%s%s jau yra.%sAtverti failą ir jame įrašyti tik kompiliatoriaus parinktis?%s(Kitos faile esančios nuostatos lik tokios pačios.)" + +#: lazarusidestrconsts:lisiecoexportfileexists +msgid "Export file exists" +msgstr "Eksportuojamas failas egzistuoja" + +#: lazarusidestrconsts:lisexportlist +msgid "Export list" +msgstr "Eksportuoti sąrašą" + +#: lazarusidestrconsts:liswlexpression +msgid "Expression" +msgstr "Išraiška" + +#: lazarusidestrconsts:lisextendunitpath +msgid "Extend unit path?" +msgstr "Išplėsti modulio kelią?" + +#: lazarusidestrconsts:liskmexternaltoolssettings +msgid "External Tools settings" +msgstr "Išorinių įrankių nuostatos" + +#: lazarusidestrconsts:srkmecexttool +msgid "External tool %d" +msgstr "Išorės įrankis %d" + +#: lazarusidestrconsts:lisexttoolexternaltools +msgid "External tools" +msgstr "Išorės įrankiai" + +#: lazarusidestrconsts:srkmecexttoolsettings +msgid "External tools settings" +msgstr "Išorės įrankių nuostatos" + +#: lazarusidestrconsts:dlgextralinespacing +msgid "Extra line spacing" +msgstr "Papildomas tarpas tarp eilučių" + +#: lazarusidestrconsts:lisextract +msgid "Extract" +msgstr "Ištraukti" + +#: lazarusidestrconsts:uemextractproc +msgid "Extract Procedure" +msgstr "Ištraukti procedūrą" + +#: lazarusidestrconsts:srkmecextractproc +msgid "Extract procedure" +msgstr "Ištraukti procedūrą" + +#: lazarusidestrconsts:lismenuextractproc +msgid "Extract procedure ..." +msgstr "Ištraukti procedūrą..." + +#: lazarusidestrconsts:lishofpcdochtmlpath +msgid "FPC Doc HTML Path" +msgstr "FPC Doc HTML kelias" + +#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory +msgid "FPC SVN source directory" +msgstr "FPC SVN pirminio kodo katalogas" + +#: lazarusidestrconsts:lisfpcsourcedirectoryerror +msgid "FPC Source Directory error" +msgstr "FPC pirminio kodo katalogo klaida" + +#: lazarusidestrconsts:dlgfpcsrcpath +msgid "FPC source directory" +msgstr "FPC pirminio kodo katalogas" + +#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg +msgid "FPC source directory \"%s\" not found." +msgstr "Nerastas FPC pirminio kodo katalogas \"%s\"." + +#: lazarusidestrconsts:lisexttoolfailedtoruntool +msgid "Failed to run tool" +msgstr "Nepavyko startuoti įrankį" + +#: lazarusidestrconsts:dlgcofast +msgid "Faster Code" +msgstr "Greitesnį kodą" + +#: lazarusidestrconsts:listodolfile +msgid "File" +msgstr "Failas" + +#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject +msgid "File %s%s%s already exists in the project." +msgstr "Failas %s%s%s projekte jau yra." + +#: lazarusidestrconsts:lisfilehaschangedsave +msgid "File %s%s%s has changed. Save?" +msgstr "Failas %s%s%s pakeistas. Išsaugoti?" + +#: lazarusidestrconsts:lisfileisvirtual +msgid "File %s%s%s is virtual." +msgstr "Failas %s%s%s yra virtualus." + +#: lazarusidestrconsts:lispkgmangfilenotfound +msgid "File %s%s%s not found." +msgstr "Failas %s%s%s nerastas." + +#: lazarusidestrconsts:lisfilenotfound2 +msgid "File %s%s%s not found.%s" +msgstr "Failas %s%s%s nerastas.%s" + +#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit +msgid "File %s%s%s not found.%sDo you want to create it?%s" +msgstr "Failas %s%s%s nerastas.%sJį sukurti?%s" + +#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway +msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" +msgstr "Nepanašu kad failas %s%s%s%s yra teksto failas.%sVistiek jį atverti?" + +#: lazarusidestrconsts:lispckeditfileproperties +msgid "File Properties" +msgstr "Failo savybės" + +#: lazarusidestrconsts:lisaf2pfiletype +msgid "File Type" +msgstr "Failo tipas" + +#: lazarusidestrconsts:lisa2pfilealreadyexists +msgid "File already exists" +msgstr "Failas jau egzistuoja" + +#: lazarusidestrconsts:lisa2pfilealreadyinpackage +msgid "File already in package" +msgstr "Pakete jau yra toks failas" + +#: lazarusidestrconsts:dlgfileexts +msgid "File extensions" +msgstr "Failų prievardžiai" + +#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage +msgid "File is already in package" +msgstr "Pakete yra toks failas" + +#: lazarusidestrconsts:lispkgmangfileisinproject +msgid "File is in Project" +msgstr "Projekto failas" + +#: lazarusidestrconsts:lisfileisnotwritable +msgid "File is not writable" +msgstr "Failas tik skaitymui" + +#: lazarusidestrconsts:uefilerocap +msgid "File is readonly" +msgstr "Failas tik skaitymui" + +#: lazarusidestrconsts:lisa2pfileisused +msgid "File is used" +msgstr "Failas jau naudojamas" + +#: lazarusidestrconsts:lisfindfilefilemaskbak +msgid "File mask (*;*.*;*.bak?)" +msgstr "Failų vardų kaukė (*;*.*;*.bak?)" + +#: lazarusidestrconsts:srkmcatfilemenu +msgid "File menu commands" +msgstr "Meniu \"Failas\" komandos" + +#: lazarusidestrconsts:lisa2pfilename +msgid "File name:" +msgstr "Failo vardas:" + +#: lazarusidestrconsts:lisrunparamsfilenotexecutable +msgid "File not executable" +msgstr "Failas nėra vykdomasis" + +#: lazarusidestrconsts:lisfilenotfound +msgid "File not found" +msgstr "Failas nerastas" + +#: lazarusidestrconsts:lisfilenotlowercase +msgid "File not lowercase" +msgstr "Failo vardas ne mažosiomis raidėmis" + +#: lazarusidestrconsts:lispkgmangfilenotsaved +msgid "File not saved" +msgstr "Failas neišsaugotas" + +#: lazarusidestrconsts:lisfilenottext +msgid "File not text" +msgstr "Neteksto failas" + +#: lazarusidestrconsts:lisa2pfilenotunit +msgid "File not unit" +msgstr "Failas nėra modulis" + +#: lazarusidestrconsts:lisa2pfilename2 +msgid "Filename" +msgstr "Failo vardas" + +#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename +msgid "Filename differs from Packagename" +msgstr "Failo ir paketo vardai skiriasi" + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage +msgid "Filename is used by other package" +msgstr "Failo vardą naudoja kitas paketas" + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject +msgid "Filename is used by project" +msgstr "Failo vardą naudoja projektas" + +#: lazarusidestrconsts:lispefilename +msgid "Filename:" +msgstr "Failo vardas:" + +#: lazarusidestrconsts:lisoipfilename +msgid "Filename: %s" +msgstr "Failo vardas: %s" + +#: lazarusidestrconsts:dlgenvfiles +msgid "Files" +msgstr "Failai" + +#: lazarusidestrconsts:lisfilter +msgid "Filter" +msgstr "Filtras" + +#: lazarusidestrconsts:lisplistfilterany +msgid "Filter by matching any part of method" +msgstr "Filtruoti pagal bet kurią metodo dalį" + +#: lazarusidestrconsts:lisplistfilterstart +msgid "Filter by matching with start of method" +msgstr "Filtruoti pagal metodo pradžią" + +#: lazarusidestrconsts:srvk_final +msgid "Final" +msgstr "Final" + +#: lazarusidestrconsts:lismenufind +msgid "Find" +msgstr "Paieška" + +#: lazarusidestrconsts:lismenufindnext +msgid "Find &Next" +msgstr "Ieškoti &toliau" + +#: lazarusidestrconsts:lismenufindprevious +msgid "Find &Previous" +msgstr "Ieškoti an&kstesnio" + +#: lazarusidestrconsts:lismenufindinfiles +msgid "Find &in files ..." +msgstr "&Ieškoti failuose..." + +#: lazarusidestrconsts:lismenufind2 +msgid "Find ..." +msgstr "Ieškoti..." + +#: lazarusidestrconsts:lismenufinddeclarationatcursor +msgid "Find Declaration at cursor" +msgstr "Ieškoti ties žymekliu nurodytojo paskelbimo" + +#: lazarusidestrconsts:uemfindidentifierreferences +msgid "Find Identifier References" +msgstr "Ieškoti identifikatoriaus įrašų" + +#: lazarusidestrconsts:lismenufindidentifierrefs +msgid "Find Identifier References ..." +msgstr "Ieškoti identifikatoriaus įrašų..." + +#: lazarusidestrconsts:lismenutemplatefindnext +msgid "Find Next" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:lisfrifindreferences +msgid "Find References" +msgstr "Ieškoti įrašų" + +#: lazarusidestrconsts:srkmecfindblockotherend +msgid "Find block other end" +msgstr "Ieškoti bloko kito galo" + +#: lazarusidestrconsts:srkmecfindblockstart +msgid "Find block start" +msgstr "Ieškoti bloko pradžios" + +#: lazarusidestrconsts:lismenufindcodeblockstart +msgid "Find code block start" +msgstr "Ieškoti kodo bloko pradžios" + +#: lazarusidestrconsts:liscomppalfindcomponent +msgid "Find component" +msgstr "Ieškoti komponentės" + +#: lazarusidestrconsts:srkmecfinddeclaration +msgid "Find declaration" +msgstr "Ieškoti paskelbimo" + +#: lazarusidestrconsts:srkmecfindidentifierrefs +msgid "Find identifier references" +msgstr "Ieškoti identifikatoriaus įrašų" + +#: lazarusidestrconsts:srkmecfindinfiles +msgid "Find in files" +msgstr "Ieškoti failuose" + +#: lazarusidestrconsts:liskmfindincremental +msgid "Find incremental" +msgstr "Prieauginė paieška" + +#: lazarusidestrconsts:srkmecfindnext +msgid "Find next" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:srkmecfindnextwordoccurrence +msgid "Find next word occurrence" +msgstr "Ieškoti žodžio toliau" + +#: lazarusidestrconsts:lisfrifindorrenameidentifier +msgid "Find or Rename Identifier" +msgstr "Ieškoti identifikatoriaus arba jį pervardyti" + +#: lazarusidestrconsts:lismenufindblockotherendofcodeblock +msgid "Find other end of code block" +msgstr "Ieškoti kodo bloko kitos pabaigos" + +#: lazarusidestrconsts:lisfpfindpalettecomponent +msgid "Find palette component" +msgstr "Ieškoti komponentės paletėje" + +#: lazarusidestrconsts:srkmecfindprevious +msgid "Find previous" +msgstr "Ieškoti ankstesnio" + +#: lazarusidestrconsts:srkmecfindprevwordoccurrence +msgid "Find previous word occurrence" +msgstr "Ieškoti žodžio atgaline tvarka" + +#: lazarusidestrconsts:srkmecfindproceduredefinition +msgid "Find procedure definiton" +msgstr "Ieškoti procedūros apibrėžties" + +#: lazarusidestrconsts:srkmecfindproceduremethod +msgid "Find procedure method" +msgstr "Ieškoti procedūros metodo" + +#: lazarusidestrconsts:srkmecfind +msgid "Find text" +msgstr "Ieškoti teksto" + +#: lazarusidestrconsts:dlgfindtextatcursor +msgid "Find text at cursor" +msgstr "Ieškoti ties žymekliu esančio teksto" + +#: lazarusidestrconsts:rslanguagefinnish +msgid "Finnish" +msgstr "Suomių" + +#: lazarusidestrconsts:lisfixlfmfile +msgid "Fix LFM file" +msgstr "LFM failo taisa" + +#: lazarusidestrconsts:srkmecjumptoeditor +msgid "Focus to source editor" +msgstr "Aktyvuoti pirminio kodo redaktorių" + +#: lazarusidestrconsts:liscefollowcursor +msgid "Follow cursor" +msgstr "Sekti žymeklį" + +#: lazarusidestrconsts:lisuefontwith +msgid "Font without UTF-8" +msgstr "Ne UTF-8 šriftas" + +#: lazarusidestrconsts:lisforcerenaming +msgid "Force renaming" +msgstr "Vistiek pervardyti" + +#: lazarusidestrconsts:dlgforecolor +msgid "Foreground color" +msgstr "Priekinė spalva" + +#: lazarusidestrconsts:dlgfrmeditor +msgid "Form Editor" +msgstr "Formų konstruktorius" + +#: lazarusidestrconsts:rsformdatafiledfm +msgid "Form data file (*.dfm)|*.dfm" +msgstr "Formos duomenų failas (*.dfm)|*.dfm" + +#: lazarusidestrconsts:lisformloaderror +msgid "Form load error" +msgstr "Klaida įkeliant formą" + +#: lazarusidestrconsts:lisformaterror +msgid "Format error" +msgstr "Formato klaida" + +#: lazarusidestrconsts:dlgpofroms +msgid "Forms" +msgstr "Formos" + +#: lazarusidestrconsts:lismenuviewforms +msgid "Forms..." +msgstr "Formos..." + +#: lazarusidestrconsts:fdmorderforwardone +msgid "Forward one" +msgstr "Vienu pirmyn" + +#: lazarusidestrconsts:lisfrforwardsearch +msgid "Forward search" +msgstr "Ieškoti pirmyn" + +#: lazarusidestrconsts:lisfreepascalcompilernotfound +msgid "Free Pascal Compiler not found" +msgstr "Nerastas FreePascal kompiliatorius" + +#: lazarusidestrconsts:lisfreepascalsourcesnotfound +msgid "Free Pascal Sources not found" +msgstr "Nerasti FreePascal pirminiai kodai" + +#: lazarusidestrconsts:lisfreepascalsourcefile +msgid "FreePascal source file" +msgstr "FreePascal pirminio kodo failas" + +#: lazarusidestrconsts:lisfreepascalsourcedirectory +msgid "Freepascal source directory" +msgstr "FreePascal pirminio kodo katalogas" + +#: lazarusidestrconsts:rslanguagefrench +msgid "French" +msgstr "Prancūzų" + +#: lazarusidestrconsts:dlgfromcursor +msgid "From Cursor" +msgstr "Nuo žymeklio" + +#: lazarusidestrconsts:listmfunctionappendpathdelimiter +msgid "Function: append path delimiter" +msgstr "Funkcija: kelio gale pridėti kelio skirtuką" + +#: lazarusidestrconsts:listmfunctionchomppathdelimiter +msgid "Function: chomp path delimiter" +msgstr "Funkcija: pašalinti kelio gale esantį skirtuką" + +#: lazarusidestrconsts:listmfunctionextractfileextension +msgid "Function: extract file extension" +msgstr "Funkcija: ištraukti tik failo prievardį" + +#: lazarusidestrconsts:listmfunctionextractfilenameonly +msgid "Function: extract file name only" +msgstr "Funkcija: ištraukti tik failo vardą" + +#: lazarusidestrconsts:listmfunctionextractfilenameextension +msgid "Function: extract file name+extension" +msgstr "Funkcija: ištraukti failo vardą ir prievardį" + +#: lazarusidestrconsts:listmfunctionextractfilepath +msgid "Function: extract file path" +msgstr "Funkcija: ištraukti tik kelią" + +#: lazarusidestrconsts:dlggpccomp +msgid "GPC (GNU Pascal Compiler) Compatible" +msgstr "Suderinamumas su GPC (GNU Pascal Compiler)" + +#: lazarusidestrconsts:lismenuinsertgplnotice +msgid "GPL notice" +msgstr "GPL raštas" + +#: lazarusidestrconsts:lismenuinsertgeneral +msgid "General" +msgstr "Pagrindinis" + +#: lazarusidestrconsts:lispckeditgeneraloptions +msgid "General Options" +msgstr "Pagrindinės parinktys" + +#: lazarusidestrconsts:srkmecenvironmentoptions +msgid "General environment options" +msgstr "Pagrindinės aplinkos parinktys" + +#: lazarusidestrconsts:dlgcodbx +msgid "Generate Debugging Info For DBX (Slows Compiling)" +msgstr "Kurti \"DBX\" skirtą derinimo informaciją (sulėtins kompiliavimą)" + +#: lazarusidestrconsts:dlgcogdb +msgid "Generate Debugging Info For GDB (Slows Compiling)" +msgstr "Kurti \"GDB\" skirtą derinimo informaciją (sulėtins kompiliavimą)" + +#: lazarusidestrconsts:dlggprof +msgid "Generate code for gprof" +msgstr "Kurti \"gprof\" skirtą kodą" + +#: lazarusidestrconsts:dlgcovalgrind +msgid "Generate code for valgrind" +msgstr "Kurti \"valgrind\" skirtą kodą" + +#: lazarusidestrconsts:dlgcogenerate +msgid "Generate:" +msgstr "Generuoti:" + +#: lazarusidestrconsts:rslanguagegerman +msgid "German" +msgstr "Vokiečių" + +#: lazarusidestrconsts:dlggetposition +msgid "Get position" +msgstr "Sužinoti poziciją" + +#: lazarusidestrconsts:dlgglobal +msgid "Global" +msgstr "Globaliai" + +#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition +msgid "Global Source Path addition" +msgstr "Priedas prie pradinio kodo globalaus katalogo" + +#: lazarusidestrconsts:srkmecgotomarker +msgid "Go to Marker %d" +msgstr "Rodyti žymeklį %d" + +#: lazarusidestrconsts:srkmecgotoeditor +msgid "Go to editor %d" +msgstr "Rodyti %s redaktorių" + +#: lazarusidestrconsts:srkmecgotolinenumber +msgid "Go to line number" +msgstr "Rodyti eilutę nurodytu numeriu" #: lazarusidestrconsts:liskmgotomarker0 msgid "Go to marker 0" @@ -4991,6 +3383,3798 @@ msgstr "Rodyti žymeklį 8" msgid "Go to marker 9" msgstr "Rodyti žymeklį 9" +#: lazarusidestrconsts:srkmecmatchbracket +msgid "Go to matching bracket" +msgstr "Eiti prie skliausto porininko" + +#: lazarusidestrconsts:srkmecnexteditor +msgid "Go to next editor" +msgstr "Eiti į tolesnį redaktorių" + +#: lazarusidestrconsts:srkmecpreveditor +msgid "Go to prior editor" +msgstr "Eiti į ankstesni redaktorių" + +#: lazarusidestrconsts:liskmgotosourceeditor1 +msgid "Go to source editor 1" +msgstr "Rodyti pirminio kodo redaktoriaus 1 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor10 +msgid "Go to source editor 10" +msgstr "Rodyti pirminio kodo redaktoriaus 10 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor2 +msgid "Go to source editor 2" +msgstr "Rodyti pirminio kodo redaktoriaus 2 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor3 +msgid "Go to source editor 3" +msgstr "Rodyti pirminio kodo redaktoriaus 3 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor4 +msgid "Go to source editor 4" +msgstr "Rodyti pirminio kodo redaktoriaus 4 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor5 +msgid "Go to source editor 5" +msgstr "Rodyti pirminio kodo redaktoriaus 5 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor6 +msgid "Go to source editor 6" +msgstr "Rodyti pirminio kodo redaktoriaus 6 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor7 +msgid "Go to source editor 7" +msgstr "Rodyti pirminio kodo redaktoriaus 7 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor8 +msgid "Go to source editor 8" +msgstr "Rodyti pirminio kodo redaktoriaus 8 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor9 +msgid "Go to source editor 9" +msgstr "Rodyti pirminio kodo redaktoriaus 9 kortelę" + +#: lazarusidestrconsts:srkmecgotoincludedirective +msgid "Go to to include directive of current include file" +msgstr "Rodyti veikiamojo įdėtojo failo įdėjimo direktyvą" + +#: lazarusidestrconsts:listodogoto +msgid "Goto" +msgstr "Rodyk kur" + +#: lazarusidestrconsts:srkmecgotoxy +msgid "Goto XY" +msgstr "Eiti į poziciją" + +#: lazarusidestrconsts:lismenugotoincludedirective +msgid "Goto include directive" +msgstr "Rodyti įterpimo direktyvą" + +#: lazarusidestrconsts:lismenugotoline +msgid "Goto line ..." +msgstr "Rodyti eilutę..." + +#: lazarusidestrconsts:lisuegotoline +msgid "Goto line :" +msgstr "Rodyti eilutę:" + +#: lazarusidestrconsts:uemnextbookmark +msgid "Goto next Bookmark" +msgstr "Rodyti tolesnę žymę" + +#: lazarusidestrconsts:uemprevbookmark +msgid "Goto previous Bookmark" +msgstr "Rodyti ankstesnę žymę" + +#: lazarusidestrconsts:listodolistgotoline +msgid "Goto selected source line" +msgstr "Rodyti eilutę pirminiame kode" + +#: lazarusidestrconsts:srkmgrabkey +msgid "Grab key" +msgstr "Susekti klavišą" + +#: lazarusidestrconsts:srkmgrabsecondkey +msgid "Grab second key" +msgstr "Susekti kitą klavišą" + +#: lazarusidestrconsts:dlggrabbercolor +msgid "Grabber color" +msgstr "Rankenėlės spalva" + +#: lazarusidestrconsts:dlgenvgrid +msgid "Grid" +msgstr "Tinklelis" + +#: lazarusidestrconsts:dlggridcolor +msgid "Grid color" +msgstr "Tinklelio spalva" + +#: lazarusidestrconsts:dlggridx +msgid "Grid size X" +msgstr "Tinklelio tarpai X" + +#: lazarusidestrconsts:dlggridy +msgid "Grid size Y" +msgstr "Tinklelio tarpai Y" + +#: lazarusidestrconsts:dlggroupundo +msgid "Group Undo" +msgstr "Grupinis grąžinimas" + +#: lazarusidestrconsts:srkmecguessmisplacedifdef +msgid "Guess misplaced $IFDEF" +msgstr "Nuspėti nevietoj esančius $IFDEF" + +#: lazarusidestrconsts:lismenuguessmisplacedifdef +msgid "Guess misplaced IFDEF/ENDIF" +msgstr "Nuspėti nevietoj esančius $IFDEF/$ENDIF" + +#: lazarusidestrconsts:lismenuguessunclosedblock +msgid "Guess unclosed block" +msgstr "Nuspėti neužbaigtus blokus" + +#: lazarusidestrconsts:dlgenvlguidelines +msgid "Guide lines" +msgstr "Pagalbinės linijos" + +#: lazarusidestrconsts:dlgguttercolor +msgid "Gutter color" +msgstr "Kairiosios paraštės spalva" + +#: lazarusidestrconsts:dlggutterwidth +msgid "Gutter width" +msgstr "Kairiosios paraštės plotis" + +#: lazarusidestrconsts:dlghalfpagescroll +msgid "Half page scroll" +msgstr "Slikti tik per puse lapo" + +#: lazarusidestrconsts:lismenueditorhandleonclickevent +msgid "Handle OnClick Event" +msgstr "Apdoroti OnClick įvykį" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledby +msgid "Handled by" +msgstr "Apdoroja" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger +msgid "Handled by Debugger" +msgstr "Apdoroja derintuvė" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram +msgid "Handled by Program" +msgstr "Apdoroja programa" + +#: lazarusidestrconsts:srvk_hanja +msgid "Hanja" +msgstr "Hanja" + +#: lazarusidestrconsts:lisaf2phasregisterprocedure +msgid "Has Register procedure" +msgstr "Turi procedūra Register" + +#: lazarusidestrconsts:lisheadercommentforclass +msgid "Header comment for class" +msgstr "Antraštinis komentaras klasei" + +#: lazarusidestrconsts:dlgheapsize +msgid "Heap Size" +msgstr "Krūvos dydį" + +#: lazarusidestrconsts:rslanguagehebrew +msgid "Hebrew" +msgstr "Žydų" + +#: lazarusidestrconsts:dlgheightpos +msgid "Height:" +msgstr "Aukštis:" + +#: lazarusidestrconsts:srvk_help +msgid "Help" +msgstr "Help" + +#: lazarusidestrconsts:lishlpoptshelpoptions +msgid "Help Options" +msgstr "Žinyno parinktys" + +#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage +msgid "Help for FreePascal Compiler message" +msgstr "Informacija apie FreePascal Compiler pranešimą" + +#: lazarusidestrconsts:srkmcarhelpmenu +msgid "Help menu commands" +msgstr "Meniu \"Žinynas\" komandos" + +#: lazarusidestrconsts:lishelpselectordialog +msgid "Help selector" +msgstr "Žinyno parinktys" + +#: lazarusidestrconsts:dlghideideonrun +msgid "Hide IDE windows on run" +msgstr "Startuojant programą slėpti IKA langus" + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 +msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." +msgstr "Užuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos.%sPažymėkite tik eilutės reiškinį ir bandykite vėl." + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon +msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." +msgstr "Funkcijai \"Kurti išteklių eilutę\" reikia pažymėtos teksto konstantos.%sTad pažymėkite išraišką ir bandykite vėl." + +#: lazarusidestrconsts:dlgedhintcommand +msgid "Hint: click on the command you want to edit" +msgstr "Užuomina: spustelkite kairį pelės mygtuką ant komandos, kurią norite keisti" + +#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath +msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" +msgstr "Užuomina: kompiliatoriaus programą galite nurodyti \"Aplinka -> Aplinkos parinktys -> Failai -> Kompiliatoriaus programa\"." + +#: lazarusidestrconsts:dlgpalhints +msgid "Hints for component palette" +msgstr "Sufleriai komponenčių paletei" + +#: lazarusidestrconsts:dlgspbhints +msgid "Hints for main speed buttons (open, save, ...)" +msgstr "Sufleriai pagrindiniams spartos mygtukams (\"Atverti\", \"Išsaugoti\", ...)" + +#: lazarusidestrconsts:srvk_home +msgid "Home" +msgstr "Home" + +#: lazarusidestrconsts:dlghomekeyjumpstoneareststart +msgid "Home key jumps to nearest start" +msgstr "Spustelėjus \"Home\", žymeklis peršoks į artimiausią pradžią" + +#: lazarusidestrconsts:lishorizontal +msgid "Horizontal" +msgstr "Horizontaliai" + +#: lazarusidestrconsts:dlggridxhint +msgid "Horizontal grid step size" +msgstr "Horizontalūs tarpai tarp tinklelio taškų" + +#: lazarusidestrconsts:dlghostapplication +msgid "Host application" +msgstr "Programa-šeimininkė" + +#: lazarusidestrconsts:uenotimplcapagain +msgid "I told You: Not implemented yet" +msgstr "Aš tau sakau: dar neįgyvendinta." + +#: lazarusidestrconsts:lisdebugoptionsfrmid +msgid "ID" +msgstr "ID" + +#: lazarusidestrconsts:liside +msgid "IDE" +msgstr "IKA" + +#: lazarusidestrconsts:lispckoptsideintegration +msgid "IDE Integration" +msgstr "IKA dalis" + +#: lazarusidestrconsts:lisideintf +msgid "IDE Interface" +msgstr "IKA interfeisas" + +#: lazarusidestrconsts:lisideoptions +msgid "IDE Options:" +msgstr "IKA parinktys:" + +#: lazarusidestrconsts:uepins +msgid "INS" +msgstr "ĮTERPTI" + +#: lazarusidestrconsts:liscodetoolsoptsidentifier +msgid "Identifier" +msgstr "Identifikatorius" + +#: lazarusidestrconsts:lisidentifierbeginswith +msgid "Identifier begins with ..." +msgstr "Identifikatorius prasideda..." + +#: lazarusidestrconsts:dlgedidcomlet +msgid "Identifier completion" +msgstr "Identifikatoriaus užbaigimas" + +#: lazarusidestrconsts:lisidentifiercontains +msgid "Identifier contains ..." +msgstr "Identifikatoriuje yra..." + +#: lazarusidestrconsts:lismakeresstridentifierlength +msgid "Identifier length:" +msgstr "Identifikatoriaus ilgis:" + +#: lazarusidestrconsts:dlgidentifierpolicy +msgid "Identifier policy" +msgstr "Identifikatoriaus politika" + +#: lazarusidestrconsts:lismakeresstridentifierprefix +msgid "Identifier prefix:" +msgstr "Identifikatoriaus prefiksas:" + +#: lazarusidestrconsts:lisfriidentifier +msgid "Identifier: %s" +msgstr "Identifikatorius: %s" + +#: lazarusidestrconsts:liscodetoolsdefsif +msgid "If" +msgstr "If" + +#: lazarusidestrconsts:uenotimpltext +msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" +msgstr "Jei jūs galite mums padėti įgyvendinti šią ypatybę, tada rašykite į lazarus@miraclec.com" + +#: lazarusidestrconsts:liscodetoolsdefsifdef +msgid "IfDef" +msgstr "IfDef" + +#: lazarusidestrconsts:liscodetoolsdefsifndef +msgid "IfNDef" +msgstr "IfNDef" + +#: lazarusidestrconsts:dlgignoreverb +msgid "Ignore" +msgstr "Ignoruoti" + +#: lazarusidestrconsts:lissortselignorespace +msgid "Ignore Space" +msgstr "Tarpai nesvarbūs" + +#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd +msgid "Ignore amount of space chars" +msgstr "Nepaisyti tam tikro tarpo simbolių kiekio" + +#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow +msgid "Ignore and save package now" +msgstr "Ignoruoti ir projektą išsaugoti dabar" + +#: lazarusidestrconsts:lisignorebinaries +msgid "Ignore binaries" +msgstr "Praleisti dvejetainius failus" + +#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe +msgid "Ignore difference in line ends (e.g. #10 = #13#10)" +msgstr "Nepaisyti naujos eilutės tipų (pvz.: #10 = #13#10)" + +#: lazarusidestrconsts:lisdiskdiffignorediskchanges +msgid "Ignore disk changes" +msgstr "Ignoruoti pasikeitimus diske" + +#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd +msgid "Ignore if empty lines were added or removed" +msgstr "Nepaisyti įdėtų ar pašalintų tuščių eilučių" + +#: lazarusidestrconsts:lisignoremissingfile +msgid "Ignore missing file" +msgstr "Praleisti trūkstamą failą" + +#: lazarusidestrconsts:lisdiffdlgignorespaces +msgid "Ignore spaces (newline chars not included)" +msgstr "Nepaisyti tarpo simbolių (neskaitant naujos eilutės simbolių)" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline +msgid "Ignore spaces at end of line" +msgstr "Nepaisyti tarpo simbolių eilutės gale" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline +msgid "Ignore spaces at start of line" +msgstr "Nepaisyti tarpo simbolių eilutės pradžioje" + +#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions +msgid "Ignore these exceptions" +msgstr "Ignoruoti šias išimtines situacijas" + +#: lazarusidestrconsts:lisignoreusetformasancestor +msgid "Ignore, use TForm as ancestor" +msgstr "Ignoruoti, TForm naudoti kaip protėvį." + +#: lazarusidestrconsts:srkmecimestr +msgid "Ime Str" +msgstr "IME eilutė" + +#: lazarusidestrconsts:lisimportlist +msgid "Import list" +msgstr "Importuoti sąrašą" + +#: lazarusidestrconsts:dlginfrontofmethods +msgid "In front of methods" +msgstr "Priešais metodus" + +#: lazarusidestrconsts:lispckoptsinclude +msgid "Include" +msgstr "Įtraukti" + +#: lazarusidestrconsts:dlgassertcode +msgid "Include Assertion Code" +msgstr "Įterpti \"Assertion\" kodą" + +#: lazarusidestrconsts:dlgcoincfiles +msgid "Include Files (-Fi):" +msgstr "Įterpiami failai (-Fi):" + +#: lazarusidestrconsts:lisincludefilter +msgid "Include Filter" +msgstr "Įterpimo filtras" + +#: lazarusidestrconsts:lispkgfiletypeinclude +msgid "Include file" +msgstr "Įtraukiamasis" + +#: lazarusidestrconsts:lisincludepaths +msgid "Include paths" +msgstr "Įterpimo keliai" + +#: lazarusidestrconsts:lisfindfileincludesubdirectories +msgid "Include sub directories" +msgstr "Ir pakatologiuose" + +#: lazarusidestrconsts:dlgincludesystemvariables +msgid "Include system variables" +msgstr "Pridėti sistemos kintamuosius" + +#: lazarusidestrconsts:lisuidincludedby +msgid "Included by:" +msgstr "Jį įtraukia:" + +#: lazarusidestrconsts:lismenuincrementalfind +msgid "Incremental Find" +msgstr "Prieauginė paieška" + +#: lazarusidestrconsts:srkmecblockindent +msgid "Indent block" +msgstr "Suteikti blokui įtrauką" + +#: lazarusidestrconsts:dlgindentcodeto +msgid "Indent code to" +msgstr "Įtraukti kodą pagal" + +#: lazarusidestrconsts:lismenuindentselection +msgid "Indent selection" +msgstr "Suteikti įtrauką pažymėjime" + +#: lazarusidestrconsts:rslanguageindonesian +msgid "Indonesian" +msgstr "Indoneziečių" + +#: lazarusidestrconsts:lisinformationaboutunit +msgid "Information about %s" +msgstr "Informacija apie modulį %s" + +#: lazarusidestrconsts:dlgcoinherited +msgid "Inherited" +msgstr "Paveldėta" + +#: lazarusidestrconsts:srvk_insert +msgid "Insert" +msgstr "Insert" + +#: lazarusidestrconsts:liskminsertifdef +msgid "Insert $IFDEF" +msgstr "Įterpti $IFDEF" + +#: lazarusidestrconsts:lismenuconditionalselection +msgid "Insert $IFDEF..." +msgstr "Įterpti $IFDEF..." + +#: lazarusidestrconsts:srkmecinsertcvsauthor +msgid "Insert CVS keyword Author" +msgstr "Įterpti CVS raktažodį \"Author\"" + +#: lazarusidestrconsts:srkmecinsertcvsdate +msgid "Insert CVS keyword Date" +msgstr "Įterpti CVS raktažodį \"Date\"" + +#: lazarusidestrconsts:srkmecinsertcvsheader +msgid "Insert CVS keyword Header" +msgstr "Įterpti CVS raktažodį \"Header\"" + +#: lazarusidestrconsts:srkmecinsertcvsid +msgid "Insert CVS keyword ID" +msgstr "Įterpti CVS raktažodį \"ID\"" + +#: lazarusidestrconsts:srkmecinsertcvslog +msgid "Insert CVS keyword Log" +msgstr "Įterpti CVS raktažodį \"Log\"" + +#: lazarusidestrconsts:srkmecinsertcvsname +msgid "Insert CVS keyword Name" +msgstr "Įterpti CVS raktažodį \"Name\"" + +#: lazarusidestrconsts:srkmecinsertcvsrevision +msgid "Insert CVS keyword Revision" +msgstr "Įterpti CVS raktažodį \"Revision\"" + +#: lazarusidestrconsts:srkmecinsertcvssource +msgid "Insert CVS keyword Source" +msgstr "Įterpti CVS raktažodį \"Source\"" + +#: lazarusidestrconsts:srkmecinsertchangelogentry +msgid "Insert ChangeLog entry" +msgstr "Įterpti pakeitimų žurnalo įrašą" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp +msgid "Insert Delphi 5 Compiler Template" +msgstr "Įterpti Delphi 5 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem +msgid "Insert Delphi 5 Directory Template" +msgstr "Įterpti Delphi 5 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl +msgid "Insert Delphi 5 Project Template" +msgstr "Įterpti Delphi 5 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp +msgid "Insert Delphi 6 Compiler Template" +msgstr "Įterpti Delphi 6 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem +msgid "Insert Delphi 6 Directory Template" +msgstr "Įterpti Delphi 6 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl +msgid "Insert Delphi 6 Project Template" +msgstr "Įterpti Delphi 6 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp +msgid "Insert Delphi 7 Compiler Template" +msgstr "Įterpti Delphi 7 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem +msgid "Insert Delphi 7 Directory Template" +msgstr "Įterpti Delphi 7 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl +msgid "Insert Delphi 7 Project Template" +msgstr "Įterpti Delphi 7 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert +msgid "Insert Free Pascal Compiler Template" +msgstr "Įterpti FreePascal kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte +msgid "Insert Free Pascal Project Template" +msgstr "Įterpti FreePascal projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource +msgid "Insert Free Pascal SVN Source Template" +msgstr "Įterpti FreePascal SVN pirminio kodo šabloną" + +#: lazarusidestrconsts:lismenueditorinsertfromtemplate +msgid "Insert From Template..." +msgstr "Įterpti iš šablono..." + +#: lazarusidestrconsts:srkmecinsertgplnotice +msgid "Insert GPL notice" +msgstr "Įterpti GPL raštą" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp +msgid "Insert Kylix 3 Compiler Template" +msgstr "Įterpti Kylix 3 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem +msgid "Insert Kylix 3 Directory Template" +msgstr "Įterpti Kylix 3 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl +msgid "Insert Kylix 3 Project Template" +msgstr "Įterpti Kylix 3 projekto šabloną" + +#: lazarusidestrconsts:srkmecinsertlgplnotice +msgid "Insert LGPL notice" +msgstr "Įterpti LGPL raštą" + +#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem +msgid "Insert Lazarus Directory Template" +msgstr "Įterpti Lazarus katalogo šabloną" + +#: lazarusidestrconsts:lisctinsertmacro +msgid "Insert Macro" +msgstr "Įterpti makrokomandą" + +#: lazarusidestrconsts:srkmecinsertmode +msgid "Insert Mode" +msgstr "Įterpimo veiksena" + +#: lazarusidestrconsts:lismenueditorinsertnewitemafter +msgid "Insert New Item (after)" +msgstr "Įterpti naują elementą (po)" + +#: lazarusidestrconsts:lismenueditorinsertnewitembefore +msgid "Insert New Item (before)" +msgstr "Įterpti naują elementą (prieš)" + +#: lazarusidestrconsts:liscodetoolsdefsinserttemplate +msgid "Insert Template" +msgstr "Įterpti šabloną" + +#: lazarusidestrconsts:lismakeresstrinsertalphabetically +msgid "Insert alphabetically" +msgstr "Įterpti pagal abėcėlę" + +#: lazarusidestrconsts:lislazdochintboldformat +msgid "Insert bold formatting tag" +msgstr "Įterpti pusjuodžio formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintinsertcodetag +msgid "Insert code formatting tag" +msgstr "Įterpti kodo formatavimo gairę" + +#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive +msgid "Insert context sensitive" +msgstr "Įterpti pagal kontekstą" + +#: lazarusidestrconsts:srkmecinsertdatetime +msgid "Insert current date and time" +msgstr "Įterpti dabartinę datą ir laiką" + +#: lazarusidestrconsts:srkmecinsertusername +msgid "Insert current username" +msgstr "Įterpti dabartinį vartotojo vardą" + +#: lazarusidestrconsts:liskminsertdateandtime +msgid "Insert date and time" +msgstr "Įterpti datą ir laiką" + +#: lazarusidestrconsts:lismenuinsertcharacter +msgid "Insert from Character Map" +msgstr "Įterpti iš simbolių lentelės" + +#: lazarusidestrconsts:srkmecinsertcharacter +msgid "Insert from Charactermap" +msgstr "Įterpti iš simbolių lentelės" + +#: lazarusidestrconsts:lislazdochintitalicformat +msgid "Insert italic formatting tag" +msgstr "Įterpti kursyvo formatavimo gairę" + +#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice +msgid "Insert modified LGPL notice" +msgstr "Įterpti modifikuotą LGPL raštą" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild +msgid "Insert node as child" +msgstr "Įterpti mazgą kaip vaiką" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow +msgid "Insert node below" +msgstr "Įterpti mazgą žemiau" + +#: lazarusidestrconsts:lislazdochintremarktag +msgid "Insert remark formatting tag" +msgstr "Įterpti pastabos formatavimo gairę" + +#: lazarusidestrconsts:dlginsspaceafter +msgid "Insert space after" +msgstr "Iterpti tarpą po" + +#: lazarusidestrconsts:dlginsspacefront +msgid "Insert space in front of" +msgstr "Įterpti tarpą priešais" + +#: lazarusidestrconsts:lismenuinserttext +msgid "Insert text" +msgstr "Įterpti tekstą" + +#: lazarusidestrconsts:lislazdochintunderlineformat +msgid "Insert underline formatting tag" +msgstr "Įterpti pabraukimo formatavimo gairę" + +#: lazarusidestrconsts:liskminsertusername +msgid "Insert username" +msgstr "Įterpti naudotojo vardą" + +#: lazarusidestrconsts:lislazdochintvartag +msgid "Insert var formatting tag" +msgstr "Įterpti kintamojo formatavimo gairę" + +#: lazarusidestrconsts:liskminspect +msgid "Inspect" +msgstr "Inspektuoti" + +#: lazarusidestrconsts:lismenuinspect +msgid "Inspect ..." +msgstr "Inspektuoti..." + +#: lazarusidestrconsts:lispckeditinstall +msgid "Install" +msgstr "Įdiegti" + +#: lazarusidestrconsts:lispckexplinstallonnextstart +msgid "Install on next start" +msgstr "Įdiegti kitąkart startuojant" + +#: lazarusidestrconsts:lispckeditinstallpackageintheide +msgid "Install package in the IDE" +msgstr "Įdiegti paketą į IKA" + +#: lazarusidestrconsts:lisinstallselection +msgid "Install selection" +msgstr "Įdiegti pažymėtą" + +#: lazarusidestrconsts:lisinstallationfailed +msgid "Installation failed" +msgstr "Diegimas nepavyko" + +#: lazarusidestrconsts:lispckexplinstalled +msgid "Installed" +msgstr "įdiegtas" + +#: lazarusidestrconsts:lisinstalledpackages +msgid "Installed Packages" +msgstr "Įdiegti paketai" + +#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac +msgid "Installing the package %s will automatically install the package:" +msgstr "Diegiant paketą %s automatiškai bus įdiegtas ir paketas:" + +#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 +msgid "Installing the package %s will automatically install the packages:" +msgstr "Diegiant paketą %s automatiškai bus įdiegti paketai:" + +#: lazarusidestrconsts:lisdebugoptionsfrminterface +msgid "Interface" +msgstr "Interfeisas" + +#: lazarusidestrconsts:listcompilerinternalerror +msgid "Internal compiler error! (%d)" +msgstr "Vidinė kompiliatoriaus klaida! (%d)" + +#: lazarusidestrconsts:dlgintvinsec +msgid "Interval in secs" +msgstr "Intervalas sekundėmis" + +#: lazarusidestrconsts:lisa2pinvalidancestortype +msgid "Invalid Ancestor Type" +msgstr "Klaidingas protėvio tipas" + +#: lazarusidestrconsts:lisa2pinvalidcircle +msgid "Invalid Circle" +msgstr "Klaidingas ratas" + +#: lazarusidestrconsts:lisa2pinvalidclassname +msgid "Invalid Class Name" +msgstr "Klaidingas klasės vardas" + +#: lazarusidestrconsts:lisinvalidcompilerfilename +msgid "Invalid Compiler Filename" +msgstr "Blogas kompiliatoriaus vardas" + +#: lazarusidestrconsts:lispublprojinvalidexcludefilter +msgid "Invalid Exclude filter" +msgstr "Klaidingas neįtraukiamųjų filtras" + +#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory +msgid "Invalid Free Pascal source directory" +msgstr "Klaidingas FreePascal pirminio kodo katalogas" + +#: lazarusidestrconsts:lisfriinvalididentifier +msgid "Invalid Identifier" +msgstr "Klaidingas identifikatorius" + +#: lazarusidestrconsts:lispublprojinvalidincludefilter +msgid "Invalid Include filter" +msgstr "Klaidingas įtraukiamųjų filtras" + +#: lazarusidestrconsts:lisprojaddinvalidminmaxversion +msgid "Invalid Min-Max version" +msgstr "Klaidingos versijos ribos" + +#: lazarusidestrconsts:lisaf2pinvalidpackage +msgid "Invalid Package" +msgstr "Klaidingas paketas" + +#: lazarusidestrconsts:lispkgmanginvalidpackagename2 +msgid "Invalid Package Name" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:lisinvalidpascalidentifiercap +msgid "Invalid Pascal Identifier" +msgstr "Klaidingas paskalio identifikatorius" + +#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect +msgid "Invalid Resourcestring section" +msgstr "Klaidinga resursų eilutės sekcija" + +#: lazarusidestrconsts:lisa2pinvalidunitname +msgid "Invalid Unit Name" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lispkgsysinvalidunitname +msgid "Invalid Unitname: %s" +msgstr "Klaidingas modulio vardas: %s" + +#: lazarusidestrconsts:lisinvalidcommand +msgid "Invalid command" +msgstr "Klaidinga komanda" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename +msgid "Invalid compiler filename" +msgstr "Klaidingas kompiliatoriaus failas" + +#: lazarusidestrconsts:lispkgsysinvalidcomponentclass +msgid "Invalid component class" +msgstr "Klaidinga komponentės klasė" + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename +msgid "Invalid debugger filename" +msgstr "Klaidingas derintuvės failas" + +#: lazarusidestrconsts:lisinvaliddelete +msgid "Invalid delete" +msgstr "Klaidingas šalinimas" + +#: lazarusidestrconsts:lisinvaliddestinationdirectory +msgid "Invalid destination directory" +msgstr "Klaidingas tikslo katalogas" + +#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction +msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." +msgstr "Klaidingas reiškinys.%sUžuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos, kuri yra tik viename faile.%sPažymėkite reiškinį ir bandykite vėl." + +#: lazarusidestrconsts:lisa2pinvalidfile +msgid "Invalid file" +msgstr "Klaidingas failo vardas" + +#: lazarusidestrconsts:lispkgmanginvalidfileextension +msgid "Invalid file extension" +msgstr "Klaidingas failo prievardis" + +#: lazarusidestrconsts:lisa2pinvalidfilename +msgid "Invalid filename" +msgstr "Klaidingas failo vardas" + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename +msgid "Invalid make filename" +msgstr "Klaidingas make failas" + +#: lazarusidestrconsts:lispckeditinvalidmaximumversion +msgid "Invalid maximum version" +msgstr "Klaidinga maksimali versija" + +#: lazarusidestrconsts:lispckeditinvalidminimumversion +msgid "Invalid minimum version" +msgstr "Klaidinga minimali versija" + +#: lazarusidestrconsts:lisinvalidmultiselection +msgid "Invalid multiselection" +msgstr "Klaidingas daugybinis pažymėjimas" + +#: lazarusidestrconsts:liserrinvalidoption +msgid "Invalid option at position %d: \"%s\"" +msgstr "Klaidinga parinktis ties pozicija %d: \"%s\"" + +#: lazarusidestrconsts:lisaf2pinvalidpackageid +msgid "Invalid package ID: %s%s%s" +msgstr "Klaidingas paketo ID: %s%s%s" + +#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension +msgid "Invalid package file extension" +msgstr "Klaidingas paketo failo prievardis" + +#: lazarusidestrconsts:lispkgmanginvalidpackagefilename +msgid "Invalid package filename" +msgstr "Klaidingas paketo failo vardas" + +#: lazarusidestrconsts:lispkgmanginvalidpackagename +msgid "Invalid package name" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:lispckoptsinvalidpackagetype +msgid "Invalid package type" +msgstr "Klaidingas paketo tipas" + +#: lazarusidestrconsts:lisprojaddinvalidpackagename +msgid "Invalid packagename" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparent +msgid "Invalid parent" +msgstr "Klaidingas tėvas" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode +msgid "Invalid parent node" +msgstr "Klaidingas tėvinis mazgas" + +#: lazarusidestrconsts:lisprojaddinvalidpascalunitname +msgid "Invalid pascal unit name" +msgstr "Klaidingas paskalio modulio vardas" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode +msgid "Invalid previous node" +msgstr "Klaidingas ankstesnis mazgas" + +#: lazarusidestrconsts:lisinvalidprocname +msgid "Invalid proc name" +msgstr "Klaidingas procedūros vardas" + +#: lazarusidestrconsts:lisinvalidprojectfilename +msgid "Invalid project filename" +msgstr "Klaidingas projekto failo vardas" + +#: lazarusidestrconsts:lisinvalidselection +msgid "Invalid selection" +msgstr "Klaidingas žymėjimas" + +#: lazarusidestrconsts:lispeinvalidunitfilename +msgid "Invalid unit filename" +msgstr "Klaidingas modulio failo vardas" + +#: lazarusidestrconsts:lispeinvalidunitname +msgid "Invalid unitname" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lissvuoinvalidvariablename +msgid "Invalid variable name" +msgstr "Klaidingas kintamojo vardas" + +#: lazarusidestrconsts:lisprojaddinvalidversion +msgid "Invalid version" +msgstr "Klaidinga versija" + +#: lazarusidestrconsts:ueminvertassignment +msgid "Invert Assignment" +msgstr "Sukeisti priskyrimą" + +#: lazarusidestrconsts:srkmecinvertassignment +msgid "Invert assignment" +msgstr "Sukeisti priskyrimą" + +#: lazarusidestrconsts:srvk_irregular +msgid "Irregular " +msgstr "Nereguliarus" + +#: lazarusidestrconsts:rslanguageitalian +msgid "Italian" +msgstr "Italų" + +#: lazarusidestrconsts:dlgedital +msgid "Italic" +msgstr "Kursyvas" + +#: lazarusidestrconsts:dlgoiitemheight +msgid "Item height" +msgstr "Elemento aukštis" + +#: lazarusidestrconsts:lisjitform +msgid "JIT Form" +msgstr "JITForm" + +#: lazarusidestrconsts:rslanguagejapanese +msgid "Japanese" +msgstr "Japonų" + +#: lazarusidestrconsts:lisplistjumptoselection +msgid "Jump To Selection" +msgstr "Rodyti žymėjimą" + +#: lazarusidestrconsts:lismenujumpback +msgid "Jump back" +msgstr "Peršokti atgal" + +#: lazarusidestrconsts:lismenujumpforward +msgid "Jump forward" +msgstr "Peršokti pirmyn" + +#: lazarusidestrconsts:lismenujumpto +msgid "Jump to" +msgstr "Šokti į" + +#: lazarusidestrconsts:lismenujumptonextbookmark +msgid "Jump to next bookmark" +msgstr "Šokti prie tolesnės žymės" + +#: lazarusidestrconsts:lismenujumptonexterror +msgid "Jump to next error" +msgstr "Šokti prie tolesnės klaidos" + +#: lazarusidestrconsts:lismenujumptoprevbookmark +msgid "Jump to previous bookmark" +msgstr "Šokti prie ankstesnės žymės" + +#: lazarusidestrconsts:lismenujumptopreverror +msgid "Jump to previous error" +msgstr "Šokti prie ankstesnės klaidos" + +#: lazarusidestrconsts:dlgjumpingetc +msgid "Jumping (e.g. Method Jumping)" +msgstr "Šokinėjimas (pvz. tarp metodų)" + +#: lazarusidestrconsts:srvk_junja +msgid "Junja" +msgstr "Junja" + +#: lazarusidestrconsts:srvk_kana +msgid "Kana" +msgstr "Kana" + +#: lazarusidestrconsts:liscldirkeepalltextfiles +msgid "Keep all text files" +msgstr "Palikti visus tekstinius failus" + +#: lazarusidestrconsts:dlgkeepcaretx +msgid "Keep caret X position" +msgstr "Išlaikyti žymeklio X poziciją" + +#: lazarusidestrconsts:dlgcokeepvarsreg +msgid "Keep certain variables in registers" +msgstr "Registre laikyti dažniausiai naudojamus kintamuosius" + +#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter +msgid "Keep files matching filter" +msgstr "Palikti filtre nurodytus failus" + +#: lazarusidestrconsts:liskeepname +msgid "Keep name" +msgstr "Nekeisti vardo" + +#: lazarusidestrconsts:dlgforwardprocskeeporder +msgid "Keep order of procedures" +msgstr "Išlaikyti procedūrų eilę" + +#: lazarusidestrconsts:liskeepthemandcontinue +msgid "Keep them and continue" +msgstr "Jį palikti ir tęsti" + +#: lazarusidestrconsts:lisedtexttoolkey +msgid "Key" +msgstr "Klavišas" + +#: lazarusidestrconsts:srkmkey +msgid "Key (or 2 keys combination)" +msgstr "Klavišas (arba dviejų kombinacija)" + +#: lazarusidestrconsts:dlgkeymappingscheme +msgid "Key Mapping Scheme" +msgstr "Klavišų priskyrimo schema" + +#: lazarusidestrconsts:dlgkeymapping +msgid "Key Mappings" +msgstr "Klavišų priskyrimai" + +#: lazarusidestrconsts:dlgkeymappingerrors +msgid "Key mapping errors" +msgstr "Klavišų priskyrimų klaidos" + +#: lazarusidestrconsts:liskmkeymappingscheme +msgid "Keymapping Scheme" +msgstr "Klavišų priskyrimo schema" + +#: lazarusidestrconsts:liscodetoolsoptskeyword +msgid "Keyword" +msgstr "Raktažodis" + +#: lazarusidestrconsts:dlgkeywordpolicy +msgid "Keyword policy" +msgstr "Raktažodžio politika" + +#: lazarusidestrconsts:lislcl +msgid "LCL" +msgstr "LCL" + +#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions +msgid "LCL Interface specific options:" +msgstr "LCL interfeiso specifinės parinktys:" + +#: lazarusidestrconsts:lislclwidgettype +msgid "LCL Widget Type" +msgstr "LCL valdiklių tipas" + +#: lazarusidestrconsts:lislazbuildlclinterface +msgid "LCL interface" +msgstr "LCL interfeisas" + +#: lazarusidestrconsts:lislclunitpathmissing +msgid "LCL unit path missing" +msgstr "Trūksta įrašo apie kelią iki LCL modulio" + +#: lazarusidestrconsts:lispkgfiletypelfm +msgid "LFM - Lazarus form text" +msgstr "LFM - Lazarus formos kodas" + +#: lazarusidestrconsts:lislfmfile +msgid "LFM file" +msgstr "LFM failas" + +#: lazarusidestrconsts:lislfmfilecorrupt +msgid "LFM file corrupt" +msgstr "LFM failas sugadintas" + +#: lazarusidestrconsts:lislfmfilenotfound +msgid "LFM file not found" +msgstr "Nerastas LFM failas" + +#: lazarusidestrconsts:lismenuinsertlgplnotice +msgid "LGPL notice" +msgstr "LGPL raštas" + +#: lazarusidestrconsts:lispkgfiletypelrs +msgid "LRS - Lazarus resource" +msgstr "LRS - Lazarus ištekliai" + +#: lazarusidestrconsts:dlgenvlanguage +msgid "Language" +msgstr "Kalba" + +#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions +msgid "Language Exceptions" +msgstr "Kalbos išimtinės situacijos" + +#: lazarusidestrconsts:dlgcdtlast +msgid "Last" +msgstr "Gale" + +#: lazarusidestrconsts:dlglast +msgid "Last (i.e. at end of source)" +msgstr "Pačiame gale" + +#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox +msgid "Launching application" +msgstr "Paleidžiančioji programa" + +#: lazarusidestrconsts:lislaunchingapplicationinvalid +msgid "Launching application invalid" +msgstr "Netinkama paleidžiančioji programa" + +#: lazarusidestrconsts:lislaunchingcmdline +msgid "Launching target command line" +msgstr "Startuojamos paskirties komandinė eilutė" + +#: lazarusidestrconsts:lislazdoc +msgid "LazDoc" +msgstr "LazDoc" + +#: lazarusidestrconsts:lismenulazdoc +msgid "LazDoc Editor" +msgstr "LazDoc redaktorius" + +#: lazarusidestrconsts:lislazdocmainformcaption +msgid "LazDoc editor" +msgstr "LazDoc redaktorius" + +#: lazarusidestrconsts:lislazdocpathsgroupbox +msgid "LazDoc settings" +msgstr "LazDoc nuostatos" + +#: lazarusidestrconsts:lispkgmanglazarus +msgid "Lazarus" +msgstr "Lazarus" + +#: lazarusidestrconsts:lislazarusdesktopsettings +msgid "Lazarus Desktop Settings" +msgstr "Lazarus darbastalio nuostatos" + +#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory +msgid "Lazarus Directory" +msgstr "Lazarus katalogas" + +#: lazarusidestrconsts:lislazaruseditorv +msgid "Lazarus Editor v%s" +msgstr "Lazarus redaktorius v%s" + +#: lazarusidestrconsts:lislazarusfile +msgid "Lazarus File" +msgstr "Lazarus failas" + +#: lazarusidestrconsts:lislazaruside +msgid "Lazarus IDE" +msgstr "Lazarus IKA" + +#: lazarusidestrconsts:lislazarusprojectinfofile +msgid "Lazarus Project Info file" +msgstr "Lazarus projekto informacinis failas" + +#: lazarusidestrconsts:locwndsrceditor +msgid "Lazarus Source Editor" +msgstr "Lazarus pirminio kodo redaktorius" + +#: lazarusidestrconsts:lisconfigdirectory +msgid "Lazarus config directory" +msgstr "Lazarus nustatymų katalogas" + +#: lazarusidestrconsts:lislazarusdirectory +msgid "Lazarus directory" +msgstr "Lazarus katalogas" + +#: lazarusidestrconsts:dlglazarusdir +msgid "Lazarus directory (default for all projects)" +msgstr "Lazarus katalogas (numatytas visiems projektams)" + +#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg +msgid "Lazarus directory \"%s\" not found." +msgstr "Nerastas Lazarus katalogas \"%s\"." + +#: lazarusidestrconsts:lislazarusdirectorynotfound +msgid "Lazarus directory not found" +msgstr "Nerastas Lazarus katalogas" + +#: lazarusidestrconsts:lislazarusform +msgid "Lazarus form" +msgstr "Lazarus forma" + +#: lazarusidestrconsts:lislazarusinclude +msgid "Lazarus include file" +msgstr "Lazarus įdedamasis failas" + +#: lazarusidestrconsts:lislazaruslanguageid +msgid "Lazarus language ID (e.g. en, de, br, fi)" +msgstr "Lazarus kalbos ID (t.y. en, de, lt, ...)" + +#: lazarusidestrconsts:lislazaruslanguagename +msgid "Lazarus language name (e.g. english, deutsch)" +msgstr "Lazarus kalbos vardas (t.y. anglų, vokiečių, lietuvių, ...)" + +#: lazarusidestrconsts:lislazaruspackage +msgid "Lazarus package" +msgstr "Lazarus paketas" + +#: lazarusidestrconsts:lislazarusproject +msgid "Lazarus project" +msgstr "Lazarus projektas" + +#: lazarusidestrconsts:lislazarusprojectsource +msgid "Lazarus project source" +msgstr "Lazarus projekto pirminis kodas" + +#: lazarusidestrconsts:lislazarusunit +msgid "Lazarus unit" +msgstr "Lazarus modulis" + +#: lazarusidestrconsts:lisleaveemptyfo +msgid "Leave empty for default .po file" +msgstr "Palikite tuščią jei naudosite numatytąjį .po failą" + +#: lazarusidestrconsts:srvk_left +msgid "Left" +msgstr "Left" + +#: lazarusidestrconsts:lisleftgroupboxcaption +msgid "Left anchoring" +msgstr "Kairės prieraiša" + +#: lazarusidestrconsts:lisleftborderspacespinedithint +msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." +msgstr "" +"Kairės kraštinės plotis.\n" +"Ši reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą kairiosios kraštinės plotį" + +#: lazarusidestrconsts:lisleftsides +msgid "Left sides" +msgstr "Sutapdinti kairiuosius kraštus" + +#: lazarusidestrconsts:lisleftspaceequally +msgid "Left space equally" +msgstr "Tolygiai rikiuoti pagal kairiuosius kraštus" + +#: lazarusidestrconsts:dlgleftpos +msgid "Left:" +msgstr "Kairė:" + +#: lazarusidestrconsts:dlglevelnoneopt +msgid "Level 0 (no extra Optimizations)" +msgstr "0 lygis (optimizacijos nėra)" + +#: lazarusidestrconsts:dlglevel1opt +msgid "Level 1 (quick and debugger friendly)" +msgstr "1 lygis (įprastų instrukcijų sekos keičiamos greitesniais ekvivalentais)" + +#: lazarusidestrconsts:dlglevel2opt +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "2 lygis (1 lygis + registro duomenų bereikalingų pakartotinų įkėlimų eliminavimas)" + +#: lazarusidestrconsts:dlglevel3opt +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "3 lygis (2 lygis +kitos laiką ryjančios optimizacijos)" + +#: lazarusidestrconsts:lislevels +msgid "Levels" +msgstr "Lygiai" + +#: lazarusidestrconsts:dlgcolibraries +msgid "Libraries (-Fl):" +msgstr "Bibliotekos (-Fl):" + +#: lazarusidestrconsts:lispckoptslibrary +msgid "Library" +msgstr "Biblioteka" + +#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin +msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." +msgstr "Biblioteka%sFreePascal biblioteka (.dll Windows aplinkoje, .so Linux aplinkoje, .dylib MacOsX aplinkoje). Lazarus automatiškai rūpinsis bibliotekos pirminio kodo failu." + +#: lazarusidestrconsts:lispckoptslicense +msgid "License:" +msgstr "Licenzija:" + +#: lazarusidestrconsts:lisaboutlazarusmsg +msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." +msgstr "Licenzija: GPL/LGPL%sLazarus yra IKA (integruota kūrimo aplinka), skirtas su FreePascal kurti (vizualinėms bei konsolės) programoms. FreePascal yra (L)GPL tipo paskalio ir objektinio paskalio kompiliatorius, jis dirba Linux, Windows, Mac OS X, FreeBSD ir kitose operacinėse sistemose.%sLazarus yra trūkstamoji galvosukio dalis, kuri jums leidžia visose paminėtose platformose kurti programas aplinkoje panašioje į Delphi. IKA yra GPK (greitas programų kūrimas) įrankis, kuriame yra formų konstruktorius.%sLazarus auga, todėl mums reikia daugiau kūrėjų." + +#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto +msgid "Limit linecount to" +msgstr "Riboti eilučių kiekį iki" + +#: lazarusidestrconsts:listodolline +msgid "Line" +msgstr "Eilutė" + +#: lazarusidestrconsts:dlglinesplitting +msgid "Line Splitting" +msgstr "Eilučių laužymas" + +#: lazarusidestrconsts:srkmeclineselect +msgid "Line selection mode" +msgstr "Eilučių žymėjimo veiksena" + +#: lazarusidestrconsts:lissortsellines +msgid "Lines" +msgstr "Eilutės" + +#: lazarusidestrconsts:lisuidlines +msgid "Lines:" +msgstr "Eilučių:" + +#: lazarusidestrconsts:dlglinksmart +msgid "Link Smart" +msgstr "Saistyti sumaniai" + +#: lazarusidestrconsts:dlglinklibraries +msgid "Link Style:" +msgstr "Saistymo stilius:" + +#: lazarusidestrconsts:lispckoptslinker +msgid "Linker" +msgstr "Saistyklė" + +#: lazarusidestrconsts:dlgcolinking +msgid "Linking" +msgstr "Saistymas" + +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "Lietuvių" + +#: lazarusidestrconsts:dlgloaddfile +msgid "Load desktop settings from file" +msgstr "Įkelti darbastalio nuostatas iš failo" + +#: lazarusidestrconsts:lisiecoloadfromfile +msgid "Load from file" +msgstr "Įkelti iš failo" + +#: lazarusidestrconsts:dlgcoloadsave +msgid "Load/Save" +msgstr "Įkelti/išsaugoti" + +#: lazarusidestrconsts:lispckexplloadedpackages +msgid "Loaded Packages:" +msgstr "Įkelti paketai:" + +#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage +msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" +msgstr "%keliant paketą %s bus pakeistas paketas %s%s, esanti faile %s.%sSenojo paketo turinys yra pakeistas.%s%sIšsaugoti senojo paketo %s pakeitimus?" + +#: lazarusidestrconsts:dlgrunolocal +msgid "Local" +msgstr "Vietiniai" + +#: lazarusidestrconsts:lismenuviewlocalvariables +msgid "Local Variables" +msgstr "Vietiniai kintamieji" + +#: lazarusidestrconsts:lismenulowercaseselection +msgid "Lowercase selection" +msgstr "Pažymėjime visas raides mažosiomis" + +#: lazarusidestrconsts:dlg1up2low +msgid "Lowercase, first letter up" +msgstr "Mažosiomis raidėmis, pirmoji - didžioji" + +#: lazarusidestrconsts:lisedtexttoolmacros +msgid "Macros" +msgstr "Makrokomandos" + +#: lazarusidestrconsts:dlgmainmenu +msgid "Main Menu" +msgstr "Pagrindinis meniu" + +#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements +msgid "Main Unit has Application.CreateForm statements" +msgstr "Pagrindiniame modulyje yra sakinių \"Application.CreateForm\"" + +#: lazarusidestrconsts:lismainunithasapplicationtitlestatements +msgid "Main Unit has Application.Title statements" +msgstr "Pagrindiniame modulyje yra sakinių \"Application.Title\"" + +#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject +msgid "Main Unit has Uses Section containing all Units of project" +msgstr "Pagrindiniame modulyje yra sekcija \"Uses\", kurioje paminėti visi projekto moduliai" + +#: lazarusidestrconsts:lismainunitispascalsource +msgid "Main Unit is Pascal Source" +msgstr "Pagrindinis modulis yra Paskalio pirminis kodas" + +#: lazarusidestrconsts:lispckoptsmajor +msgid "Major" +msgstr "Didysis" + +#: lazarusidestrconsts:lismakeexe +msgid "Make Executable" +msgstr "Daryti vykdomąjį failą" + +#: lazarusidestrconsts:lismenumakeresourcestring +msgid "Make Resource String ..." +msgstr "Kurti resursų eilutę..." + +#: lazarusidestrconsts:lismakeresourcestring +msgid "Make ResourceString" +msgstr "Kurti resursų eilutę" + +#: lazarusidestrconsts:lismakenotfound +msgid "Make not found" +msgstr "Nerastas Make" + +#: lazarusidestrconsts:dlgmakepath +msgid "Make path" +msgstr "Programos make failas" + +#: lazarusidestrconsts:srkmecmakeresourcestring +msgid "Make resource string" +msgstr "Sukurti resursų eilutę" + +#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically +msgid "Manual compilation (never automatically)" +msgstr "Kompiliuoti rankiniu būdu (ne automatiškai)" + +#: lazarusidestrconsts:dlgmargingutter +msgid "Margin and gutter" +msgstr "Paraštės" + +#: lazarusidestrconsts:dlgmarkercolor +msgid "Marker color" +msgstr "Žymeklio spalva" + +#: lazarusidestrconsts:lissmatches +msgid "Matches" +msgstr "Atitikmenys" + +#: lazarusidestrconsts:dlgmaxlinelength +msgid "Max line length:" +msgstr "Maksimalus eilutės ilgis:" + +#: lazarusidestrconsts:dlgmaxrecentfiles +msgid "Max recent files" +msgstr "Maksimalus atvertų failų sąrašo ilgis" + +#: lazarusidestrconsts:dlgmaxrecentprojs +msgid "Max recent project files" +msgstr "Maksimalus atvertų projektų sąrašo ilgis" + +#: lazarusidestrconsts:lisexttoolmaximumtoolsreached +msgid "Maximum Tools reached" +msgstr "Perdaug įrankių" + +#: lazarusidestrconsts:lisprojaddmaximumversionoptional +msgid "Maximum Version (optional):" +msgstr "Maksimali versija (nebūtina)" + +#: lazarusidestrconsts:lispckeditmaximumversion +msgid "Maximum Version:" +msgstr "Maksimali versija:" + +#: lazarusidestrconsts:dlgmaxcntr +msgid "Maximum counter" +msgstr "Skaitliuko riba" + +#: lazarusidestrconsts:srvk_menu +msgid "Menu" +msgstr "Menu" + +#: lazarusidestrconsts:lismenueditormenueditor +msgid "Menu Editor" +msgstr "Meniu redaktorius" + +#: lazarusidestrconsts:lismenuviewmessages +msgid "Messages" +msgstr "Pranešimai" + +#: lazarusidestrconsts:dlgmethodinspolicy +msgid "Method insert policy" +msgstr "Metodo įterpimo policija" + +#: lazarusidestrconsts:dlgminimizeallonminimizemain +msgid "Minimize all on minimize main" +msgstr "Suskleidžiant pagrindinį suskleisti visus" + +#: lazarusidestrconsts:lisprojaddminimumversionoptional +msgid "Minimum Version (optional):" +msgstr "Minimali versija (nebūtina):" + +#: lazarusidestrconsts:lispckeditminimumversion +msgid "Minimum Version:" +msgstr "Minimali versija:" + +#: lazarusidestrconsts:lispckoptsminor +msgid "Minor" +msgstr "Mažasis" + +#: lazarusidestrconsts:fdmmirrorhorizontal +msgid "Mirror horizontal" +msgstr "Apsukti horizontaliai" + +#: lazarusidestrconsts:fdmmirrorvertical +msgid "Mirror vertical" +msgstr "Apsukti vertikaliai" + +#: lazarusidestrconsts:dlgenvmisc +msgid "Miscellaneous" +msgstr "Įvairūs" + +#: lazarusidestrconsts:lismissingevents +msgid "Missing Events" +msgstr "Trūksta įvykių" + +#: lazarusidestrconsts:lismissingpackages +msgid "Missing Packages" +msgstr "Trūksta paketų" + +#: lazarusidestrconsts:dlgmixmethodsandproperties +msgid "Mix methods and properties" +msgstr "Maišyti metodus su savybėm" + +#: lazarusidestrconsts:srvk_modechange +msgid "Mode Change" +msgstr "Mode Change" + +#: lazarusidestrconsts:uemodified +msgid "Modified" +msgstr "Pakeista" + +#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice +msgid "Modified LGPL notice" +msgstr "Modifikuotas LGPL raštas" + +#: lazarusidestrconsts:lispckeditmodified +msgid "Modified: %s" +msgstr "Pakeista: %s" + +#: lazarusidestrconsts:lisdebugoptionsfrmmodule +msgid "Module" +msgstr "Modulis" + +#: lazarusidestrconsts:lispckeditmore +msgid "More ..." +msgstr "Daugiau..." + +#: lazarusidestrconsts:srvk_lbutton +msgid "Mouse Button Left" +msgstr "Pelės kairysis klavišas" + +#: lazarusidestrconsts:srvk_mbutton +msgid "Mouse Button Middle" +msgstr "Pelės vidurinis klavišas" + +#: lazarusidestrconsts:srvk_rbutton +msgid "Mouse Button Right" +msgstr "Pelės dešinysis klavišas" + +#: lazarusidestrconsts:dlgmouselinks +msgid "Mouse links" +msgstr "Aktyvuoti saitą su Ctrl ir pele" + +#: lazarusidestrconsts:lismenueditormovedown +msgid "Move Down (or right)" +msgstr "Stumti žemyn (arba dešinėn)" + +#: lazarusidestrconsts:uemmoveeditorleft +msgid "Move Editor Left" +msgstr "Perkelti redaktorių kairėn" + +#: lazarusidestrconsts:uemmoveeditorright +msgid "Move Editor Right" +msgstr "Perkelti redaktorių dešinėn" + +#: lazarusidestrconsts:lismenueditormoveup +msgid "Move Up (or left)" +msgstr "Stumti viršun (arba kairėn)" + +#: lazarusidestrconsts:lisdsgorderbackone +msgid "Move component one back" +msgstr "Perkelti komponentę per viena atgal" + +#: lazarusidestrconsts:lisdsgorderforwardone +msgid "Move component one forward" +msgstr "Perkelti komponentę per viena pirmyn" + +#: lazarusidestrconsts:lisdsgordermovetoback +msgid "Move component to back" +msgstr "Perkelti komponentę galan" + +#: lazarusidestrconsts:lisdsgordermovetofront +msgid "Move component to front" +msgstr "Perkelti komponentę priekin" + +#: lazarusidestrconsts:srkmecpagedown +msgid "Move cursor down one page" +msgstr "Perkelti žymeklį lapu žemiau" + +#: lazarusidestrconsts:srkmecpageleft +msgid "Move cursor left one page" +msgstr "Perkelti žymeklį lapu kairiau" + +#: lazarusidestrconsts:srkmecpageright +msgid "Move cursor right one page" +msgstr "Perkelti žymeklį lapu dešiniau" + +#: lazarusidestrconsts:srkmeceditortop +msgid "Move cursor to absolute beginning" +msgstr "Perkelti žymeklį į absoliučią pradžią" + +#: lazarusidestrconsts:srkmeceditorbottom +msgid "Move cursor to absolute end" +msgstr "Perkelti žymeklį į absoliučią pabaigą" + +#: lazarusidestrconsts:srkmecpagebottom +msgid "Move cursor to bottom of page" +msgstr "Perkelti žymeklį į lapo pabaigą" + +#: lazarusidestrconsts:srkmeclineend +msgid "Move cursor to line end" +msgstr "Perkelti žymeklį į eilutės pabaigą" + +#: lazarusidestrconsts:srkmeclinestart +msgid "Move cursor to line start" +msgstr "Perkelti žymeklį į eilutės pradžia" + +#: lazarusidestrconsts:srkmecpagetop +msgid "Move cursor to top of page" +msgstr "Perkelti žymeklį į lapo pradžią" + +#: lazarusidestrconsts:srkmecpageup +msgid "Move cursor up one page" +msgstr "Perkelti žymeklį lapu aukščiau" + +#: lazarusidestrconsts:srkmecwordleft +msgid "Move cursor word left" +msgstr "Perkelti žymeklį žodžiu kairiau" + +#: lazarusidestrconsts:srkmecwordright +msgid "Move cursor word right" +msgstr "Perkelti žymeklį žodžiu dešiniau" + +#: lazarusidestrconsts:lispckeditmovedependencydown +msgid "Move dependency down" +msgstr "Perkelti priklausinį žemyn" + +#: lazarusidestrconsts:lispckeditmovedependencyup +msgid "Move dependency up" +msgstr "Perkelti priklausinį aukštyn" + +#: lazarusidestrconsts:srkmecmoveeditorleft +msgid "Move editor left" +msgstr "Perkelti redaktorių kairėn" + +#: lazarusidestrconsts:srkmecmoveeditorright +msgid "Move editor right" +msgstr "Perkelti redaktorių dešinėn" + +#: lazarusidestrconsts:lisldmoveentriestoinherited +msgid "Move entries to inherited" +msgstr "Įrašus perkelti į paveldą" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodedown +msgid "Move node down" +msgstr "Perkelti mazgą žemyn" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown +msgid "Move node one level down" +msgstr "Mazgą perkelti vienu lygiu žemiau" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup +msgid "Move node one level up" +msgstr "Mazgą perkelti vienu lygiu aukščiau" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeup +msgid "Move node up" +msgstr "Perkelti mazgą aukštyn" + +#: lazarusidestrconsts:lispatheditmovepathdown +msgid "Move path down" +msgstr "Perkelti kelią žemyn" + +#: lazarusidestrconsts:lispatheditmovepathup +msgid "Move path up" +msgstr "Perkelti kelią aukštyn" + +#: lazarusidestrconsts:fdmordermovetoback +msgid "Move to back" +msgstr "Perkelti į galą" + +#: lazarusidestrconsts:fdmordermovetofront +msgid "Move to front" +msgstr "Perkelti į priekį" + +#: lazarusidestrconsts:dlgmultiselect +msgid "Multi Select" +msgstr "Pažymėti kelis" + +#: lazarusidestrconsts:dlgmultiline +msgid "Multiline" +msgstr "Kelios eilutės" + +#: lazarusidestrconsts:lisfindfilemultiline +msgid "Multiline pattern" +msgstr "Kelių eilučių modelis" + +#: lazarusidestrconsts:fdinvalidmultiselectiontext +msgid "Multiselected components must be of a single form." +msgstr "Kelios pažymėtos komponentės turi būti toje pačioje formoje." + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal +msgid "NOTE: Could not create Define Template for Free Pascal Sources" +msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto FreePascal pirminiam kodui" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources +msgid "NOTE: Could not create Define Template for Lazarus Sources" +msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto Lazarus pirminiam kodui" + +#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults +msgid "NOTE: codetools config file not found - using defaults" +msgstr "Pastaba: nerastas CodeTools nustatymų failas - naudojami numatytieji nustatymai." + +#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile +msgid "NOTE: loading old codetools options file: " +msgstr "Pastaba: įkeliami senasis CodeTools parinkčių failas:" + +#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow +msgid "NOTE: only absolute paths are supported now" +msgstr "Pastaba: šiuo metu palaikomi tik absoliutūs keliai" + +#: lazarusidestrconsts:lisdebugoptionsfrmname +msgid "Name" +msgstr "Vardas" + +#: lazarusidestrconsts:lisnameofnewprocedure +msgid "Name of new procedure" +msgstr "Naujos procedūros vardas" + +#: lazarusidestrconsts:liscodetoolsdefsname +msgid "Name:" +msgstr "Vardas:" + +#: lazarusidestrconsts:dlgnaming +msgid "Naming" +msgstr "Vardų suteikimas" + +#: lazarusidestrconsts:lisceoneveronlymanually +msgid "Never, only manually" +msgstr "Niekada, tik rankiniu būdu" + +#: lazarusidestrconsts:lismenutemplatenew +msgid "New" +msgstr "Naujas" + +#: lazarusidestrconsts:lismenunewother +msgid "New ..." +msgstr "Naujas..." + +#: lazarusidestrconsts:lisnewancestors +msgid "New Ancestors" +msgstr "Naujas protėvis" + +#: lazarusidestrconsts:lisnewclass +msgid "New Class" +msgstr "Nauja klasė" + +#: lazarusidestrconsts:lisa2pnewcomponent +msgid "New Component" +msgstr "Nauja komponentė" + +#: lazarusidestrconsts:lisa2pnewfile +msgid "New File" +msgstr "Naujas failas" + +#: lazarusidestrconsts:lismenunewform +msgid "New Form" +msgstr "Nauja forma" + +#: lazarusidestrconsts:lismenunewproject +msgid "New Project ..." +msgstr "Naujas projektas..." + +#: lazarusidestrconsts:lismenunewprojectfromfile +msgid "New Project from file ..." +msgstr "Naujas projektas iš failo..." + +#: lazarusidestrconsts:lisprojaddnewrequirement +msgid "New Requirement" +msgstr "Nauja priklausomybė" + +#: lazarusidestrconsts:lismenueditornewtemplatedescription +msgid "New Template Description..." +msgstr "Naujas šablono aprašymas..." + +#: lazarusidestrconsts:lismenunewunit +msgid "New Unit" +msgstr "Naujas modulis" + +#: lazarusidestrconsts:lisa2pnewclassname +msgid "New class name:" +msgstr "Naujos klasės vardaas:" + +#: lazarusidestrconsts:liskmnewproject +msgid "New project" +msgstr "Naujas projektas" + +#: lazarusidestrconsts:liskmnewprojectfromfile +msgid "New project from file" +msgstr "Naujas projektas iš failo" + +#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath +msgid "New unit not in unitpath" +msgstr "Naujojo modulio nėra modulių kelyje" + +#: lazarusidestrconsts:liscodetoolsdefsnewnode +msgid "NewNode" +msgstr "Mazgas" + +#: lazarusidestrconsts:lispkgmangnewpackage +msgid "NewPackage" +msgstr "Naujas paketas" + +#: lazarusidestrconsts:liscodetoolsoptsnewline +msgid "Newline" +msgstr "Nauja eilutė" + +#: lazarusidestrconsts:srvk_next +msgid "Next" +msgstr "Next" + +#: lazarusidestrconsts:srkmecnextbookmark +msgid "Next Bookmark" +msgstr "Tolesnė žymė" + +#: lazarusidestrconsts:lisnoresourcestringsectionfound +msgid "No ResourceString Section found" +msgstr "Nerasta \"ResourceString\" sekcija" + +#: lazarusidestrconsts:lisnobackupfiles +msgid "No backup files" +msgstr "Nedaryti atsarginių kopijų" + +#: lazarusidestrconsts:lisnochange +msgid "No change" +msgstr "Nekeisti" + +#: lazarusidestrconsts:lisnocodeselected +msgid "No code selected" +msgstr "Kodas nepažymėtas" + +#: lazarusidestrconsts:lisnocompileroptionsinherited +msgid "No compiler options inherited." +msgstr "Nėra paveldėtų kompiliatoriaus parinkčių." + +#: lazarusidestrconsts:lisdbgmangnodebuggerspecified +msgid "No debugger specified" +msgstr "Nenurodyta derintuvė" + +#: lazarusidestrconsts:dlgednoerr +msgid "No errors in key mapping found." +msgstr "Klavišų priskyrimuose klaidų nerasta." + +#: lazarusidestrconsts:lisnewdlgnoitemselected +msgid "No item selected" +msgstr "Nėra pažymėtų elementų" + +#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting +msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." +msgstr "%s%s%s priklausiniui nerastas paketas.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisoipnopackageselected +msgid "No package selected" +msgstr "Paketas nepažymėtas" + +#: lazarusidestrconsts:lisnoprogramfilesfound +msgid "No program file %s%s%s found." +msgstr "Nerastas programos failas %s%s%s." + +#: lazarusidestrconsts:lisnostringconstantfound +msgid "No string constant found" +msgstr "Nerasta teksto konstanta" + +#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly +msgid "Node and its children are only valid for this project" +msgstr "Mazgas ir jo vaikai galioja tik šiam projektui" + +#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly +msgid "Node is readonly" +msgstr "Mazgas tik skaitymui" + +#: lazarusidestrconsts:srvk_nonconvert +msgid "Nonconvert" +msgstr "Nonconvert" + +#: lazarusidestrconsts:dlgenvnone +msgid "None" +msgstr "Joks" + +#: lazarusidestrconsts:dlgconormal +msgid "Normal Code" +msgstr "Normalų kodą" + +#: lazarusidestrconsts:srkmecnormalselect +msgid "Normal selection mode" +msgstr "Įprasta žymėjimo veiksena" + +#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta +msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" +msgstr "Įprastai filtre nurodomas reguliarusis reiškinys. Paprastojoje sintaksėje taškas \".\" įra įprastas simbolis, žvaigždė \"*\" atitinka betką, klaustukas \"?\" atitinka vieną kažkokį simbolį, kablelis arba kabliataškis atskiria alternatyvas. Pavyzdžiui: prasta sintaksė *.pas;*pp atitinka ^(.*\\.pas|.*\\.pp)$" + +#: lazarusidestrconsts:lisnotadelphiproject +msgid "Not a Delphi project" +msgstr "Ne Delphi projektas" + +#: lazarusidestrconsts:lisnotadelphiunit +msgid "Not a Delphi unit" +msgstr "Ne Delhi modulis" + +#: lazarusidestrconsts:lisuenotfound +msgid "Not found" +msgstr "Nerasta" + +#: lazarusidestrconsts:uenotimplcap +msgid "Not implemented yet" +msgstr "Dar neįgyvendinta" + +#: lazarusidestrconsts:lisnotnow +msgid "Not now" +msgstr "Ne dabar" + +#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme +msgid "Note: All keys will be set to the values of the choosen scheme." +msgstr "Pastaba: visi klavišai bus nustatyti pagal pasirinktą schemą" + +#: lazarusidestrconsts:dlgenvbackuphelpnote +msgid "Notes: Project files are all files in the project directory" +msgstr "Pastaba: projekto failai - visi failai, esantys projekto kataloge" + +#: lazarusidestrconsts:liscodetoolsoptsnumber +msgid "Number" +msgstr "Skaičius" + +#: lazarusidestrconsts:srvk_numlock +msgid "Numlock" +msgstr "Numlock" + +#: lazarusidestrconsts:srvk_numpad +msgid "Numpad %d" +msgstr "Numpad %d" + +#: lazarusidestrconsts:lisifdok +msgid "OK" +msgstr "Tinka" + +#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions +msgid "OS Exceptions" +msgstr "OS išimtinės situacijos" + +#: lazarusidestrconsts:uepovr +msgid "OVR" +msgstr "KEISTI" + +#: lazarusidestrconsts:lispckoptsobject +msgid "Object" +msgstr "Objektas" + +#: lazarusidestrconsts:lismenuviewobjectinspector +msgid "Object Inspector" +msgstr "Objektų inspektorius" + +#: lazarusidestrconsts:liskeycatobjinspector +msgid "Object Inspector commands" +msgstr "Objetų inspektoriaus komandos" + +#: lazarusidestrconsts:lisokbtn +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:lisoldancestors +msgid "Old Ancestors" +msgstr "Buvęs protėvis" + +#: lazarusidestrconsts:lisoldclass +msgid "Old Class" +msgstr "Buvusi klasė" + +#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead +msgid "On build project execute the Build File command instead" +msgstr "Darant projektą, ištikro vykdyti komandą \"Kurti failą\"" + +#: lazarusidestrconsts:lisceoonidle +msgid "On idle" +msgstr "Neveikos metu" + +#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead +msgid "On run project execute the Run File command instead" +msgstr "Startuojant projektą, ištikro vykdyti komandą \"Startuoti failą\"" + +#: lazarusidestrconsts:lismenuonlinehelp +msgid "Online Help" +msgstr "Internetinis žinynas" + +#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented +msgid "Online Help not yet implemented" +msgstr "Kontekstinis žinynas dar neįgyvendintas" + +#: lazarusidestrconsts:lisonlysearchforwholewords +msgid "Only search for whole words" +msgstr "Ieškoti tik ištisų žodžių" + +#: lazarusidestrconsts:lisdiffdlgonlyselection +msgid "Only selection" +msgstr "Tik pažymėtoje srityje" + +#: lazarusidestrconsts:lisfindfileonlytextfiles +msgid "Only text files" +msgstr "Tik teksto failai" + +#: lazarusidestrconsts:lishintopen +msgid "Open" +msgstr "Atverti" + +#: lazarusidestrconsts:lisopenlfm +msgid "Open %s" +msgstr "Atverti %s" + +#: lazarusidestrconsts:lismenuopen +msgid "Open ..." +msgstr "Atverti..." + +#: lazarusidestrconsts:lisdiffdlgopendiffineditor +msgid "Open Diff in editor" +msgstr "Diff atverti redaktoriuje" + +#: lazarusidestrconsts:liscpopenpackage +msgid "Open Package %s" +msgstr "Atverti paketą %s" + +#: lazarusidestrconsts:lisopenpackagefile +msgid "Open Package File" +msgstr "Atverti paketo failą" + +#: lazarusidestrconsts:lisopenpackage +msgid "Open Package?" +msgstr "Atverti paketą?" + +#: lazarusidestrconsts:lisctdefsopenpreview +msgid "Open Preview" +msgstr "Atverti peržiūros langą" + +#: lazarusidestrconsts:lismenuopenproject +msgid "Open Project ..." +msgstr "Atverti projektą..." + +#: lazarusidestrconsts:lisopenprojectfile +msgid "Open Project File" +msgstr "Atverti projekto failą" + +#: lazarusidestrconsts:lisopenproject +msgid "Open Project?" +msgstr "Atverti projektą?" + +#: lazarusidestrconsts:lismenutemplateopenrecent +msgid "Open Recent" +msgstr "Atverti paskiausiuosius" + +#: lazarusidestrconsts:lismenuopenrecent +msgid "Open Recent ..." +msgstr "Atverti paskutinį naudotą..." + +#: lazarusidestrconsts:lismenuopenrecentproject +msgid "Open Recent Project ..." +msgstr "Atverti paskutinį naudotą projektą..." + +#: lazarusidestrconsts:liscpopenunit +msgid "Open Unit %s" +msgstr "Atverti modulį %s" + +#: lazarusidestrconsts:lisopenasxmlfile +msgid "Open as XML file" +msgstr "Įkelti kaip XML failą" + +#: lazarusidestrconsts:lisopenexistingfile +msgid "Open existing file" +msgstr "Atverti failą" + +#: lazarusidestrconsts:lisopenfile +msgid "Open file" +msgstr "Atverti failą" + +#: lazarusidestrconsts:srkmecopenfileatcursor +msgid "Open file at cursor" +msgstr "Atverti ties žymekliu nurodytą failą" + +#: lazarusidestrconsts:lismenuopenfilenameatcursor +msgid "Open filename at cursor" +msgstr "Atverti ties žymekliu nurodytą failą" + +#: lazarusidestrconsts:dlgqopenlastprj +msgid "Open last project at start" +msgstr "Startuojant atverti paskutinisyk atvertą projektą" + +#: lazarusidestrconsts:lisoipopenloadedpackage +msgid "Open loaded package" +msgstr "Atverti įkeltą paketą" + +#: lazarusidestrconsts:lismenuopenpackage +msgid "Open loaded package ..." +msgstr "Atverti įkeltą paketą..." + +#: lazarusidestrconsts:lisiecoopenorloadcompileroptions +msgid "Open or Load Compiler Options" +msgstr "Atverti arba įkelti kompiliatoriaus parinktis" + +#: lazarusidestrconsts:liscomppalopenpackage +msgid "Open package" +msgstr "Atverti paketą" + +#: lazarusidestrconsts:liskmopenpackagefile +msgid "Open package file" +msgstr "Atverti paketo failą" + +#: lazarusidestrconsts:lismenuopenpackagefile +msgid "Open package file (.lpk) ..." +msgstr "Atverti paketo failą (.lpk)" + +#: lazarusidestrconsts:lismenuopenpackageofcurunit +msgid "Open package of current unit" +msgstr "Atverti veikiamojo modulio paketą" + +#: lazarusidestrconsts:lisopenproject2 +msgid "Open project" +msgstr "Atverti projektą" + +#: lazarusidestrconsts:lisopenprojectagain +msgid "Open project again" +msgstr "Vėl atverti projektą" + +#: lazarusidestrconsts:lisiecoopenrecent +msgid "Open recent" +msgstr "Atverti paskutinį naudotą" + +#: lazarusidestrconsts:lismenuopenrecentpkg +msgid "Open recent package ..." +msgstr "Atverti paskutinį naudotą paketą..." + +#: lazarusidestrconsts:lisopenthefileasnormalsource +msgid "Open the file as normal source" +msgstr "Failą įkelti kaip įprastą pirminį kodą" + +#: lazarusidestrconsts:lisopenthepackage +msgid "Open the package %s?" +msgstr "Atverti paketą %s?" + +#: lazarusidestrconsts:lisopentheproject +msgid "Open the project %s?" +msgstr "Atverti projektą %s?" + +#: lazarusidestrconsts:liscomppalopenunit +msgid "Open unit" +msgstr "Atverti modulį" + +#: lazarusidestrconsts:dlgoptimiz +msgid "Optimizations:" +msgstr "Optimizacija:" + +#: lazarusidestrconsts:liserrnooptionallowed +msgid "Option at position %d does not allow an argument: %s" +msgstr "Parinkčiai ties pozicija %s argumentai nepriimtini: %s" + +#: lazarusidestrconsts:liserroptionneeded +msgid "Option at position %d needs an argument : %s" +msgstr "Parinkčiai ties pozicija %d reikia nurodyti argumentą: %s" + +#: lazarusidestrconsts:fdmsnaptogridoption +msgid "Option: Snap to grid" +msgstr "Parinktis: pritraukti prie tinklelio taškų" + +#: lazarusidestrconsts:fdmsnaptoguidelinesoption +msgid "Option: Snap to guide lines" +msgstr "Parinktis: pritraukti prie pagalbinių linijų" + +#: lazarusidestrconsts:dlgfropts +msgid "Options" +msgstr "Parinktys" + +#: lazarusidestrconsts:lislazbuildoptions +msgid "Options:" +msgstr "Parinktys:" + +#: lazarusidestrconsts:dlgcoopts +msgid "Options: " +msgstr "Parinktys: " + +#: lazarusidestrconsts:fdmorder +msgid "Order" +msgstr "Eilė" + +#: lazarusidestrconsts:dlgsrorigin +msgid "Origin" +msgstr "Pradžia" + +#: lazarusidestrconsts:dlgcoother +msgid "Other" +msgstr "Kiti" + +#: lazarusidestrconsts:dlgcosources +msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" +msgstr "Kiti pirminiai kodai (.pp/.pas failai, skirta tik IKA, ne kompiliatoriui)" + +#: lazarusidestrconsts:dlgotherunitfiles +msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" +msgstr "Kitų modulių failai (-Fu) (atskirti kabliataškiais)" + +#: lazarusidestrconsts:dlgenvotherfiles +msgid "Other files" +msgstr "Kiti failai" + +#: lazarusidestrconsts:lisdebugoptionsfrmoutput +msgid "Output" +msgstr "Išvestis" + +#: lazarusidestrconsts:dlgpooutputsettings +msgid "Output Settings" +msgstr "Išvesties nuostatos" + +#: lazarusidestrconsts:lispkgdefsoutputdirectory +msgid "Output directory" +msgstr "Išvesties katalogas" + +#: lazarusidestrconsts:dlgcooverflow +msgid "Overflow" +msgstr "Perpildymą" + +#: lazarusidestrconsts:lisoverridelanguage +msgid "Override language. For example --language=de. For possible values see files in the languages directory." +msgstr "Viršesnė kalba. Pavyzdžiui: --language=de. Galimas reikšmes galite sužinoti žvilgterėje į kalbų katalogą." + +#: lazarusidestrconsts:lissvuooverridesystemvariable +msgid "Override system variable" +msgstr "Kurti viršesnį sistemos kintamąjį" + +#: lazarusidestrconsts:srkmecoverwritemode +msgid "Overwrite Mode" +msgstr "Perrašymo veiksena" + +#: lazarusidestrconsts:lisoverwritefileondisk +msgid "Overwrite file on disk" +msgstr "Perrašyti failą diske" + +#: lazarusidestrconsts:lisoverwritefile +msgid "Overwrite file?" +msgstr "Perrašyti failą?" + +#: lazarusidestrconsts:lispackage +msgid "Package" +msgstr "Paketas" + +#: lazarusidestrconsts:lispckeditpackage +msgid "Package %s" +msgstr "Paketas %s" + +#: lazarusidestrconsts:lispckexplpackagenotfound +msgid "Package %s not found" +msgstr "%s paketas nerastas" + +#: lazarusidestrconsts:lispkgmangpackagechangedsave +msgid "Package %s%s%s changed. Save?" +msgstr "Paketas %s%s%s pakeistas. Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage +msgid "Package %s%s%s has changed.%sSave package?" +msgstr "Paketas %s%s%s pakeistas.%sIšsaugoti paketą?" + +#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory +msgid "Package %s%s%s has no valid output directory:%s%s%s%s" +msgstr "Paketui %s%s%s nurodytas blogas katalogas:%s%s%s%s" + +#: lazarusidestrconsts:lisaf2ppackagenotfound +msgid "Package %s%s%s not found." +msgstr "Paketas %s%s%s nerastas." + +#: lazarusidestrconsts:lismenupackagegraph +msgid "Package Graph ..." +msgstr "Paketų grafas..." + +#: lazarusidestrconsts:lispackageinfo +msgid "Package Info" +msgstr "Informacija apie paketą" + +#: lazarusidestrconsts:lisoippackagename +msgid "Package Name" +msgstr "Paketo vardas" + +#: lazarusidestrconsts:lisprojaddpackagename +msgid "Package Name:" +msgstr "Paketo vardas:" + +#: lazarusidestrconsts:lispckoptspackageoptions +msgid "Package Options" +msgstr "Paketo parinktys" + +#: lazarusidestrconsts:lispkgreg +msgid "Package Registration" +msgstr "Paketo registracija" + +#: lazarusidestrconsts:lispkgdefssrcdirmark +msgid "Package Source Directory Mark" +msgstr "Paketo pradinio katalogo žymė" + +#: lazarusidestrconsts:lispkgmangpackageconflicts +msgid "Package conflicts" +msgstr "Paketų konfliktas" + +#: lazarusidestrconsts:lispkgmangpackagefilemissing +msgid "Package file missing" +msgstr "Trūksta paketo failo" + +#: lazarusidestrconsts:lispkgsyspackagefilenotfound +msgid "Package file not found" +msgstr "Nerastas paketo failas" + +#: lazarusidestrconsts:lispkgmangpackagefilenotsaved +msgid "Package file not saved" +msgstr "Paketo failas neišsaugotas" + +#: lazarusidestrconsts:liskmpackagegraph +msgid "Package graph" +msgstr "Paketų grafas" + +#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage +msgid "Package is no designtime package" +msgstr "Paketas nėra skirtas modeliavimo rėžimui" + +#: lazarusidestrconsts:lisaf2ppackageisreadonly +msgid "Package is read only" +msgstr "Paketas tik skaitymui" + +#: lazarusidestrconsts:lispkgmangpackageisrequired +msgid "Package is required" +msgstr "Paketas reikalingas" + +#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists +msgid "Package name already exists" +msgstr "Paketas šiuo vardu jau egzistuoja" + +#: lazarusidestrconsts:lispackagenamebeginswith +msgid "Package name begins with ..." +msgstr "Paketo vardas prasideda..." + +#: lazarusidestrconsts:lispackagenamecontains +msgid "Package name contains ..." +msgstr "Paketo varde yra..." + +#: lazarusidestrconsts:lispackageneedsinstallation +msgid "Package needs installation" +msgstr "Paketą reikia įdiegti" + +#: lazarusidestrconsts:lisprojaddpackagenotfound +msgid "Package not found" +msgstr "Paketas nerastas" + +#: lazarusidestrconsts:lispkgmangpackage +msgid "Package: %s" +msgstr "Paketui: %s" + +#: lazarusidestrconsts:lispckoptspackagetype +msgid "PackageType" +msgstr "Paketo tipas" + +#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk +msgid "Packages must have the extension .lpk" +msgstr "Paketų failų prievardis turi būti .lpk" + +#: lazarusidestrconsts:lispackagestoinstallintheide +msgid "Packages to install in the IDE" +msgstr "Į IKA diegtini paketai" + +#: lazarusidestrconsts:lisa2ppagenametoolong +msgid "Page Name too long" +msgstr "Perilgas vardas" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu +msgid "Paint designer items only on idle (reduce overhead for slow computers)" +msgstr "Piešti tik IKA esančius konstruktoriaus elementus (sumažina lėtų kompiuterių apkrovą)" + +#: lazarusidestrconsts:lisa2ppalettepage +msgid "Palette Page:" +msgstr "Paletės lapas:" + +#: lazarusidestrconsts:lissortselparagraphs +msgid "Paragraphs" +msgstr "Pastraipos" + +#: lazarusidestrconsts:liscmparameter +msgid "Parameter" +msgstr "Parametras" + +#: lazarusidestrconsts:lisedtexttoolparameters +msgid "Parameters:" +msgstr "Parametrai:" + +#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch +msgid "Parent node can not contain child nodes." +msgstr "Tėvinis mazgas negali turėti mazgų-sūnų." + +#: lazarusidestrconsts:dlgcoparsing +msgid "Parsing" +msgstr "Analizė" + +#: lazarusidestrconsts:lispascalsourcefile +msgid "Pascal source file" +msgstr "Paskalio pirminio kodo failas" + +#: lazarusidestrconsts:lispascalunit +msgid "Pascal unit" +msgstr "Paskalio modulis" + +#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas +msgid "Pascal units must have the extension .pp or .pas" +msgstr "Paskalio modulių failų prievardis turi būti .pp arba .pas" + +#: lazarusidestrconsts:dlgpassoptslinker +msgid "Pass Options To The Linker (Delimiter is space)" +msgstr "Perduoti parinktis saistyklei (atskirta kabliataškiais)" + +#: lazarusidestrconsts:lismenupaste +msgid "Paste" +msgstr "Įdėti" + +#: lazarusidestrconsts:liskmpastecomponentsfromclipboard +msgid "Paste Components from clipboard" +msgstr "Įdėti komponentę iš iškarpinės" + +#: lazarusidestrconsts:srkmecpaste +msgid "Paste clipboard to current position" +msgstr "Iš iškarpinės įdėti veikiamojoje vietoje" + +#: lazarusidestrconsts:lisdsgpastecomponents +msgid "Paste selected components from clipboard" +msgstr "Įterpti pažymėtas komponentes iš iškarpinės" + +#: lazarusidestrconsts:lispatheditpathtemplates +msgid "Path templates" +msgstr "Kelio šablonai" + +#: lazarusidestrconsts:listofpcpath +msgid "Path:" +msgstr "Failas:" + +#: lazarusidestrconsts:dlgsearchpaths +msgid "Paths" +msgstr "Keliai" + +#: lazarusidestrconsts:lisuidpathsreadonly +msgid "Paths (Read Only)" +msgstr "Keliai (tik skaitymui)" + +#: lazarusidestrconsts:lismenupause +msgid "Pause" +msgstr "Pauzė" + +#: lazarusidestrconsts:srvk_pause +msgid "Pause key" +msgstr "Pause klavišas" + +#: lazarusidestrconsts:liskmpauseprogram +msgid "Pause program" +msgstr "Pristabdyti veiką" + +#: lazarusidestrconsts:dlgpersistentcaret +msgid "Persistent caret" +msgstr "Nuolatinis žymeklis" + +#: lazarusidestrconsts:lisplzcheckthecompilername +msgid "Please check the compiler name" +msgstr "Patikrinkite kompiliatoriaus vardą" + +#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory +msgid "Please check the freepascal source directory" +msgstr "Patikrinkite FreePascal pirminio kodo katalogą" + +#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring +msgid "Please choose a resourstring section from the list." +msgstr "Resursų eilutės sekciją pasirinkite iš sąrašo." + +#: lazarusidestrconsts:lispleaseopenaunitbeforerun +msgid "Please open a unit before run." +msgstr "Prieš startuojant atverkite modulį." + +#: lazarusidestrconsts:srkmpresskey +msgid "Please press a key ..." +msgstr "Spustelkit kokį nors klavišą..." + +#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage +msgid "Please save the file before adding it to a package." +msgstr "Failą būtina išsaugoti prieš dedant jį į paketą." + +#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst +msgid "Please save the package first." +msgstr "Pirma išsaugokite paketą." + +#: lazarusidestrconsts:lisoippleaseselectapackage +msgid "Please select a package" +msgstr "Pažymėkite paketą" + +#: lazarusidestrconsts:lisoippleaseselectapackagetoopen +msgid "Please select a package to open" +msgstr "Nurodykit kurį paketą atverti" + +#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst +msgid "Please select an item first." +msgstr "Būtina pažymėti kurį nors iš elementų." + +#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod +msgid "Please select some code to extract a new procedure/method." +msgstr "Prieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." + +#: lazarusidestrconsts:liscodetoolsoptspoint +msgid "Point" +msgstr "Taškas" + +#: lazarusidestrconsts:rslanguagepolish +msgid "Polish" +msgstr "Lenkų" + +#: lazarusidestrconsts:rslanguagepolishwin +msgid "Polish(CP1250)" +msgstr "Lenkų(CP1250)" + +#: lazarusidestrconsts:rslanguagepolishiso +msgid "Polish(ISO 8859-2)" +msgstr "Lenkų(ISO 8859-2)" + +#: lazarusidestrconsts:rslanguageportugues +msgid "Portuguese" +msgstr "Portugalų" + +#: lazarusidestrconsts:dlgwrdpreview +msgid "Preview" +msgstr "Peržiūra" + +#: lazarusidestrconsts:dlgcdtpreview +msgid "Preview (Max line length = 1)" +msgstr "Peržiūra (maksimalus eilutės ilgis - 1)" + +#: lazarusidestrconsts:srkmecprevbookmark +msgid "Previous Bookmark" +msgstr "Ankstesnė žymė" + +#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes +msgid "Previous node can not contain child nodes." +msgstr "Ankstesnis mazgas negali turėti mazgų-vaikų." + +#: lazarusidestrconsts:srvk_print +msgid "Print" +msgstr "Print" + +#: lazarusidestrconsts:listodolistprintlist +msgid "Print todo items" +msgstr "Spauzdinti ToDo sąrašą" + +#: lazarusidestrconsts:srvk_prior +msgid "Prior" +msgstr "Prior" + +#: lazarusidestrconsts:lisprivate +msgid "Private" +msgstr "Private" + +#: lazarusidestrconsts:lisprivatemethod +msgid "Private Method" +msgstr "Private metodas" + +#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti +msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" +msgstr "Prieš tesiant reiktų įdiegti kai kuriuos paketus.%sDėmesio:%sProjektas priklauso nuo kai kurių paketų, kuriuose yra moduliai su Register procedūra. Įprastai Register procedūra naudojama komponentėms diegti į IKA. Tačiau šie moduliai priklauso paketams, kurie dar nėra įdiegti į IKA. Bandant IKA atverti formą, kuri naudoja šias komponentes, bus pranešta kad trūksta komponenčių ir tolesnis formos įkėlimas gali pridaryti nepageidautinų nemalonumų.%s%sTai neatsilieps projekto atvėrimui ar jo pirminiam kodui.%s%sTai rik reiškia, kad nėra gerai prieš diegiant trūkstamus paketu atverti formas kūrimui.%s%s" + +#: lazarusidestrconsts:lisprocedure +msgid "Procedure" +msgstr "Procedūra" + +#: lazarusidestrconsts:uemprocedurejump +msgid "Procedure Jump" +msgstr "Rodyti procedūros paskelbimą arba jos kodą" + +#: lazarusidestrconsts:srkmecprocedurelist +msgid "Procedure List ..." +msgstr "Procedurų sąrašas..." + +#: lazarusidestrconsts:dlgforwardprocsinsertpolicy +msgid "Procedure insert policy" +msgstr "Procedūros įterpimo politika" + +#: lazarusidestrconsts:lisprocedurewithinterface +msgid "Procedure with interface" +msgstr "Procedūra su interfeisu" + +#: lazarusidestrconsts:lisdebugoptionsfrmprocess +msgid "Process" +msgstr "Procesas" + +#: lazarusidestrconsts:lisprogram +msgid "Program" +msgstr "Programa" + +#: lazarusidestrconsts:lisprogramdetected +msgid "Program detected" +msgstr "Aptikta programa" + +#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp +msgid "Program source must have a pascal extension like .pas, .pp or .lpr" +msgstr "Programos pirminio kodo failo prievardis turi būti panašus į paskalio: .pas, .pp arba .lpr" + +#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic +msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." +msgstr "Programa%sFreePascal programa. Lazarus automatiškai rūpinsis programos failu." + +#: lazarusidestrconsts:lisedtexttoolprogramfilename +msgid "Programfilename:" +msgstr "Programos failo vardas:" + +#: lazarusidestrconsts:lispdprogress +msgid "Progress" +msgstr "Eiga" + +#: lazarusidestrconsts:dlgenvproject +msgid "Project" +msgstr "Projektas" + +#: lazarusidestrconsts:lisprojectsuccessfullybuilt +msgid "Project %s%s%s successfully built. :)" +msgstr "Projektas %s%s%s sėkmingai padarytas :)" + +#: lazarusidestrconsts:lisedtdefprojectincpath +msgid "Project IncPath" +msgstr "Projekto IncPath" + +#: lazarusidestrconsts:lisprojectincpath +msgid "Project Include Path" +msgstr "Kelias iki projekto įterpinių" + +#: lazarusidestrconsts:lisprojectinformation +msgid "Project Information" +msgstr "Informacija apie projektą" + +#: lazarusidestrconsts:lismenuprojectinspector +msgid "Project Inspector" +msgstr "Projekto inspektorius" + +#: lazarusidestrconsts:lisprojinspprojectinspector +msgid "Project Inspector - %s" +msgstr "Projekto inspektorius - %s" + +#: lazarusidestrconsts:dlgprojectoptions +msgid "Project Options" +msgstr "Projekto parinktys" + +#: lazarusidestrconsts:lismenuprojectoptions +msgid "Project Options ..." +msgstr "Projekto parinktys..." + +#: lazarusidestrconsts:lisprojprojectsourcedirectorymark +msgid "Project Source Directory Mark" +msgstr "Projekto pradinio katalogo žymė" + +#: lazarusidestrconsts:lisprojectsrcpath +msgid "Project Src Path" +msgstr "Kelias iki projekto pirminio kodo" + +#: lazarusidestrconsts:lisedtdefprojectsrcpath +msgid "Project SrcPath" +msgstr "Projekto SrcPath" + +#: lazarusidestrconsts:lisprojectunitpath +msgid "Project Unit Path" +msgstr "Kelias iki projekto modulių" + +#: lazarusidestrconsts:lisedtdefprojectunitpath +msgid "Project UnitPath" +msgstr "Projekto UnitPath" + +#: lazarusidestrconsts:lisprojectchanged +msgid "Project changed" +msgstr "Projektas pakeistas" + +#: lazarusidestrconsts:lisprojectclosed +msgid "Project closed" +msgstr "Projektas užvertas" + +#: lazarusidestrconsts:lisprojectdirectory +msgid "Project directory" +msgstr "Projekto katalogas" + +#: lazarusidestrconsts:lisprojectfilename +msgid "Project filename" +msgstr "Projekto failo vardas" + +#: lazarusidestrconsts:dlgprojfiles +msgid "Project files" +msgstr "Projekto failai" + +#: lazarusidestrconsts:lisprojectinfofiledetected +msgid "Project info file detected" +msgstr "Aptiktas projekto informacinis failas" + +#: lazarusidestrconsts:lisprojectisrunnable +msgid "Project is runnable" +msgstr "Projektas yra vykdomasis" + +#: lazarusidestrconsts:lisprojectmacroproperties +msgid "Project macro properties" +msgstr "Projekto makrokomandos savybės" + +#: lazarusidestrconsts:srkmcatprojectmenu +msgid "Project menu commands" +msgstr "Menių \"Projektas\" komandos" + +#: lazarusidestrconsts:lispkgmangproject +msgid "Project: %s" +msgstr "Projektui: %s" + +#: lazarusidestrconsts:dlgpromptonreplace +msgid "Prompt On Replace" +msgstr "Reikalauti patvirtinimo" + +#: lazarusidestrconsts:lispromptforvalue +msgid "Prompt for value" +msgstr "Kvietimas įvesti reikšmę" + +#: lazarusidestrconsts:lishlpoptsproperties +msgid "Properties:" +msgstr "Savybės:" + +#: lazarusidestrconsts:dlgpropertycompletion +msgid "Property completion" +msgstr "\"Property\" užbaigimas" + +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "Savybės vardas" + +#: lazarusidestrconsts:lisprotected +msgid "Protected" +msgstr "Protected" + +#: lazarusidestrconsts:lisprotectedmethod +msgid "Protected Method" +msgstr "Protected metodas" + +#: lazarusidestrconsts:lispublicmethod +msgid "Public Method" +msgstr "Public metodas" + +#: lazarusidestrconsts:lispkgeditpublishpackage +msgid "Publish Package" +msgstr "Skelbti paketą" + +#: lazarusidestrconsts:lismenupublishproject +msgid "Publish Project ..." +msgstr "Skelbti projektą..." + +#: lazarusidestrconsts:liskmpublishproject +msgid "Publish project" +msgstr "Skelbti projektą" + +#: lazarusidestrconsts:lispublishprojdir +msgid "Publish project directory" +msgstr "Skelbiamo projekto katalogas" + +#: lazarusidestrconsts:lispublishedmethod +msgid "Published Method" +msgstr "Published metodas" + +#: lazarusidestrconsts:lismenuquickcompile +msgid "Quick compile" +msgstr "Spartus kompiliavimas" + +#: lazarusidestrconsts:liskmquickcompilenolinking +msgid "Quick compile, no linking" +msgstr "Kompiliuoti greitai, nesaistyti" + +#: lazarusidestrconsts:lismenuquicksyntaxcheck +msgid "Quick syntax check" +msgstr "Sparti sintaksės patikra" + +#: lazarusidestrconsts:lismenuquit +msgid "Quit" +msgstr "Baigti darbą" + +#: lazarusidestrconsts:lisquitlazarus +msgid "Quit Lazarus" +msgstr "Baigti Lazarus darbą" + +#: lazarusidestrconsts:dlgcorange +msgid "Range" +msgstr "Rėžį" + +#: lazarusidestrconsts:lispckeditreadddependency +msgid "Re-Add dependency" +msgstr "Išnaujo talpinti priklausinį" + +#: lazarusidestrconsts:lispckeditreaddfile +msgid "Re-Add file" +msgstr "Išnaujo talpinti failą" + +#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages +msgid "Re-Compile this and all required packages?" +msgstr "Kompiliuoti išnaujo šį ir kitus reikiamus paketus?" + +#: lazarusidestrconsts:lisreaderror +msgid "Read Error" +msgstr "Skaitymo klaida" + +#: lazarusidestrconsts:uemreadonly +msgid "Read Only" +msgstr "Tik skaitymui" + +#: lazarusidestrconsts:lispckeditreadonly +msgid "Read Only: %s" +msgstr "Tik skaitymui: %s" + +#: lazarusidestrconsts:liscodetoolsdefsreaderror +msgid "Read error" +msgstr "Klaida įkeliant" + +#: lazarusidestrconsts:dlgcdtreadprefix +msgid "Read prefix" +msgstr "\"Read\" prefiksas" + +#: lazarusidestrconsts:uepreadonly +msgid "Readonly" +msgstr "Tik skaitymui" + +#: lazarusidestrconsts:lispkgmangrebuildlazarus +msgid "Rebuild Lazarus?" +msgstr "Daryti Lazarus išnaujo?" + +#: lazarusidestrconsts:lisiecorecentfiles +msgid "Recent files" +msgstr "Paskutiniai naudoti" + +#: lazarusidestrconsts:lispckeditrecompileallrequired +msgid "Recompile all required" +msgstr "Kompiliuoti visus būtinus" + +#: lazarusidestrconsts:lispckeditrecompileclean +msgid "Recompile clean" +msgstr "Kompiliuoti išvalant" + +#: lazarusidestrconsts:lismenuredo +msgid "Redo" +msgstr "Pakartoti" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidle +msgid "Reduce designer painting" +msgstr "Sumažinti paišymą konstruktoriuje" + +#: lazarusidestrconsts:uemrefactor +msgid "Refactoring" +msgstr "Pertvarkymas" + +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "Paminėjimas" + +#: lazarusidestrconsts:dlgunitdeprefresh +msgid "Refresh" +msgstr "Atnaujinti" + +#: lazarusidestrconsts:lisceorefreshautomatically +msgid "Refresh automatically" +msgstr "Atnaujinti automatiškai" + +#: lazarusidestrconsts:listodolistrefresh +msgid "Refresh todo items" +msgstr "Atnaujinti ToDo sąrašą" + +#: lazarusidestrconsts:lispkgsysregisterprocedureisnil +msgid "Register procedure is nil" +msgstr "Procedūra Register yra nil" + +#: lazarusidestrconsts:lispckeditregisterunit +msgid "Register unit" +msgstr "Registruoti modulį" + +#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering +msgid "RegisterUnit was called, but no package is registering." +msgstr "Paleistas RegisterUnit, tačiau paketas nėra registruojamas." + +#: lazarusidestrconsts:lispckeditregisteredplugins +msgid "Registered plugins" +msgstr "Registruoti įskiepiai" + +#: lazarusidestrconsts:lispkgsysregistrationerror +msgid "Registration Error" +msgstr "Klaida registruojant" + +#: lazarusidestrconsts:dlgregularexpressions +msgid "Regular Expressions" +msgstr "Reguliarusis reiškinys" + +#: lazarusidestrconsts:lisfindfileregularexpressions +msgid "Regular expressions" +msgstr "Reguliarusis reiškinys" + +#: lazarusidestrconsts:lisrelativepaths +msgid "Relative paths" +msgstr "Santykiniai keliai" + +#: lazarusidestrconsts:lispckoptsrelease +msgid "Release" +msgstr "Laida" + +#: lazarusidestrconsts:lisdiskdiffrevertall +msgid "Reload from disk" +msgstr "Įkelti išnaujo" + +#: lazarusidestrconsts:lisexttoolremove +msgid "Remove" +msgstr "Pašalinti" + +#: lazarusidestrconsts:lispckeditremovedependency2 +msgid "Remove Dependency?" +msgstr "Panaikinti priklausomybę?" + +#: lazarusidestrconsts:liskmremoveactiveunitfromproject +msgid "Remove active unit from project" +msgstr "Pašalinti iš projekto aktyvųjį modulį" + +#: lazarusidestrconsts:lisremoveallinvalidproperties +msgid "Remove all invalid properties" +msgstr "Pašalinti klaidingas savybes" + +#: lazarusidestrconsts:liskmremovebreakpoint +msgid "Remove break point" +msgstr "Pašalinti stabdos tašką" + +#: lazarusidestrconsts:lispckeditremovedependency +msgid "Remove dependency" +msgstr "Pašalinti priklausinį" + +#: lazarusidestrconsts:lispckeditremovedependencyfrompackage +msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" +msgstr "Panaikinti priklausomybę %s%s%s%spaketui %s%s%s?" + +#: lazarusidestrconsts:lispckeditremovefile +msgid "Remove file" +msgstr "Pašalinti failą" + +#: lazarusidestrconsts:lisprojinspremovefilefromproject +msgid "Remove file %s from project?" +msgstr "Pašalinti failą %s iš projekto?" + +#: lazarusidestrconsts:lispckeditremovefilefrompackage +msgid "Remove file %s%s%s%sfrom package %s%s%s?" +msgstr "Išmesti failą %s%s%s%siš paketo %s%s%s?" + +#: lazarusidestrconsts:lispckeditremovefile2 +msgid "Remove file?" +msgstr "Išmesti failą?" + +#: lazarusidestrconsts:liscldirremovefilesmatchingfilter +msgid "Remove files matching filter" +msgstr "Pašalinti nurodytus failus" + +#: lazarusidestrconsts:lismenuremovefromproject +msgid "Remove from Project ..." +msgstr "Pašalinti iš projekto..." + +#: lazarusidestrconsts:lisoifremovefromfavouriteproperties +msgid "Remove from favourite properties" +msgstr "Pašalinti iš mėgstamiausiųjų savybių" + +#: lazarusidestrconsts:lisremovefromproject +msgid "Remove from project" +msgstr "Pašalinti iš projekto" + +#: lazarusidestrconsts:lislazdocdeletepathbutton +msgid "Remove path" +msgstr "Pašalinti kelią" + +#: lazarusidestrconsts:lispckeditremoveselecteditem +msgid "Remove selected item" +msgstr "Pašalinti pažymėtą elementą" + +#: lazarusidestrconsts:lisremovethem +msgid "Remove them" +msgstr "Pašalinti elementą" + +#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile +msgid "Removed Files (these entries are not saved to the lpk file)" +msgstr "Pašalinti failai (šie įrašai lpk faile neįrašyti)" + +#: lazarusidestrconsts:lisprojinspremovedrequiredpackages +msgid "Removed required packages" +msgstr "Pašalinti reikiami paketai" + +#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved +msgid "Removed required packages (these entries are not saved to the lpk file)" +msgstr "Pašalinti reikiami paketai (šie įrašai lpk faile neįrašyti)" + +#: lazarusidestrconsts:lisfrirename +msgid "Rename" +msgstr "Pervardyti" + +#: lazarusidestrconsts:lispkgmangrenamefilelowercase +msgid "Rename File lowercase?" +msgstr "Failo varde vien mažosios raidės?" + +#: lazarusidestrconsts:uemrenameidentifier +msgid "Rename Identifier" +msgstr "Pervardyti identifikatorių" + +#: lazarusidestrconsts:lismenurenameidentifier +msgid "Rename Identifier ..." +msgstr "Pervardyti identifikatorių..." + +#: lazarusidestrconsts:lisfrirenameallreferences +msgid "Rename all References" +msgstr "Pervardyti visus surastus" + +#: lazarusidestrconsts:lisrenamefilefailed +msgid "Rename file failed" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:lispkgmangrenamefileinpackage +msgid "Rename file in package?" +msgstr "Pervardinti failą pakete?" + +#: lazarusidestrconsts:lisrenamefile +msgid "Rename file?" +msgstr "Pervardyti failą?" + +#: lazarusidestrconsts:srkmecrenameidentifier +msgid "Rename identifier" +msgstr "Pervardyti identifikatorių" + +#: lazarusidestrconsts:lisfrirenameto +msgid "Rename to" +msgstr "Pervardyti į" + +#: lazarusidestrconsts:lisrenametolowercase +msgid "Rename to lowercase" +msgstr "Pervardyti mažosiomis" + +#: lazarusidestrconsts:lismenureplace +msgid "Replace" +msgstr "Pakeisti" + +#: lazarusidestrconsts:dlgreplaceall +msgid "Replace &All" +msgstr "Pakeisti &visus" + +#: lazarusidestrconsts:lismenureplace2 +msgid "Replace ..." +msgstr "Pakeisti..." + +#: lazarusidestrconsts:lispkgmangreplacefile +msgid "Replace File" +msgstr "Pakeisti failą" + +#: lazarusidestrconsts:lispkgmangreplaceexistingfile +msgid "Replace existing file %s%s%s?" +msgstr "Pakeisti esamą failą %s%s%s?" + +#: lazarusidestrconsts:srkmecreplace +msgid "Replace text" +msgstr "Pakeisti tekstą" + +#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith +msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" +msgstr "Pakeisti rastąjį %s%s%s%s į %s%s%s?" + +#: lazarusidestrconsts:lisreplacingselectionfailed +msgid "Replacing selection failed." +msgstr "Pakeisti pažymėtąjį nepavyko." + +#: lazarusidestrconsts:dlgreport +msgid "Report" +msgstr "Ataskaita" + +#: lazarusidestrconsts:lispckeditrequiredpackages +msgid "Required Packages" +msgstr "Būtini paketai" + +#: lazarusidestrconsts:lismenurescanfpcsourcedirectory +msgid "Rescan FPC source directory" +msgstr "Peržvelgti FPC pirminio kodo katalogą" + +#: lazarusidestrconsts:lismenuresetdebugger +msgid "Reset debugger" +msgstr "Atstatyti derintuvę pradžion" + +#: lazarusidestrconsts:lisresourceloaderror +msgid "Resource load error" +msgstr "Klaida įkeliant resursus" + +#: lazarusidestrconsts:lisresourcesaveerror +msgid "Resource save error" +msgstr "Klaida išsaugojant resursus" + +#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis +msgid "Resourcestring already exists" +msgstr "Tokia resursų eilutė jau yra" + +#: lazarusidestrconsts:lismakeresstrresourcestringsection +msgid "Resourcestring section:" +msgstr "Išteklių eilutės sekcija:" + +#: lazarusidestrconsts:lismenurestart +msgid "Restart" +msgstr "Startuoti išnaujo" + +#: lazarusidestrconsts:lislazbuildrestartafterbuild +msgid "Restart After Successfull Build" +msgstr "Padarius sėkmingai startuoti išnaujo" + +#: lazarusidestrconsts:rsiwprestorewindowgeometry +msgid "Restore window geometry" +msgstr "Atstatyti lango geometriją" + +#: lazarusidestrconsts:rsiwprestorewindowsize +msgid "Restore window size" +msgstr "Atstatyti lango dydį" + +#: lazarusidestrconsts:lisdebugoptionsfrmresume +msgid "Resume" +msgstr "Tęsti" + +#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled +msgid "Resume Handled" +msgstr "Tęsti apdorojant" + +#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled +msgid "Resume Unhandled" +msgstr "Tęsti praleidžiant" + +#: lazarusidestrconsts:srvk_return +msgid "Return" +msgstr "Return" + +#: lazarusidestrconsts:lismenurevert +msgid "Revert" +msgstr "Atstatyti" + +#: lazarusidestrconsts:lisrevertfailed +msgid "Revert failed" +msgstr "Atstatyti nepavyko" + +#: lazarusidestrconsts:lispkgeditrevertpackage +msgid "Revert package?" +msgstr "Atstatyti paketą?" + +#: lazarusidestrconsts:srvk_right +msgid "Right" +msgstr "Right" + +#: lazarusidestrconsts:dlgrightclickselects +msgid "Right Click selects" +msgstr "Dešinysis pelės spustelėjimas pažymi" + +#: lazarusidestrconsts:lisrightanchoring +msgid "Right anchoring" +msgstr "Dešinės prieraiša" + +#: lazarusidestrconsts:lisrightborderspacespinedithint +msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." +msgstr "" +"Dešinės kraštinės plotis.\n" +"Ši reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą dešiniosios kraštinės plotį" + +#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav +msgid "Right click on the items tree to get the popupmenu with all available package functions." +msgstr "Spustelėje dešinį pelės mygtuką ant medžio elemento iššoks meniu su visomis galimomis paketo funkcijomis." + +#: lazarusidestrconsts:dlgrightmargin +msgid "Right margin" +msgstr "Dešinioji paraštė" + +#: lazarusidestrconsts:dlgrightmargincolor +msgid "Right margin color" +msgstr "Dešiniosios paraštės spalva" + +#: lazarusidestrconsts:dlgrightmousemovescursor +msgid "Right mouse moves caret" +msgstr "Spragtelėjus dešinį pelės mygtuką perkeliamas žymeklis" + +#: lazarusidestrconsts:lisrightsides +msgid "Right sides" +msgstr "Sutapdinti dešiniuosius kraštus" + +#: lazarusidestrconsts:lisrightspaceequally +msgid "Right space equally" +msgstr "Tolygiai rikiuoti pagal dešiniuosius kraštus" + +#: lazarusidestrconsts:dlgrubberbandgroup +msgid "Rubber band" +msgstr "Žymėjimo rėmelis" + +#: lazarusidestrconsts:lismenuprojectrun +msgid "Run" +msgstr "Startuoti" + +#: lazarusidestrconsts:lisbfruncommand +msgid "Run Command" +msgstr "Startavimo komanda" + +#: lazarusidestrconsts:lismenurunfile +msgid "Run File" +msgstr "Startuoti failą" + +#: lazarusidestrconsts:lismenurunparameters +msgid "Run Parameters ..." +msgstr "Startavimo parametrai..." + +#: lazarusidestrconsts:srkmcatrunmenu +msgid "Run menu commands" +msgstr "Meniu \"Startuoti\" komandos" + +#: lazarusidestrconsts:dlgrunparameters +msgid "Run parameters" +msgstr "Starto parametrai" + +#: lazarusidestrconsts:liskmrunprogram +msgid "Run program" +msgstr "Startuoti programą" + +#: lazarusidestrconsts:lismenuruntocursor +msgid "Run to cursor" +msgstr "Startuoti iki žymeklio" + +#: lazarusidestrconsts:lisruntofailed +msgid "Run-to failed" +msgstr "Nepavyko Startuoti-Iki" + +#: lazarusidestrconsts:lispckoptsruntimeonly +msgid "Runtime only" +msgstr "Tik vykdymo metu" + +#: lazarusidestrconsts:rslanguagerussian +msgid "Russian" +msgstr "Rusų" + +#: lazarusidestrconsts:lissvnrevision +msgid "SVN Revision: " +msgstr "SVN poversijis:" + +#: lazarusidestrconsts:dlgbckupsubdir +msgid "Same name (in subdirectory)" +msgstr "Tokspat vardas (pakatalogyje)" + +#: lazarusidestrconsts:lismenusave +msgid "Save" +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lissavespace +msgid "Save " +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lissave +msgid "Save ..." +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lismenusaveall +msgid "Save All" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:lismenutemplatesaveas +msgid "Save As" +msgstr "Išsaugoti kaip" + +#: lazarusidestrconsts:dlgcharcasefileact +msgid "Save As - auto rename pascal files lower case" +msgstr "Išsaugant kitaip paskalio failus automatiškai pervardyti mažosiomis raidėmis" + +#: lazarusidestrconsts:lismenusaveas +msgid "Save As ..." +msgstr "Išsaugoti kaip..." + +#: lazarusidestrconsts:lismenueditorsaveastemplate +msgid "Save As Template..." +msgstr "Išsaugoti kaip šabloną..." + +#: lazarusidestrconsts:lispckeditsavechanges +msgid "Save Changes?" +msgstr "Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:lispkgmangsavepackagelpk +msgid "Save Package %s (*.lpk)" +msgstr "Išsaugoti paketą %s (*.lpk)" + +#: lazarusidestrconsts:lispkgmangsavepackage +msgid "Save Package?" +msgstr "Išsaugoti paketą?" + +#: lazarusidestrconsts:lismenusaveproject +msgid "Save Project" +msgstr "Išsaugoti projektą" + +#: lazarusidestrconsts:lissaveprojectlpi +msgid "Save Project %s (*.lpi)" +msgstr "Išsaugoti projektą %s (.lpi)" + +#: lazarusidestrconsts:lismenusaveprojectas +msgid "Save Project As ..." +msgstr "Projektą išsaugoti kaip..." + +#: lazarusidestrconsts:lissavesettings +msgid "Save Settings" +msgstr "Išsaugoti nuostatas" + +#: lazarusidestrconsts:lishintsaveall +msgid "Save all" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:lissaveallmessagestofile +msgid "Save all messages to file" +msgstr "Visus pranešimus įrašyti failan" + +#: lazarusidestrconsts:liscodetoolsdefssaveandexit +msgid "Save and Exit" +msgstr "Išsaugoti ir išeiti" + +#: lazarusidestrconsts:lissaveandexitdialog +msgid "Save and exit dialog" +msgstr "Išsaugoti ir uždaryti" + +#: lazarusidestrconsts:lissaveandrebuildide +msgid "Save and rebuild IDE" +msgstr "Išsaugoti ir daryti IKA" + +#: lazarusidestrconsts:lissavechangestoproject +msgid "Save changes to project %s?" +msgstr "Išsaugoti pakeitimus projekte %s?" + +#: lazarusidestrconsts:lissavechanges +msgid "Save changes?" +msgstr "Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:dlgsavedfile +msgid "Save desktop settings to file" +msgstr "Įrašyti darbastalio nustatas faile" + +#: lazarusidestrconsts:dlgsaveeditorinfo +msgid "Save editor info for closed files" +msgstr "Išsaugoti redaktoriaus informaciją apie užvertus failus" + +#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles +msgid "Save editor info of non project files" +msgstr "Išsaugoti redaktoriaus informaciją apie projektui nepriklausančius failus" + +#: lazarusidestrconsts:dlgsaveeditorinfoproject +msgid "Save editor info only for project files" +msgstr "Išsaugoti redaktoriaus informaciją tik apie projekto failus" + +#: lazarusidestrconsts:lissavefilebeforeclosingform +msgid "Save file %s%s%s%sbefore closing form %s%s%s?" +msgstr "Išsaugoti failą %s%s%s%sprieš užveriant formą %s%s%s?" + +#: lazarusidestrconsts:lissavefileas +msgid "Save file as" +msgstr "Išsaugoti failą kaip" + +#: lazarusidestrconsts:lisa2psavefiledialog +msgid "Save file dialog" +msgstr "Išsaugoti failą" + +#: lazarusidestrconsts:fdmsaveformasxml +msgid "Save form as xml" +msgstr "Išsaugoti formą kaip xml" + +#: lazarusidestrconsts:lisposaveinlpifil +msgid "Save in .lpi file" +msgstr "Išsaugoti .lpi faile" + +#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory +msgid "Save in .lps file in project directory" +msgstr "Išsaugoti .lps faile, projekto kataloge" + +#: lazarusidestrconsts:lisposaveinideconfigdirectory +msgid "Save in IDE config directory" +msgstr "Išsaugoti IKA nustatymų kataloge" + +#: lazarusidestrconsts:lissaveinfoofclosededitorfiles +msgid "Save info of closed editor files" +msgstr "Išsaugoti informaciją apie užvertus redaktoriaus failus" + +#: lazarusidestrconsts:lismvsavemessagestofiletxt +msgid "Save messages to file (*.txt)" +msgstr "Išsaugoti pranešimus faile (*.txt)" + +#: lazarusidestrconsts:lispckeditsavepackage +msgid "Save package" +msgstr "Išsaugoti paketą" + +#: lazarusidestrconsts:lispkgmangsavepackage2 +msgid "Save package?" +msgstr "Išsaugoti paketą?" + +#: lazarusidestrconsts:liskmsaveproject +msgid "Save project" +msgstr "Išsaugoti projektą" + +#: lazarusidestrconsts:liskmsaveprojectas +msgid "Save project as" +msgstr "Išsaugoti projektą kaip" + +#: lazarusidestrconsts:lisposavesessioninformationin +msgid "Save session information in" +msgstr "Sesijos informaciją išsaugoti į" + +#: lazarusidestrconsts:lislazbuildsavesettings +msgid "Save settings" +msgstr "Išsaugoti nuostatas" + +#: lazarusidestrconsts:lisiecosavetofile +msgid "Save to file" +msgstr "Išsaugoti faile" + +#: lazarusidestrconsts:lisiecosavetorecent +msgid "Save to recent" +msgstr "Išsaugoti paskutinį naudotame" + +#: lazarusidestrconsts:liskmsaveall +msgid "SaveAll" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:liskmsaveas +msgid "SaveAs" +msgstr "Išsaugoti kaip" + +#: lazarusidestrconsts:fdmscaleword +msgid "Scale" +msgstr "Mastelis" + +#: lazarusidestrconsts:lisscalingfactor +msgid "Scaling factor:" +msgstr "Santykinis mastelis:" + +#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure +msgid "Scan Unit for Unit Name and Register procedure" +msgstr "Modulyje ieškoti modulio vardo ir užregistruoti procedūrą" + +#: lazarusidestrconsts:liscoscanforfpcmessages +msgid "Scan for FPC messages" +msgstr "Ieškoti FPC pranešimų" + +#: lazarusidestrconsts:liscoscanformakemessages +msgid "Scan for Make messages" +msgstr "Ieškoti Make pranešimų" + +#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages +msgid "Scan output for Free Pascal Compiler messages" +msgstr "Išvestyje ieškoti FreePascalCompiler pranešimų" + +#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages +msgid "Scan output for make messages" +msgstr "Išvestyje ieškoti make pranešimų" + +#: lazarusidestrconsts:dlgscope +msgid "Scope" +msgstr "Sritis" + +#: lazarusidestrconsts:srvk_scroll +msgid "Scroll" +msgstr "Sroll" + +#: lazarusidestrconsts:dlgscrollbyoneless +msgid "Scroll by one less" +msgstr "Slenkant per lapą slinkti viena eilute mažiau" + +#: lazarusidestrconsts:srkmecscrolldown +msgid "Scroll down one line" +msgstr "Slinkti žemyn per vieną eilutę" + +#: lazarusidestrconsts:srkmecscrollleft +msgid "Scroll left one char" +msgstr "Slinkti kairėn per vieną simbolį" + +#: lazarusidestrconsts:dlgscrollpastendfile +msgid "Scroll past end of file" +msgstr "Failo pabaiga nesustabdo slinkties" + +#: lazarusidestrconsts:dlgscrollpastendline +msgid "Scroll past end of line" +msgstr "Eilutės pabaiga nesustabdo slinkties" + +#: lazarusidestrconsts:srkmecscrollright +msgid "Scroll right one char" +msgstr "Slinkti dešinėn per vieną simbolį" + +#: lazarusidestrconsts:srkmecscrollup +msgid "Scroll up one line" +msgstr "Slinkti aukštyn per vieną eilutę" + +#: lazarusidestrconsts:lissearchfor +msgid "Search For " +msgstr "Ko ieškoti" + +#: lazarusidestrconsts:lismenuviewsearchresults +msgid "Search Results" +msgstr "Ieškos rezultatai" + +#: lazarusidestrconsts:lissearchagain +msgid "Search again" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:lisfrisearchincommentstoo +msgid "Search in comments too" +msgstr "Taip pat ir komentaruose" + +#: lazarusidestrconsts:lispatheditsearchpaths +msgid "Search paths:" +msgstr "Ieškos keliai:" + +#: lazarusidestrconsts:lisuesearchstringnotfound +msgid "Search string '%s' not found!" +msgstr "Ieškomasis tekstas %s nerastas!" + +#: lazarusidestrconsts:dlgsearchabort +msgid "Search terminated by user." +msgstr "Iešką nutraukė naudotojas." + +#: lazarusidestrconsts:lisssearchtext +msgid "Search text" +msgstr "Teksto paieška" + +#: lazarusidestrconsts:lisfrisearchwhere +msgid "Search where" +msgstr "Kur ieškoti" + +#: lazarusidestrconsts:lisssearching +msgid "Searching" +msgstr "Ieškoma" + +#: lazarusidestrconsts:dlgsearchcaption +msgid "Searching..." +msgstr "Ieškoma..." + +#: lazarusidestrconsts:lisuesearching +msgid "Searching: %s" +msgstr "Ieškoma: %s" + +#: lazarusidestrconsts:lislazdocseealsotag +msgid "See also" +msgstr "Taip pat žiūrėkite" + +#: lazarusidestrconsts:lisseemessages +msgid "See messages." +msgstr "Peržvelkit pranešimus." + +#: lazarusidestrconsts:srkmecselleft +msgid "SelLeft" +msgstr "Žymėti simboliu kairiau" + +#: lazarusidestrconsts:srkmecselright +msgid "SelRight" +msgstr "Žymėti simboliu dešiniau" + +#: lazarusidestrconsts:lismenuselect +msgid "Select" +msgstr "Žymėjimas" + +#: lazarusidestrconsts:srkmecselectall +msgid "Select All" +msgstr "Žymėti viską" + +#: lazarusidestrconsts:lisctselectcodemacro +msgid "Select Code Macro" +msgstr "Išrink kodo makrokomandą" + +#: lazarusidestrconsts:lisselectdfmfiles +msgid "Select Delphi form files (*.dfm)" +msgstr "Nurodykite Delphi formos failus (*.dfm)" + +#: lazarusidestrconsts:srkmecseldown +msgid "Select Down" +msgstr "Žymėti eilute žemiau" + +#: lazarusidestrconsts:srkmecselgotoxy +msgid "Select Goto XY" +msgstr "Žymėti ir eiti į XY" + +#: lazarusidestrconsts:srkmecsellineend +msgid "Select Line End" +msgstr "Žymėti iki eilutės galo" + +#: lazarusidestrconsts:srkmecsellinestart +msgid "Select Line Start" +msgstr "Žymėti iki eilutės pradžios" + +#: lazarusidestrconsts:lismenueditorselectmenu +msgid "Select Menu:" +msgstr "Rinkitės menių:" + +#: lazarusidestrconsts:srkmecselpagebottom +msgid "Select Page Bottom" +msgstr "Žymėti iki lapo apačios" + +#: lazarusidestrconsts:srkmecselpagedown +msgid "Select Page Down" +msgstr "Žymėti lapu žemiau" + +#: lazarusidestrconsts:srkmecselpageleft +msgid "Select Page Left" +msgstr "Žymėti lapu kairiau" + +#: lazarusidestrconsts:srkmecselpageright +msgid "Select Page Right" +msgstr "Žymėti lapu dešiniau" + +#: lazarusidestrconsts:srkmecselpagetop +msgid "Select Page Top" +msgstr "Žymėti iki lapo viršaus" + +#: lazarusidestrconsts:srkmecselpageup +msgid "Select Page Up" +msgstr "Žymėti lapu aukščiau" + +#: lazarusidestrconsts:lismenueditorselecttemplate +msgid "Select Template:" +msgstr "Rinkitės šabloną:" + +#: lazarusidestrconsts:srkmecselup +msgid "Select Up" +msgstr "Žymėti eilute aukščiau" + +#: lazarusidestrconsts:srkmecselwordleft +msgid "Select Word Left" +msgstr "Žymėti žodžiu kairiau" + +#: lazarusidestrconsts:srkmecselwordright +msgid "Select Word Right" +msgstr "Žymėti žodžiu dešiniau" + +#: lazarusidestrconsts:lisselectahelpitem +msgid "Select a help item:" +msgstr "Rinkitės žinyno elementą:" + +#: lazarusidestrconsts:lisselectanode +msgid "Select a node" +msgstr "Pažymėkit mazgą" + +#: lazarusidestrconsts:lisnpselectaprojecttype +msgid "Select a project type" +msgstr "Pasirinkite projekto tipą" + +#: lazarusidestrconsts:lismenuselectall +msgid "Select all" +msgstr "Pažymėti viską" + +#: lazarusidestrconsts:lismenuselectcodeblock +msgid "Select code block" +msgstr "Pažymėti kodo bloką" + +#: lazarusidestrconsts:lispatheditselectdirectory +msgid "Select directory" +msgstr "Rinkitės katalogą" + +#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds +msgid "Select grand childs" +msgstr "Žymėti provaikius" + +#: lazarusidestrconsts:lismenuselectline +msgid "Select line" +msgstr "Pažymėti eilutę" + +#: lazarusidestrconsts:liskmselectlineend +msgid "Select line end" +msgstr "Žymėti iki eilutės galo" + +#: lazarusidestrconsts:liskmselectlinestart +msgid "Select line start" +msgstr "Žymėti iki eilutės pradžios" + +#: lazarusidestrconsts:liskmselectpagebottom +msgid "Select page bottom" +msgstr "Žymėti iki lapo apačios" + +#: lazarusidestrconsts:liskmselectpagetop +msgid "Select page top" +msgstr "Žymėti iki lapo viršaus" + +#: lazarusidestrconsts:lismenuselectparagraph +msgid "Select paragraph" +msgstr "Pažymėti paragrafą" + +#: lazarusidestrconsts:lisdsgselectparentcomponent +msgid "Select parent component" +msgstr "Pažymėkite tėvinę komponentę" + +#: lazarusidestrconsts:srkmecseleditortop +msgid "Select to absolute beginning" +msgstr "Žymėti iki absoliučios pradžios" + +#: lazarusidestrconsts:srkmecseleditorbottom +msgid "Select to absolute end" +msgstr "Žymėti iki absoliučios pabaigos" + +#: lazarusidestrconsts:lismenuselecttobrace +msgid "Select to brace" +msgstr "Pažymėti iki skliaustelio" + +#: lazarusidestrconsts:lismenuselectword +msgid "Select word" +msgstr "Pažymėti žodį" + +#: lazarusidestrconsts:liskmselectwordleft +msgid "Select word left" +msgstr "Pažymėti žodį kairėje" + +#: lazarusidestrconsts:liskmselectwordright +msgid "Select word right" +msgstr "Pažymėti žodį dešinėje" + +#: lazarusidestrconsts:liscodetoolsdefsselectednode +msgid "Selected Node:" +msgstr "Pažymėtas mazgas:" + +#: lazarusidestrconsts:dlgselectedtext +msgid "Selected Text" +msgstr "Pažymėtame tekste" + +#: lazarusidestrconsts:lispckexplisrequiredby +msgid "Selected package is required by:" +msgstr "Pažymėtojo paketo reikia:" + +#: lazarusidestrconsts:dlgruberbandselectioncolor +msgid "Selection" +msgstr "Žymėjimas" + +#: lazarusidestrconsts:lisselectionexceedsstringconstant +msgid "Selection exceeds string constant" +msgstr "Pažymėta daugiau nei eilutės konstanta" + +#: lazarusidestrconsts:lisselectiontool +msgid "Selection tool" +msgstr "Žymėjimo įrankis" + +#: lazarusidestrconsts:liscodetoolsoptssemicolon +msgid "Semicolon" +msgstr "Kabliataškis" + +#: lazarusidestrconsts:dlgposavesession +msgid "Session" +msgstr "Sesija" + +#: lazarusidestrconsts:srkmecsetmarker +msgid "Set Marker %d" +msgstr "Uždėti žymeklį %d" + +#: lazarusidestrconsts:uemsetfreebookmark +msgid "Set a free Bookmark" +msgstr "Padėti laisvą žymę" + +#: lazarusidestrconsts:lismenusetfreebookmark +msgid "Set a free bookmark" +msgstr "Padėti laisvą žymę" + +#: lazarusidestrconsts:dlgsetallelementdefault +msgid "Set all elements to default" +msgstr "Visiems priskirti numatytą reikšmę" + +#: lazarusidestrconsts:dlgsetelementdefault +msgid "Set element to default" +msgstr "Priskirti numatytą reikšmę" + +#: lazarusidestrconsts:liskmsetfreebookmark +msgid "Set free Bookmark" +msgstr "Padėti laisvą žymę" + #: lazarusidestrconsts:liskmsetmarker0 msgid "Set marker 0" msgstr "Uždėti žymeklį 0" @@ -5031,1073 +7215,547 @@ msgstr "Uždėti žymeklį 8" msgid "Set marker 9" msgstr "Uždėti žymeklį 9" -#: lazarusidestrconsts:srkmecgotomarker -msgid "Go to Marker %d" -msgstr "Rodyti žymeklį %d" +#: lazarusidestrconsts:dlgsetpropertyvariable +msgid "Set property Variable" +msgstr "\"Set\" kintamojo vardas" -#: lazarusidestrconsts:srkmecsetmarker -msgid "Set Marker %d" -msgstr "Uždėti žymeklį %d" - -#: lazarusidestrconsts:srkmecjumptoeditor -msgid "Focus to source editor" -msgstr "Aktyvuoti pirminio kodo redaktorių" - -#: lazarusidestrconsts:liskmtogglebetweenunitandform -msgid "Toggle between Unit and Form" -msgstr "Persijungti tarp formos ir modulio" - -#: lazarusidestrconsts:srkmecnexteditor -msgid "Go to next editor" -msgstr "Eiti į tolesnį redaktorių" - -#: lazarusidestrconsts:srkmecpreveditor -msgid "Go to prior editor" -msgstr "Eiti į ankstesni redaktorių" - -#: lazarusidestrconsts:liskmaddbreakpoint -msgid "Add break point" -msgstr "Padėti stabdos tašką" - -#: lazarusidestrconsts:liskmremovebreakpoint -msgid "Remove break point" -msgstr "Pašalinti stabdos tašką" - -#: lazarusidestrconsts:srkmecmoveeditorleft -msgid "Move editor left" -msgstr "Perkelti redaktorių kairėn" - -#: lazarusidestrconsts:srkmecmoveeditorright -msgid "Move editor right" -msgstr "Perkelti redaktorių dešinėn" - -#: lazarusidestrconsts:liskmgotosourceeditor1 -msgid "Go to source editor 1" -msgstr "Rodyti pirminio kodo redaktoriaus 1 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor2 -msgid "Go to source editor 2" -msgstr "Rodyti pirminio kodo redaktoriaus 2 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor3 -msgid "Go to source editor 3" -msgstr "Rodyti pirminio kodo redaktoriaus 3 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor4 -msgid "Go to source editor 4" -msgstr "Rodyti pirminio kodo redaktoriaus 4 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor5 -msgid "Go to source editor 5" -msgstr "Rodyti pirminio kodo redaktoriaus 5 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor6 -msgid "Go to source editor 6" -msgstr "Rodyti pirminio kodo redaktoriaus 6 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor7 -msgid "Go to source editor 7" -msgstr "Rodyti pirminio kodo redaktoriaus 7 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor8 -msgid "Go to source editor 8" -msgstr "Rodyti pirminio kodo redaktoriaus 8 kortelę" - -#: lazarusidestrconsts:liskmgotosourceeditor9 -msgid "Go to source editor 9" -msgstr "Rodyti pirminio kodo redaktoriaus 9 kortelę" - -#: lazarusidestrconsts:srkmecgotoeditor -msgid "Go to editor %d" -msgstr "Rodyti %s redaktorių" - -#: lazarusidestrconsts:srkmecselectiontabs2spaces -msgid "Convert tabs to spaces in selection" -msgstr "Pažymėjime tabuliatoriaus simbolius konvertuoti į tarpų simbolius" - -#: lazarusidestrconsts:liskmencloseselection -msgid "Enclose selection" -msgstr "Apgaubti pažymėtąjį" - -#: lazarusidestrconsts:srkmecinsertcharacter -msgid "Insert from Charactermap" -msgstr "Įterpti iš simbolių lentelės" - -#: lazarusidestrconsts:srkmecinsertgplnotice -msgid "Insert GPL notice" -msgstr "Įterpti GPL raštą" - -#: lazarusidestrconsts:srkmecinsertlgplnotice -msgid "Insert LGPL notice" -msgstr "Įterpti LGPL raštą" - -#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice -msgid "Insert modified LGPL notice" -msgstr "Įterpti modifikuotą LGPL raštą" - -#: lazarusidestrconsts:liskminsertusername -msgid "Insert username" -msgstr "Įterpti naudotojo vardą" - -#: lazarusidestrconsts:liskminsertdateandtime -msgid "Insert date and time" -msgstr "Įterpti datą ir laiką" - -#: lazarusidestrconsts:srkmecinsertusername -msgid "Insert current username" -msgstr "Įterpti dabartinį vartotojo vardą" - -#: lazarusidestrconsts:srkmecinsertdatetime -msgid "Insert current date and time" -msgstr "Įterpti dabartinę datą ir laiką" - -#: lazarusidestrconsts:srkmecinsertchangelogentry -msgid "Insert ChangeLog entry" -msgstr "Įterpti pakeitimų žurnalo įrašą" - -#: lazarusidestrconsts:srkmecinsertcvsauthor -msgid "Insert CVS keyword Author" -msgstr "Įterpti CVS raktažodį \"Author\"" - -#: lazarusidestrconsts:srkmecinsertcvsdate -msgid "Insert CVS keyword Date" -msgstr "Įterpti CVS raktažodį \"Date\"" - -#: lazarusidestrconsts:srkmecinsertcvsheader -msgid "Insert CVS keyword Header" -msgstr "Įterpti CVS raktažodį \"Header\"" - -#: lazarusidestrconsts:srkmecinsertcvsid -msgid "Insert CVS keyword ID" -msgstr "Įterpti CVS raktažodį \"ID\"" - -#: lazarusidestrconsts:srkmecinsertcvslog -msgid "Insert CVS keyword Log" -msgstr "Įterpti CVS raktažodį \"Log\"" - -#: lazarusidestrconsts:srkmecinsertcvsname -msgid "Insert CVS keyword Name" -msgstr "Įterpti CVS raktažodį \"Name\"" - -#: lazarusidestrconsts:srkmecinsertcvsrevision -msgid "Insert CVS keyword Revision" -msgstr "Įterpti CVS raktažodį \"Revision\"" - -#: lazarusidestrconsts:srkmecinsertcvssource -msgid "Insert CVS keyword Source" -msgstr "Įterpti CVS raktažodį \"Source\"" - -#: lazarusidestrconsts:srkmecfind -msgid "Find text" -msgstr "Ieškoti teksto" - -#: lazarusidestrconsts:srkmecfindnext -msgid "Find next" -msgstr "Ieškoti toliau" - -#: lazarusidestrconsts:srkmecfindprevious -msgid "Find previous" -msgstr "Ieškoti ankstesnio" - -#: lazarusidestrconsts:srkmecfindinfiles -msgid "Find in files" -msgstr "Ieškoti failuose" - -#: lazarusidestrconsts:srkmecreplace -msgid "Replace text" -msgstr "Pakeisti tekstą" - -#: lazarusidestrconsts:liskmfindincremental -msgid "Find incremental" -msgstr "Prieauginė paieška" - -#: lazarusidestrconsts:srkmecfindproceduredefinition -msgid "Find procedure definiton" -msgstr "Ieškoti procedūros apibrėžties" - -#: lazarusidestrconsts:srkmecfindproceduremethod -msgid "Find procedure method" -msgstr "Ieškoti procedūros metodo" - -#: lazarusidestrconsts:srkmecgotolinenumber -msgid "Go to line number" -msgstr "Rodyti eilutę nurodytu numeriu" - -#: lazarusidestrconsts:srkmecfindnextwordoccurrence -msgid "Find next word occurrence" -msgstr "Ieškoti žodžio toliau" - -#: lazarusidestrconsts:srkmecfindprevwordoccurrence -msgid "Find previous word occurrence" -msgstr "Ieškoti žodžio atgaline tvarka" - -#: lazarusidestrconsts:srkmecaddjumppoint -msgid "Add jump point" -msgstr "Pridėti peršokimo tašką" - -#: lazarusidestrconsts:liskmviewjumphistory -msgid "View jump history" -msgstr "Rodyti peršokimų istoriją" - -#: lazarusidestrconsts:srkmecopenfileatcursor -msgid "Open file at cursor" -msgstr "Atverti ties žymekliu nurodytą failą" - -#: lazarusidestrconsts:srkmecgotoincludedirective -msgid "Go to to include directive of current include file" -msgstr "Rodyti veikiamojo įdėtojo failo įdėjimo direktyvą" - -#: lazarusidestrconsts:srkmecprocedurelist -msgid "Procedure List ..." -msgstr "Procedurų sąrašas..." - -#: lazarusidestrconsts:srkmectoggleformunit -msgid "Switch between form and unit" -msgstr "Persijungti tarp formos ir modulio" - -#: lazarusidestrconsts:srkmectoggleobjectinsp -msgid "View Object Inspector" -msgstr "Rodyti objektų inspektorių" - -#: lazarusidestrconsts:srkmectogglesourceeditor -msgid "View Source Editor" -msgstr "Rodyti pirminio kodo redaktorių" - -#: lazarusidestrconsts:srkmectogglecodeexpl -msgid "View Code Explorer" -msgstr "Rodyti kodo tyrinėtoją" - -#: lazarusidestrconsts:srkmectogglelazdoc -msgid "View Documentation Editor" -msgstr "Rodyti dokumentacijos redaktorių" - -#: lazarusidestrconsts:srkmectogglemessages -msgid "View messages" -msgstr "Rodyti pranešimus" - -#: lazarusidestrconsts:srkmectogglesearchresults -msgid "View Search Results" -msgstr "Rodyti ieškos rezultatus" - -#: lazarusidestrconsts:srkmectogglewatches -msgid "View watches" -msgstr "Rodyti stebimuosius" - -#: lazarusidestrconsts:srkmectogglebreakpoints -msgid "View breakpoints" -msgstr "Rodyti stabdos taškus" - -#: lazarusidestrconsts:srkmectoggledebuggerout -msgid "View debugger output" -msgstr "Rodyti derintuvės išvestį" - -#: lazarusidestrconsts:srkmectogglelocals -msgid "View local variables" -msgstr "Rodyti vietinius kintamuosius" - -#: lazarusidestrconsts:srkmectogglecallstack -msgid "View call stack" -msgstr "Rodyti kreipčių dėklą" - -#: lazarusidestrconsts:srkmecviewunits -msgid "View units" -msgstr "Rodyti modulius" - -#: lazarusidestrconsts:srkmecviewforms -msgid "View forms" -msgstr "Rodyti formas" - -#: lazarusidestrconsts:srkmecviewunitdependencies -msgid "View unit dependencies" -msgstr "Rodyti modulio priklausomybes" - -#: lazarusidestrconsts:srkmecviewunitinfo -msgid "View unit information" -msgstr "Rodyti informaciją apie modulį" - -#: lazarusidestrconsts:srkmecviewanchoreditor -msgid "View anchor editor" -msgstr "Rodyti prieraišų redaktorių" - -#: lazarusidestrconsts:srkmectogglecodebrowser -msgid "View code browser" -msgstr "Rodyti kodo naršyklę" - -#: lazarusidestrconsts:srkmectogglecomppalette -msgid "View component palette" -msgstr "Rodyti komponenčių paletę" - -#: lazarusidestrconsts:srkmectoggleidespeedbtns -msgid "View IDE speed buttons" -msgstr "Rodyti IKA spartos mygtukus" - -#: lazarusidestrconsts:srkmecwordcompletion -msgid "Word completion" -msgstr "Užbaigti žodį" - -#: lazarusidestrconsts:srkmeccompletecode -msgid "Complete code" -msgstr "Užbaigti kodą" - -#: lazarusidestrconsts:srkmecshowcodecontext -msgid "Show code context" -msgstr "Rodyti kodo turinį" - -#: lazarusidestrconsts:srkmecextractproc -msgid "Extract procedure" -msgstr "Ištraukti procedūrą" - -#: lazarusidestrconsts:srkmecfindidentifierrefs -msgid "Find identifier references" -msgstr "Ieškoti identifikatoriaus įrašų" - -#: lazarusidestrconsts:srkmecrenameidentifier -msgid "Rename identifier" -msgstr "Pervardyti identifikatorių" - -#: lazarusidestrconsts:srkmecinvertassignment -msgid "Invert assignment" -msgstr "Sukeisti priskyrimą" - -#: lazarusidestrconsts:srkmecsyntaxcheck -msgid "Syntax check" -msgstr "Sintaksės patikra" - -#: lazarusidestrconsts:srkmecguessmisplacedifdef -msgid "Guess misplaced $IFDEF" -msgstr "Nuspėti nevietoj esančius $IFDEF" - -#: lazarusidestrconsts:srkmecfinddeclaration -msgid "Find declaration" -msgstr "Ieškoti paskelbimo" - -#: lazarusidestrconsts:srkmecfindblockotherend -msgid "Find block other end" -msgstr "Ieškoti bloko kito galo" - -#: lazarusidestrconsts:srkmecfindblockstart -msgid "Find block start" -msgstr "Ieškoti bloko pradžios" - -#: lazarusidestrconsts:srkmecbuild -msgid "build program/project" -msgstr "daryti programą/projektą" - -#: lazarusidestrconsts:srkmecbuildall -msgid "build all files of program/project" -msgstr "daryti visus programos/projekto failus" - -#: lazarusidestrconsts:srkmecquickcompile -msgid "quick compile, no linking" -msgstr "kompiliuoti greitai, nesaistyti" - -#: lazarusidestrconsts:srkmecabortbuild -msgid "abort build" -msgstr "nutraukti darymą" - -#: lazarusidestrconsts:srkmecrun -msgid "run program" -msgstr "startuoti programą" - -#: lazarusidestrconsts:srkmecpause -msgid "pause program" -msgstr "pristabdyti programos veiką" - -#: lazarusidestrconsts:srkmecstopprogram -msgid "stop program" -msgstr "sustabdyti programos veiką" - -#: lazarusidestrconsts:srkmecresetdebugger -msgid "reset debugger" -msgstr "atstatyti derintuvę" - -#: lazarusidestrconsts:srkmecaddbreakpoint -msgid "add break point" -msgstr "padėti stabdos tašką" - -#: lazarusidestrconsts:srkmecremovebreakpoint -msgid "remove break point" -msgstr "pašalinti stabdos tašką" - -#: lazarusidestrconsts:srkmecrunparameters -msgid "run parameters" -msgstr "starto parametrai" - -#: lazarusidestrconsts:srkmeccompileroptions -msgid "compiler options" -msgstr "kompiliatoriaus parinktys" - -#: lazarusidestrconsts:srkmecbuildfile -msgid "build file" -msgstr "daryti failą" - -#: lazarusidestrconsts:srkmecrunfile -msgid "run file" -msgstr "startuoti failą" - -#: lazarusidestrconsts:srkmecconfigbuildfile -msgid "config build file" -msgstr "Derinti failo darytuvę" - -#: lazarusidestrconsts:srkmecinspect -msgid "inspect" -msgstr "inspektuoti" - -#: lazarusidestrconsts:srkmecevaluate -msgid "evaluate/modify" -msgstr "įvertinti/modifikuoti" - -#: lazarusidestrconsts:srkmecaddwatch -msgid "add watch" -msgstr "stebėti" - -#: lazarusidestrconsts:srkmecexttoolsettings -msgid "External tools settings" -msgstr "Išorės įrankių nuostatos" - -#: lazarusidestrconsts:srkmecbuildlazarus -msgid "Build lazarus" -msgstr "Daryti Lazarus" - -#: lazarusidestrconsts:srkmecexttool -msgid "External tool %d" -msgstr "Išorės įrankis %d" - -#: lazarusidestrconsts:srkmeccustomtool -msgid "Custom tool %d" -msgstr "Naudotojo įrankis %d" - -#: lazarusidestrconsts:srkmecenvironmentoptions -msgid "General environment options" -msgstr "Pagrindinės aplinkos parinktys" - -#: lazarusidestrconsts:liskmeditoroptions -msgid "Editor options" -msgstr "Redaktoriaus parinktys" - -#: lazarusidestrconsts:liskmeditcodetemplates -msgid "Edit Code Templates" -msgstr "Keisti kodo šablonus" - -#: lazarusidestrconsts:liskmcodetoolsoptions -msgid "CodeTools options" -msgstr "CodeTools parinktys" - -#: lazarusidestrconsts:liskmcodetoolsdefineseditor -msgid "CodeTools defines editor" -msgstr "CodeTools apibrėžčių redaktorius" - -#: lazarusidestrconsts:srkmeccodetoolsoptions -msgid "Codetools options" -msgstr "CodeTools parinktys" - -#: lazarusidestrconsts:srkmeccodetoolsdefinesed -msgid "Codetools defines editor" -msgstr "CodeTools apibrėžčių redaktorius" - -#: lazarusidestrconsts:lismenurescanfpcsourcedirectory -msgid "Rescan FPC source directory" -msgstr "Peržvelgti FPC pirminio kodo katalogą" - -#: lazarusidestrconsts:srkmecmakeresourcestring -msgid "Make resource string" -msgstr "Sukurti resursų eilutę" - -#: lazarusidestrconsts:liskmdiffeditorfiles -msgid "Diff editor files" -msgstr "Redaktoriaus failus apdoroti komanda Diff" - -#: lazarusidestrconsts:liskmconvertdfmfiletolfm -msgid "Convert DFM file to LFM" -msgstr "Konvertuoti DFM į LFM" - -#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit -msgid "Convert Delphi unit to Lazarus unit" -msgstr "Konvertuoti Delphi modulį į Lazarus modulį" - -#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject -msgid "Convert Delphi project to Lazarus project" -msgstr "Konvertuoti Delphi projektą į Lazarus projektą" - -#: lazarusidestrconsts:srkmecdiff -msgid "Diff" -msgstr "Diff" - -#: lazarusidestrconsts:srkmecunknown -msgid "unknown editor command" -msgstr "nežinoma redaktoriaus komana" - -#: lazarusidestrconsts:srvk_unknown -msgid "Unknown" -msgstr "Nežinomas" - -#: lazarusidestrconsts:srvk_lbutton -msgid "Mouse Button Left" -msgstr "Pelės kairysis klavišas" - -#: lazarusidestrconsts:srvk_rbutton -msgid "Mouse Button Right" -msgstr "Pelės dešinysis klavišas" - -#: lazarusidestrconsts:srvk_mbutton -msgid "Mouse Button Middle" -msgstr "Pelės vidurinis klavišas" - -#: lazarusidestrconsts:srvk_back -msgid "Backspace" -msgstr "Backspace" - -#: lazarusidestrconsts:srvk_tab -msgid "Tab" -msgstr "Tab" - -#: lazarusidestrconsts:srvk_clear -msgid "Clear" -msgstr "Clear" - -#: lazarusidestrconsts:srvk_return -msgid "Return" -msgstr "Return" +#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway +msgid "Set the breakpoint anyway" +msgstr "Vistiek padėti stabdos tašką" #: lazarusidestrconsts:srvk_shift msgid "Shift" msgstr "Shift" -#: lazarusidestrconsts:srvk_control -msgid "Control" -msgstr "Ctrl" +#: lazarusidestrconsts:srkmecshifttab +msgid "Shift Tab" +msgstr "Shift Tab" -#: lazarusidestrconsts:srvk_menu -msgid "Menu" -msgstr "Menu" +#: lazarusidestrconsts:lislazdocshorttag +msgid "Short" +msgstr "Santrumpa" -#: lazarusidestrconsts:srvk_pause -msgid "Pause key" -msgstr "Pause klavišas" +#: lazarusidestrconsts:lisa2pshortenorexpandfilename +msgid "Shorten or expand filename" +msgstr "Suskleisti ar išplėsti failo vardą" -#: lazarusidestrconsts:srvk_capital -msgid "Capital" -msgstr "Caps Lock" +#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto +msgid "Should the file be renamed lowercase to%s%s%s%s?" +msgstr "Failo vardą rašyti vien mažosiomis raidėmis:%s%s%s%s?" -#: lazarusidestrconsts:srvk_kana -msgid "Kana" -msgstr "Kana" +#: lazarusidestrconsts:lisaf2pshowall +msgid "Show All" +msgstr "Rodyti visus" -#: lazarusidestrconsts:srvk_junja -msgid "Junja" -msgstr "Junja" +#: lazarusidestrconsts:lisuishowcodetoolsvalues +msgid "Show CodeTools Values" +msgstr "Rodyti CodeTools reikšmes" -#: lazarusidestrconsts:srvk_final -msgid "Final" -msgstr "Final" +#: lazarusidestrconsts:dlgcoshowerr +msgid "Show Errors" +msgstr "Rodyti klaidas" -#: lazarusidestrconsts:srvk_hanja -msgid "Hanja" -msgstr "Hanja" +#: lazarusidestrconsts:dlgguidelines +msgid "Show Guide Lines" +msgstr "Rodyti pagalbines linijas" -#: lazarusidestrconsts:srvk_escape -msgid "Escape" -msgstr "Esc" +#: lazarusidestrconsts:dlgshowhint +msgid "Show Hints" +msgstr "Rodyti užuominas" -#: lazarusidestrconsts:srvk_convert -msgid "Convert" -msgstr "Convert" +#: lazarusidestrconsts:dlghintsparametersendernotused +msgid "Show Hints for parameter \"Sender\" not used" +msgstr "Rodyti užuominas apie nenaudojamus \"Sender\" parametrus" -#: lazarusidestrconsts:srvk_nonconvert -msgid "Nonconvert" -msgstr "Nonconvert" +#: lazarusidestrconsts:dlghintsunused +msgid "Show Hints for unused units in main source" +msgstr "Rodyti užuominas apie pagrindiniame pirminiame kode nenaudojamus modulius" -#: lazarusidestrconsts:srvk_accept -msgid "Accept" -msgstr "Accept" +#: lazarusidestrconsts:uemshowlinenumbers +msgid "Show Line Numbers" +msgstr "Rodyti eilučių numerius" -#: lazarusidestrconsts:srvk_modechange -msgid "Mode Change" -msgstr "Mode Change" +#: lazarusidestrconsts:dlgshownotes +msgid "Show Notes" +msgstr "Rodyti pastabas" -#: lazarusidestrconsts:srvk_space -msgid "Space key" -msgstr "Space klavišas" +#: lazarusidestrconsts:dlgcoshowoptions +msgid "Show Options" +msgstr "Rodyti parinktis" -#: lazarusidestrconsts:srvk_prior -msgid "Prior" -msgstr "Prior" +#: lazarusidestrconsts:fdmshowoptions +msgid "Show Options for form editing" +msgstr "Formos konstravimo parinktys" -#: lazarusidestrconsts:srvk_next -msgid "Next" -msgstr "Next" +#: lazarusidestrconsts:dlgshowwarnings +msgid "Show Warnings" +msgstr "Rodyti perspėjimus" -#: lazarusidestrconsts:srvk_end -msgid "End" -msgstr "End" +#: lazarusidestrconsts:lisa2pshowall +msgid "Show all" +msgstr "Rodyti visus" -#: lazarusidestrconsts:srvk_home -msgid "Home" -msgstr "Home" +#: lazarusidestrconsts:liscoshowallmessages +msgid "Show all messages" +msgstr "Rodyti visus pranešimus" -#: lazarusidestrconsts:srvk_left -msgid "Left" -msgstr "Left" +#: lazarusidestrconsts:dlgshowprocserror +msgid "Show all procs on error" +msgstr "Įvykus klaidai rodyti visus procedūrų paskelbimus" -#: lazarusidestrconsts:srvk_up -msgid "Up" -msgstr "Up" +#: lazarusidestrconsts:dlgqshowborderspacing +msgid "Show border spacing" +msgstr "Rodyti rėmelio plotį" -#: lazarusidestrconsts:srvk_right -msgid "Right" -msgstr "Right" +#: lazarusidestrconsts:dlgclosebuttonsnotebook +msgid "Show close buttons in notebook" +msgstr "Redaktoriaus kortelėse rodyti \"Užverti\" mygtukus" -#: lazarusidestrconsts:srvk_print -msgid "Print" -msgstr "Print" +#: lazarusidestrconsts:srkmecshowcodecontext +msgid "Show code context" +msgstr "Rodyti kodo turinį" -#: lazarusidestrconsts:srvk_execute -msgid "Execute" -msgstr "Execute" +#: lazarusidestrconsts:dlgshowcompiledprocedures +msgid "Show compiled procedures" +msgstr "Rodyti kompiliuotas procedūras" + +#: lazarusidestrconsts:dlgshowcompileroptions +msgid "Show compiler options" +msgstr "Rodyti kompiliatoriaus parinktis" + +#: lazarusidestrconsts:dlgshowcaps +msgid "Show component captions" +msgstr "Rodyti komponenčių antraštes" + +#: lazarusidestrconsts:dlgshowconditionals +msgid "Show conditionals" +msgstr "Rodyti sąlygines instrukcijas" + +#: lazarusidestrconsts:dlgshowdebuginfo +msgid "Show debug info" +msgstr "Rodyti derinimo informaciją" + +#: lazarusidestrconsts:dlgshowdefinedmacros +msgid "Show defined macros" +msgstr "Rodyti " + +#: lazarusidestrconsts:dlgshowedrhints +msgid "Show editor hints" +msgstr "Redaktoriuje rodyti informacinius langelius" + +#: lazarusidestrconsts:dlgshoweverything +msgid "Show everything" +msgstr "Rodyti viską" + +#: lazarusidestrconsts:dlgshowexecutableinfo +msgid "Show executable info (Win32 only)" +msgstr "Rodyti vykdomosios bylos informaciją (tik Win32)" + +#: lazarusidestrconsts:dlgshowgeneralinfo +msgid "Show general info" +msgstr "Rodyti pagrindinę informaciją" + +#: lazarusidestrconsts:dlgqshowgrid +msgid "Show grid" +msgstr "Rodyti tinklelį" + +#: lazarusidestrconsts:dlgshowgutterhints +msgid "Show gutter hints" +msgstr "Rodyti kairiosios paraštės informacinius langelius" + +#: lazarusidestrconsts:lisshowhintsinobjectinspector +msgid "Show hints in Object Inspector" +msgstr "Rodyti informacinius langelius objektų inspektoriuje" + +#: lazarusidestrconsts:lisshowidentifiers +msgid "Show identifiers" +msgstr "Rodyti identifikatorius" + +#: lazarusidestrconsts:dlgshowlinenumbers +msgid "Show line numbers" +msgstr "Rodyti eilučių numerius" + +#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop +msgid "Show message on stop" +msgstr "Rodyti pranešimą sustabdžius" + +#: lazarusidestrconsts:dlgshownothing +msgid "Show nothing (only errors)" +msgstr "Slėpti viską (išskyrus klaidas)" + +#: lazarusidestrconsts:lisshowoldtaborder +msgid "Show old tab order" +msgstr "Rodyti buvusią vietą tabuliatoriaus eilėje" + +#: lazarusidestrconsts:lisshowpackages +msgid "Show packages" +msgstr "Rodyti paketus" + +#: lazarusidestrconsts:dlgshowscrollhint +msgid "Show scroll hint" +msgstr "Slenkant rodyti informacinį langelį" + +#: lazarusidestrconsts:dlgshowsummary +msgid "Show summary" +msgstr "Rodyti apibendrinimą" + +#: lazarusidestrconsts:dlgshowtriedfiles +msgid "Show tried files" +msgstr "Rodyti apibrėžtas makrokomandas" + +#: lazarusidestrconsts:lisshowunits +msgid "Show units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:dlgshowusedfiles +msgid "Show used files" +msgstr "Rodyti naudojamus failus" + +#: lazarusidestrconsts:lissibling +msgid "Sibling" +msgstr "Kaimynas" + +#: lazarusidestrconsts:lisdebugoptionsfrmsignals +msgid "Signals" +msgstr "Signalai" + +#: lazarusidestrconsts:lissimplesyntax +msgid "Simple Syntax" +msgstr "Paprasta sintaksė" + +#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof +msgid "Simple Syntax (e.g. * instead of .*)" +msgstr "Paprasta sintaksė (pvz.: * vietoje .*)" + +#: lazarusidestrconsts:fdmsizeword +msgid "Size" +msgstr "Dydis" + +#: lazarusidestrconsts:lisuidsize +msgid "Size:" +msgstr "Dydis:" + +#: lazarusidestrconsts:liscoskipcallingcompiler +msgid "Skip calling Compiler" +msgstr "Nešaukti kompiliatoriaus" + +#: lazarusidestrconsts:lisskipfileandcontinueloading +msgid "Skip file and continue loading" +msgstr "Tęsti įkrovą praleidžiant failą" + +#: lazarusidestrconsts:lisskiploadinglastproject +msgid "Skip loading last project" +msgstr "Neįkelti paskutinio naudoto projekto" + +#: lazarusidestrconsts:lispkgmangskipthispackage +msgid "Skip this package" +msgstr "Praleisti šį paketą" + +#: lazarusidestrconsts:dlgcosmaller +msgid "Smaller Code" +msgstr "Mažesnį kodą" + +#: lazarusidestrconsts:dlgcosmartlinkable +msgid "Smart Linkable" +msgstr "Saistoma sumaniai" + +#: lazarusidestrconsts:dlgsmarttabs +msgid "Smart tabs" +msgstr "Gudrus tabuliatorius" + +#: lazarusidestrconsts:dlgsnapguidelines +msgid "Snap to Guide Lines" +msgstr "Pritraukti prie pagalbinių linijų" + +#: lazarusidestrconsts:dlgqsnaptogrid +msgid "Snap to grid" +msgstr "Pritraukti prie tinklelio taškų" #: lazarusidestrconsts:srvk_snapshot msgid "Snapshot" msgstr "Snapshot" -#: lazarusidestrconsts:srvk_insert -msgid "Insert" -msgstr "Insert" +#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk +msgid "Some files have changed on disk:" +msgstr "Kai kurie failai buvo pakeisti iš išorės:" -#: lazarusidestrconsts:srvk_help -msgid "Help" -msgstr "Help" +#: lazarusidestrconsts:lissorrynotimplementedyet +msgid "Sorry, not implemented yet" +msgstr "Deja, dar neįgyvendinta" -#: lazarusidestrconsts:srvk_lwin -msgid "left windows key" -msgstr "kairysis windows klavišas" +#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented +msgid "Sorry, this type is not yet implemented" +msgstr "Deja, šis tipas dar neįgyvendintas" -#: lazarusidestrconsts:srvk_rwin -msgid "right windows key" -msgstr "dešinysis windows klavišas" +#: lazarusidestrconsts:lissortselsortselection +msgid "Sort selection" +msgstr "Rūšiuoti pažymėtą" -#: lazarusidestrconsts:srvk_apps -msgid "application key" -msgstr "programos klavišas" +#: lazarusidestrconsts:lismenusortselection +msgid "Sort selection ..." +msgstr "Rūšiuoti pažymėtą..." -#: lazarusidestrconsts:srvk_numpad -msgid "Numpad %d" -msgstr "Numpad %d" - -#: lazarusidestrconsts:srvk_numlock -msgid "Numlock" -msgstr "Numlock" - -#: lazarusidestrconsts:srvk_scroll -msgid "Scroll" -msgstr "Sroll" - -#: lazarusidestrconsts:srvk_irregular -msgid "Irregular " -msgstr "Nereguliarus" - -#: lazarusidestrconsts:srkm_alt -msgid "Alt" -msgstr "Alt" - -#: lazarusidestrconsts:srkm_ctrl -msgid "Ctrl" -msgstr "Ctrl" - -#: lazarusidestrconsts:srkmcatcursormoving -msgid "Cursor moving commands" -msgstr "Žymeklio perkėlimo komandos" - -#: lazarusidestrconsts:srkmcatselection -msgid "Text selection commands" -msgstr "Teksto žymėjimo komandos" - -#: lazarusidestrconsts:srkmcatediting -msgid "Text editing commands" -msgstr "Teksto keitimo komandos" - -#: lazarusidestrconsts:liskmdeletelastchar -msgid "Delete last char" -msgstr "Pašalinti paskutinį simbolį" - -#: lazarusidestrconsts:srkmcatcmdcmd -msgid "Command commands" -msgstr "Menių \"Komandos\" komandos" - -#: lazarusidestrconsts:srkmcatsearchreplace -msgid "Text search and replace commands" -msgstr "Teksto ieškos ir pakeitimo komandos" - -#: lazarusidestrconsts:srkmcatmarker -msgid "Text marker commands" -msgstr "Teksto žymeklio komandos" - -#: lazarusidestrconsts:liskmsetfreebookmark -msgid "Set free Bookmark" -msgstr "Padėti laisvą žymę" - -#: lazarusidestrconsts:srkmcatcodetools -msgid "CodeTools commands" -msgstr "CodeTools komandos" +#: lazarusidestrconsts:lismenuviewsourceeditor +msgid "Source Editor" +msgstr "Pirminio kodo redaktorius" #: lazarusidestrconsts:srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "Pirminio kodo redaktoriaus komandos" -#: lazarusidestrconsts:srkmcatfilemenu -msgid "File menu commands" -msgstr "Meniu \"Failas\" komandos" +#: lazarusidestrconsts:lissourceanddestinationarethesame +msgid "Source and Destination are the same:%s%s" +msgstr "Šaltinis ir tikslas sutampa:%s%s" -#: lazarusidestrconsts:liskmgotosourceeditor10 -msgid "Go to source editor 10" -msgstr "Rodyti pirminio kodo redaktoriaus 10 kortelę" +#: lazarusidestrconsts:lismenuaddbpsource +msgid "Source breakpoint" +msgstr "Stabdos taškas pirminiame kode" -#: lazarusidestrconsts:srkmcatviewmenu -msgid "View menu commands" -msgstr "Meniu \"Rodymas\" komandos" +#: lazarusidestrconsts:lissourcedirectorydoesnotexist +msgid "Source directory %s%s%s does not exist." +msgstr "Pirminio kodo katalogas %s%s%s neegzistuoja." -#: lazarusidestrconsts:liskmtoggleviewobjectinspector -msgid "Toggle view Object Inspector" -msgstr "Keisti \"Objektų inspektorius\" matomumą" +#: lazarusidestrconsts:lissourcemodified +msgid "Source modified" +msgstr "Pirminis kodas pakeistas" -#: lazarusidestrconsts:liskmtoggleviewsourceeditor -msgid "Toggle view Source Editor" -msgstr "Keisti \"Pirminio kodo redaktorius\" matomumą" +#: lazarusidestrconsts:lissourceofpagehaschangedsave +msgid "Source of page %s%s%s has changed. Save?" +msgstr "Pirminis kodas lape %s%s%s pakeistas. Išsaugoti?" -#: lazarusidestrconsts:liskmtoggleviewcodeexplorer -msgid "Toggle view Code Explorer" -msgstr "Keisti \"Kodo tyrinėtojas\" matomumą" +#: lazarusidestrconsts:lissourcepaths +msgid "Source paths" +msgstr "Keliai iki pirminio kodo" -#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor -msgid "Toggle view Documentation Editor" -msgstr "Keisti \"Dokumentacijos redaktorius\" matomumą" +#: lazarusidestrconsts:lismakeresstrsourcepreview +msgid "Source preview" +msgstr "Pirminio kodo peržiūra" -#: lazarusidestrconsts:liskmtoggleviewmessages -msgid "Toggle view Messages" -msgstr "Keisti \"Pranešimai\" matomumą" +#: lazarusidestrconsts:dlgspacenotcosmos +msgid "Space" +msgstr "Tarpo simbolis" -#: lazarusidestrconsts:liskmtoggleviewsearchresults -msgid "Toggle view Search Results" -msgstr "Keisti \"Ieškos rezultatai\" matomumą" +#: lazarusidestrconsts:lisspaceequally +msgid "Space equally" +msgstr "Vienodais tarpais tarp elementu" -#: lazarusidestrconsts:liskmtoggleviewwatches -msgid "Toggle view Watches" -msgstr "Keisti \"Stebimieji\" matomumą" - -#: lazarusidestrconsts:liskmtoggleviewbreakpoints -msgid "Toggle view Breakpoints" -msgstr "Keisti \"Stabdos taškai\" matomumą" - -#: lazarusidestrconsts:liskmtoggleviewlocalvariables -msgid "Toggle view Local Variables" -msgstr "Keisti \"Vietiniai kintamieji\" matomumą" - -#: lazarusidestrconsts:liskmtoggleviewcallstack -msgid "Toggle view Call Stack" -msgstr "Keisti \"Kreipčių dėklas\" matomumą" - -#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput -msgid "Toggle view Debugger Output" -msgstr "Keisti \"Derintuvės išvestis\" matomumą" - -#: lazarusidestrconsts:srkmcatprojectmenu -msgid "Project menu commands" -msgstr "Menių \"Projektas\" komandos" - -#: lazarusidestrconsts:liskmnewproject -msgid "New project" -msgstr "Naujas projektas" - -#: lazarusidestrconsts:liskmnewprojectfromfile -msgid "New project from file" -msgstr "Naujas projektas iš failo" - -#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons -msgid "Toggle view IDE speed buttons" -msgstr "Keisti IKA sparčiųjų mygtukų matomumą" - -#: lazarusidestrconsts:srkmcatrunmenu -msgid "Run menu commands" -msgstr "Meniu \"Startuoti\" komandos" - -#: lazarusidestrconsts:liskmbuildprojectprogram -msgid "Build project/program" -msgstr "Daryti projektą/programą" - -#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram -msgid "Build all files of project/program" -msgstr "Daryti visus projekto/programos failus" - -#: lazarusidestrconsts:liskmquickcompilenolinking -msgid "Quick compile, no linking" -msgstr "Kompiliuoti greitai, nesaistyti" - -#: lazarusidestrconsts:liskmabortbuilding -msgid "Abort building" -msgstr "Nutraukti darymą" - -#: lazarusidestrconsts:liskmrunprogram -msgid "Run program" -msgstr "Startuoti programą" - -#: lazarusidestrconsts:liskmpauseprogram -msgid "Pause program" -msgstr "Pristabdyti veiką" - -#: lazarusidestrconsts:liskmviewprojectoptions -msgid "View project options" -msgstr "Rodyti projekto parinktis" - -#: lazarusidestrconsts:srkmcatcomponentsmenu -msgid "Components menu commands" -msgstr "Maniu \"Komponentės\" komandos" - -#: lazarusidestrconsts:srkmcattoolmenu -msgid "Tools menu commands" -msgstr "Meniu \"Įrankiai\" komandos" - -#: lazarusidestrconsts:liskmexternaltoolssettings -msgid "External Tools settings" -msgstr "Išorinių įrankių nuostatos" - -#: lazarusidestrconsts:srkmcatenvmenu -msgid "Environment menu commands" -msgstr "Meniu \"Aplinka\" komandos" - -#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage -msgid "Convert Delphi package to Lazarus package" -msgstr "Delphi paketą konvertuoti į Lazarus paketą" - -#: lazarusidestrconsts:srkmcarhelpmenu -msgid "Help menu commands" -msgstr "Meniu \"Žinynas\" komandos" - -#: lazarusidestrconsts:liskeycatdesigner -msgid "Designer commands" -msgstr "Konstruktoriaus komandos" - -#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard -msgid "Copy selected Components to clipboard" -msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" - -#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard -msgid "Cut selected Components to clipboard" -msgstr "Iškirpti pažymėtas komponentes į iškarpinę" - -#: lazarusidestrconsts:liskmpastecomponentsfromclipboard -msgid "Paste Components from clipboard" -msgstr "Įdėti komponentę iš iškarpinės" - -#: lazarusidestrconsts:liskeycatobjinspector -msgid "Object Inspector commands" -msgstr "Objetų inspektoriaus komandos" - -#: lazarusidestrconsts:liskeycatcustom -msgid "Custom commands" -msgstr "Kitos komandos" - -#: lazarusidestrconsts:rslanguageautomatic -msgid "Automatic (or english)" -msgstr "Automatiškai (arba anglų)" - -#: lazarusidestrconsts:rslanguageenglish -msgid "English" -msgstr "Anglų" - -#: lazarusidestrconsts:rslanguagegerman -msgid "German" -msgstr "Vokiečių" +#: lazarusidestrconsts:srvk_space +msgid "Space key" +msgstr "Space klavišas" #: lazarusidestrconsts:rslanguagespanish msgid "Spanish" msgstr "Ispanų" -#: lazarusidestrconsts:rslanguagefrench -msgid "French" -msgstr "Prancūzų" +#: lazarusidestrconsts:lisuidsrc +msgid "Src" +msgstr "pirm.kod." -#: lazarusidestrconsts:rslanguagerussian -msgid "Russian" -msgstr "Rusų" +#: lazarusidestrconsts:dlgcostack +msgid "Stack" +msgstr "Dėklą" -#: lazarusidestrconsts:rslanguagepolish -msgid "Polish" -msgstr "Lenkų" +#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu +msgid "Standard Edit Menu" +msgstr "Standartinis redaktoriaus meniu" -#: lazarusidestrconsts:rslanguagepolishiso -msgid "Polish(ISO 8859-2)" -msgstr "Lenkų(ISO 8859-2)" +#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu +msgid "Standard File Menu" +msgstr "Standartinis failo meniu" -#: lazarusidestrconsts:rslanguagepolishwin -msgid "Polish(CP1250)" -msgstr "Lenkų(CP1250)" +#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu +msgid "Standard Help Menu" +msgstr "Standartinis žinyno meniu" -#: lazarusidestrconsts:rslanguageitalian -msgid "Italian" -msgstr "Italų" - -#: lazarusidestrconsts:rslanguagecatalan -msgid "Catalan" -msgstr "Katalanų" - -#: lazarusidestrconsts:rslanguagefinnish -msgid "Finnish" -msgstr "Suomių" - -#: lazarusidestrconsts:rslanguagehebrew -msgid "Hebrew" -msgstr "Žydų" - -#: lazarusidestrconsts:rslanguagearabic -msgid "Arabic" -msgstr "Arabų" - -#: lazarusidestrconsts:rslanguageportugues -msgid "Portuguese" -msgstr "Portugalų" - -#: lazarusidestrconsts:rslanguageukrainian -msgid "Ukrainian" -msgstr "Ukrainiečių" - -#: lazarusidestrconsts:rslanguagedutch -msgid "Dutch" -msgstr "Olandų" - -#: lazarusidestrconsts:rslanguagejapanese -msgid "Japanese" -msgstr "Japonų" - -#: lazarusidestrconsts:rslanguagechinese -msgid "Chinese" -msgstr "Kiniečių" - -#: lazarusidestrconsts:rslanguageindonesian -msgid "Indonesian" -msgstr "Indoneziečių" - -#: lazarusidestrconsts:rslanguageafrikaans -msgid "Afrikaans" -msgstr "Afrikiečių" - -#: lazarusidestrconsts:rslanguagelithuanian -msgid "Lithuanian" -msgstr "Lietuvių" - -#: lazarusidestrconsts:dlgunitdepcaption -msgid "Unit dependencies" -msgstr "Modulio priklausomybės" - -#: lazarusidestrconsts:dlgunitdepbrowse -msgid "Open" -msgstr "Atverti" - -#: lazarusidestrconsts:dlgunitdeprefresh -msgid "Refresh" -msgstr "Atnaujinti" - -#: lazarusidestrconsts:listodogoto -msgid "Goto" -msgstr "Rodyk kur" - -#: lazarusidestrconsts:lisdocumentationeditor -msgid "Documentation Editor" -msgstr "Dokumentacijos redaktorius" - -#: lazarusidestrconsts:lisconfirmlazarusrebuild -msgid "Do you want to rebuild Lazarus?" -msgstr "Daryti Lazarus išnaujo?" - -#: lazarusidestrconsts:liscleanlazarussource -msgid "Clean Lazarus Source" -msgstr "Apvalyti Lazarus katalogus" - -#: lazarusidestrconsts:lismakenotfound -msgid "Make not found" -msgstr "Nerastas Make" - -#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla -msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" -msgstr "Nerasta programa %ssmake%s.%sŠi programa reikalinga Lazarus darymui.%s" - -#: lazarusidestrconsts:liscompileidewithoutlinking -msgid "Compile IDE (without linking)" -msgstr "Kompiliuoti IKA (nesaistant)" - -#: lazarusidestrconsts:lislcl -msgid "LCL" -msgstr "LCL" - -#: lazarusidestrconsts:liscomponent -msgid "Component" -msgstr "Komponentė" - -#: lazarusidestrconsts:liscodetools -msgid "CodeTools" -msgstr "CodeTools" - -#: lazarusidestrconsts:lissynedit -msgid "SynEdit" -msgstr "SynEdit" - -#: lazarusidestrconsts:lisideintf -msgid "IDE Interface" -msgstr "IKA interfeisas" - -#: lazarusidestrconsts:lisjitform -msgid "JIT Form" -msgstr "JITForm" - -#: lazarusidestrconsts:lispkgreg -msgid "Package Registration" -msgstr "Paketo registracija" - -#: lazarusidestrconsts:liside -msgid "IDE" -msgstr "IKA" +#: lazarusidestrconsts:lisstartwithanewproject +msgid "Start with a new project" +msgstr "Startuti su nauju projektu" #: lazarusidestrconsts:lisstarter msgid "Starter" msgstr "Paleidimo programa" -#: lazarusidestrconsts:lisexamples -msgid "Examples" -msgstr "Pavyzdžiai" +#: lazarusidestrconsts:lisoipstate +msgid "State" +msgstr "Būsena" -#: lazarusidestrconsts:lisconfigurebuildlazarus -msgid "Configure %sBuild Lazarus%s" -msgstr "Derinti %sDaryti Lazarus%s" +#: lazarusidestrconsts:dlgstatickeyword +msgid "Static Keyword in Objects" +msgstr "Objektuose statiniai raktažodžiai" -#: lazarusidestrconsts:lislazbuildcleanall -msgid "Clean all" -msgstr "Visiškas apvalymas" +#: lazarusidestrconsts:lishintstepinto +msgid "Step Into" +msgstr "Žengti gilyn" -#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools -msgid "Build Components (SynEdit, CodeTools)" -msgstr "Daryti komponentes (SynEdit, CodeTools)" +#: lazarusidestrconsts:lishintstepover +msgid "Step Over" +msgstr "Žengti virš" -#: lazarusidestrconsts:lislazbuildbuildsynedit -msgid "Build SynEdit" -msgstr "Daryti SynEdit" +#: lazarusidestrconsts:lismenustepinto +msgid "Step into" +msgstr "Žengti gilyn" -#: lazarusidestrconsts:lislazbuildbuildcodetools -msgid "Build CodeTools" -msgstr "Daryti CodeTools" +#: lazarusidestrconsts:lismenustepover +msgid "Step over" +msgstr "Žengti virš" -#: lazarusidestrconsts:lislazbuildbuildide -msgid "Build IDE" -msgstr "Daryti IKA" +#: lazarusidestrconsts:lismenustop +msgid "Stop" +msgstr "Stabdyti" -#: lazarusidestrconsts:lislazbuildbuildexamples -msgid "Build Examples" -msgstr "Daryti pavyzdžius" +#: lazarusidestrconsts:lisstopdebugging +msgid "Stop Debugging?" +msgstr "Nutraukti derinimą?" -#: lazarusidestrconsts:lislazbuildoptions -msgid "Options:" -msgstr "Parinktys:" +#: lazarusidestrconsts:dlgstopafternrerr +msgid "Stop after number of errors:" +msgstr "Po kelių klaidų sustoti:" -#: lazarusidestrconsts:lislazbuildtargetos -msgid "Target OS:" -msgstr "Paskirties OS:" +#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject +msgid "Stop current debugging and rebuild project?" +msgstr "Sustabdyti šiuo metu vykdomą programos derinimą ir daryti projektą išnaujo?" + +#: lazarusidestrconsts:lisstopdebugging2 +msgid "Stop debugging?" +msgstr "Sustabdyti derinimą?" + +#: lazarusidestrconsts:liskmstopprogram +msgid "Stop program" +msgstr "Sustabdyti programą" + +#: lazarusidestrconsts:lisstopthedebugging +msgid "Stop the debugging?" +msgstr "Nutraukti derinimą?" + +#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename +msgid "Store dependency filename" +msgstr "Talpinti priklausomo failo vardą" + +#: lazarusidestrconsts:dlgcdtstoredpostfix +msgid "Stored postfix" +msgstr "\"Stored\" postfiksas" + +#: lazarusidestrconsts:lisstreamingerror +msgid "Streaming error" +msgstr "Klaida siunčiant srautu" + +#: lazarusidestrconsts:liscodetoolsoptsstringconst +msgid "String constant" +msgstr "Eilutės konstanta" + +#: lazarusidestrconsts:lismakeresstrstringconstantinsource +msgid "String constant in source" +msgstr "Teksto konstanta pirminiame kode" + +#: lazarusidestrconsts:lismakeresstrstringswithsamevalue +msgid "Strings with same value:" +msgstr "Eilutės su tokia pat reikšme:" + +#: lazarusidestrconsts:dlgcostrip +msgid "Strip Symbols From Executable" +msgstr "Pašalinti simbolius iš vykdomojo failo" + +#: lazarusidestrconsts:dlgcostyle +msgid "Style:" +msgstr "Stilius:" + +#: lazarusidestrconsts:lissubprocedure +msgid "Sub Procedure" +msgstr "Vidinė procedūra" + +#: lazarusidestrconsts:lissubprocedureonsamelevel +msgid "Sub Procedure on same level" +msgstr "Vidinė procedūra tame pačiame lygyje" + +#: lazarusidestrconsts:dlgedbsubdir +msgid "Sub directory" +msgstr "Pakatalogis" + +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "Posavybės" + +#: lazarusidestrconsts:lissuccess +msgid "Success" +msgstr "Tvarka" + +#: lazarusidestrconsts:lisa2pswitchpaths +msgid "Switch Paths" +msgstr "Kitoks kelias" + +#: lazarusidestrconsts:srkmectoggleformunit +msgid "Switch between form and unit" +msgstr "Persijungti tarp formos ir modulio" + +#: lazarusidestrconsts:liscodetoolsoptssymbol +msgid "Symbol" +msgstr "Simbolis" + +#: lazarusidestrconsts:dlgsmbbehind +msgid "Symbol behind (.pp~)" +msgstr "Simbolis gale (.pp~)" + +#: lazarusidestrconsts:dlgsmbfront +msgid "Symbol in front (.~pp)" +msgstr "Simbolis priekyje (.~pp)" + +#: lazarusidestrconsts:lissynedit +msgid "SynEdit" +msgstr "SynEdit" + +#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus +msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" +msgstr "" +"SynEdit - Lazarus naudojama redagavimo komponentė.\n" +"http://sourceforge.net/projects/synedit/" + +#: lazarusidestrconsts:srkmecsyntaxcheck +msgid "Syntax check" +msgstr "Sintaksės patikra" + +#: lazarusidestrconsts:dlgsyntaxoptions +msgid "Syntax options" +msgstr "Sintaksės parinktys" + +#: lazarusidestrconsts:dlgrunosystemvariables +msgid "System variables" +msgstr "Sistemos kintamieji" + +#: lazarusidestrconsts:dlgbp7cptb +msgid "TP/BP 7.0 Compatible" +msgstr "Suderinamumas su TP/BP 7.0" + +#: lazarusidestrconsts:srvk_tab +msgid "Tab" +msgstr "Tab" + +#: lazarusidestrconsts:listaborderof +msgid "Tab Order of" +msgstr "Vieta tabuliatoriaus eilėje" + +#: lazarusidestrconsts:dlgtabindent +msgid "Tab indents blocks" +msgstr "Tabuliatorius įtraukia blokus" + +#: lazarusidestrconsts:fdmtaborder +msgid "Tab order..." +msgstr "Tabuliatoriaus eilė..." + +#: lazarusidestrconsts:liseotabwidths +msgid "Tab widths" +msgstr "Tabuliatoriaus plotis" + +#: lazarusidestrconsts:dlgtabstospaces +msgid "Tabs to spaces" +msgstr "Vietoj tabuliatoriaus - tarpo simboliai" + +#: lazarusidestrconsts:lismenutabstospacesselection +msgid "Tabs to spaces in selection" +msgstr "Pažymėtoje srityje tabuliatorius keisti tarpais" + +#: lazarusidestrconsts:listargetcpu +msgid "Target CPU" +msgstr "Paskirties procesorius" #: lazarusidestrconsts:lislazbuildtargetcpu msgid "Target CPU:" @@ -6107,1277 +7765,549 @@ msgstr "Paskirties procesorius:" msgid "Target Directory:" msgstr "Paskirties katalogas:" -#: lazarusidestrconsts:lislazbuildlclinterface -msgid "LCL interface" -msgstr "LCL interfeisas" +#: lazarusidestrconsts:listargetos +msgid "Target OS" +msgstr "Paskirties OS" -#: lazarusidestrconsts:lislazbuildbuildjitform -msgid "Build JITForm" -msgstr "Daryti JITForm" +#: lazarusidestrconsts:liscotargetosspecificoptions +msgid "Target OS specific options" +msgstr "Paskirties OS specifinės parinktys" -#: lazarusidestrconsts:lislazbuildwithstaticpackages -msgid "With Packages" -msgstr "Su paketais" +#: lazarusidestrconsts:lislazbuildtargetos +msgid "Target OS:" +msgstr "Paskirties OS:" -#: lazarusidestrconsts:lislazbuildrestartafterbuild -msgid "Restart After Successfull Build" -msgstr "Padarius sėkmingai startuoti išnaujo" +#: lazarusidestrconsts:dlgtargetplatform +msgid "Target Platform:" +msgstr "Paskirties platforma:" -#: lazarusidestrconsts:lislazbuildconfirmbuild -msgid "Confirm Before ReBuild Lazarus" -msgstr "Klausti sutikimo prieš darant Lazarus" +#: lazarusidestrconsts:dlgpotargetfilename +msgid "Target file name:" +msgstr "Būsimo failo vardas:" -#: lazarusidestrconsts:lislazbuildok -msgid "Ok" -msgstr "Tinka" +#: lazarusidestrconsts:listargetfilenameplusparams +msgid "Target filename + params" +msgstr "Būsimo failo vardas + parametrai" + +#: lazarusidestrconsts:listargetfilenameofproject +msgid "Target filename of project" +msgstr "Projekto būsimo failo vardas" + +#: lazarusidestrconsts:dlgtargetproc +msgid "Target i386" +msgstr "Paskirtis i386" + +#: lazarusidestrconsts:lismenueditortemplatepreview +msgid "Template Preview" +msgstr "Šablono peržiūra" + +#: lazarusidestrconsts:dlgtplfname +msgid "Template file name" +msgstr "Šablono failo vardas" #: lazarusidestrconsts:lisctdtemplates msgid "Templates" msgstr "Šablonai" -#: lazarusidestrconsts:lissavesettings -msgid "Save Settings" -msgstr "Išsaugoti nuostatas" +#: lazarusidestrconsts:liscomptest +msgid "Test" +msgstr "Testas" -#: lazarusidestrconsts:lislazbuildcancel -msgid "Cancel" -msgstr "Atsisakyti" +#: lazarusidestrconsts:listestdirectory +msgid "Test directory" +msgstr "Testo katalogas" -#: lazarusidestrconsts:lislazbuildnone -msgid "None" -msgstr "Nieko" - -#: lazarusidestrconsts:lislazbuildbuild -msgid "Build" -msgstr "Daryti" - -#: lazarusidestrconsts:lislazbuildcleanbuild -msgid "Clean+Build" -msgstr "Apvalyti ir daryti" - -#: lazarusidestrconsts:liscompilererrorinvalidcompiler -msgid "Error: invalid compiler: %s" -msgstr "Klaida: klaidingas kompiliatorius: %s" - -#: lazarusidestrconsts:listcompilerinternalerror -msgid "Internal compiler error! (%d)" -msgstr "Vidinė kompiliatoriaus klaida! (%d)" - -#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath -msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "Užuomina: kompiliatoriaus programą galite nurodyti \"Aplinka -> Aplinkos parinktys -> Failai -> Kompiliatoriaus programa\"." - -#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile -msgid "NOTE: loading old codetools options file: " -msgstr "Pastaba: įkeliami senasis CodeTools parinkčių failas:" - -#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults -msgid "NOTE: codetools config file not found - using defaults" -msgstr "Pastaba: nerastas CodeTools nustatymų failas - naudojami numatytieji nustatymai." - -#: lazarusidestrconsts:liscodetoolsoptsok -msgid "Ok" -msgstr "Tinka" - -#: lazarusidestrconsts:liscodetoolsoptsnone -msgid "None" -msgstr "Niekas" - -#: lazarusidestrconsts:liscodetoolsoptskeyword -msgid "Keyword" -msgstr "Raktažodis" - -#: lazarusidestrconsts:liscodetoolsoptsidentifier -msgid "Identifier" -msgstr "Identifikatorius" - -#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp -msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "Ieškoti ir kituose failuose (pvz.: /path/*.pas;/path2/*.pp)" - -#: lazarusidestrconsts:lisfrifindreferences -msgid "Find References" -msgstr "Ieškoti įrašų" - -#: lazarusidestrconsts:lisfriinvalididentifier -msgid "Invalid Identifier" -msgstr "Klaidingas identifikatorius" - -#: lazarusidestrconsts:lisfrirenameto -msgid "Rename to" -msgstr "Pervardyti į" - -#: lazarusidestrconsts:lisfrirename -msgid "Rename" -msgstr "Pervardyti" - -#: lazarusidestrconsts:lisfrisearchincommentstoo -msgid "Search in comments too" -msgstr "Taip pat ir komentaruose" - -#: lazarusidestrconsts:lisfrisearchwhere -msgid "Search where" -msgstr "Kur ieškoti" - -#: lazarusidestrconsts:liscodetoolsoptscolon -msgid "Colon" -msgstr "Dvitaškis" - -#: lazarusidestrconsts:liscodetoolsoptssemicolon -msgid "Semicolon" -msgstr "Kabliataškis" - -#: lazarusidestrconsts:liscodetoolsoptscomma -msgid "Comma" -msgstr "Kablelis" - -#: lazarusidestrconsts:liscodetoolsoptspoint -msgid "Point" -msgstr "Taškas" - -#: lazarusidestrconsts:liscodetoolsoptsat -msgid "At" -msgstr "Simbolis eta" - -#: lazarusidestrconsts:liscodetoolsoptsnumber -msgid "Number" -msgstr "Skaičius" - -#: lazarusidestrconsts:liscodetoolsoptsstringconst -msgid "String constant" -msgstr "Eilutės konstanta" - -#: lazarusidestrconsts:liscodetoolsoptsnewline -msgid "Newline" -msgstr "Nauja eilutė" - -#: lazarusidestrconsts:liscodetoolsoptsspace -msgid "Space" -msgstr "Tarpo simbolis" - -#: lazarusidestrconsts:liscodetoolsoptssymbol -msgid "Symbol" -msgstr "Simbolis" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview -msgid "CodeTools Defines Preview" -msgstr "CodeTools apibrėžčių peržiūra" - -#: lazarusidestrconsts:liscodetoolsdefswriteerror -msgid "Write error" -msgstr "Klaida rašant" - -#: lazarusidestrconsts:lisstopdebugging2 -msgid "Stop debugging?" -msgstr "Sustabdyti derinimą?" - -#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject -msgid "Stop current debugging and rebuild project?" -msgstr "Sustabdyti šiuo metu vykdomą programos derinimą ir daryti projektą išnaujo?" - -#: lazarusidestrconsts:liserrorwritingpackagelisttofile -msgid "Error writing package list to file%s%s%s%s" -msgstr "Įvyko klaida rašant paketo sąrašą į failą%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting -msgid "Error while writing %s%s%s%s%s" -msgstr "Įvyko klaida rašant %s%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile -msgid "Error while writing project info file %s%s%s%s%s" -msgstr "Įvyko klaida rašant į informacijos apie projektą failą %s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefsreaderror -msgid "Read error" -msgstr "Klaida įkeliant" - -#: lazarusidestrconsts:liserrorreadingpackagelistfromfile -msgid "Error reading package list from file%s%s%s%s" -msgstr "Įvyko klaida įkeliant paketų sąrašą iš failo%s%s%s%s" - -#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits -msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "Dabartinis failo%s%s%s%s modulio kelias yra%s%s%s%s.%s%sTrūksta įrašo apie kelią iki LCL modulių %s%s%s.%s%sUžuomina naujokams:%ssukurkite Lazarus programą ir patalpinkite failą projekto kataloge." - -#: lazarusidestrconsts:lislclunitpathmissing -msgid "LCL unit path missing" -msgstr "Trūksta įrašo apie kelią iki LCL modulio" - -#: lazarusidestrconsts:lisnotadelphiunit -msgid "Not a Delphi unit" -msgstr "Ne Delhi modulis" - -#: lazarusidestrconsts:listhefileisnotadelphiunit -msgid "The file %s%s%s is not a Delphi unit." -msgstr "Failas %s%s%s nėra Delhi modulis." - -#: lazarusidestrconsts:liscodetoolsdefserrorreading -msgid "Error reading %s%s%s%s%s" -msgstr "Įvyko klaida įkeliant %s%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile -msgid "Error reading project info file %s%s%s%s%s" -msgstr "Įvyko klaida įkeliant informacijos apie projektą failą %s%s%s%s%s" - -#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly -msgid "Node is readonly" -msgstr "Mazgas tik skaitymui" - -#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited -msgid "Auto generated nodes can not be edited." -msgstr "Negalima keisti automatiškai sukurtų mazgų." - -#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode -msgid "Invalid previous node" -msgstr "Klaidingas ankstesnis mazgas" - -#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes -msgid "Previous node can not contain child nodes." -msgstr "Ankstesnis mazgas negali turėti mazgų-vaikų." - -#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory -msgid "Create FPC Macros and paths for a fpc project directory" -msgstr "Sukurti FPC makrokomandas ir kelius FPC projekto katalogui" - -#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory -msgid "Project directory" -msgstr "Projekto katalogas" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory -msgid "The Free Pascal project directory." -msgstr "FreePascal projekto katalogas." - -#: lazarusidestrconsts:liscodetoolsdefscompilerpath -msgid "compiler path" -msgstr "Kompiliatoriaus programa" - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject -msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." -msgstr "Šio projekto FreePascal kompiliatoriaus programa su keliu iki jos. Būtina įrašyti jei žemiau nurodysit FPC SVN pirminio kodo katalogą. Šis įrasa naudojamas automatiškai kuriant makrokomandas." - -#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory -msgid "FPC SVN source directory" -msgstr "FPC SVN pirminio kodo katalogas" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory -msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." -msgstr "FreePascal SVN pirminio teksto katalogas. Nebūtina, tačiau nurodžius tai pagerins paskelbimo kode paiešką bei programos derinimą." - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler -msgid "Create Defines for Free Pascal Compiler" -msgstr "Sukurti apibrėžtis FreePascal kompiliatoriui" - -#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample -msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." -msgstr "FreePascal kompiliatoriaus programa su keliu iki jos.%sPavyzdžiui: %s/usr/bin/%s -n%s arba %s/usr/local/bin/fpc @/etc/fpc.cfg%s." - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources -msgid "Create Defines for Free Pascal SVN Sources" -msgstr "Sukurti apibrėžtis FreePascal SVN pirminiam kodui" - -#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir -msgid "The Free Pascal SVN source directory." -msgstr "FreePascal SVN pirminio kodo katalogas." - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir -msgid "Create Defines for Lazarus Directory" -msgstr "Sukurti apibr4=tis Lazarus katalogui" - -#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory -msgid "Lazarus Directory" -msgstr "Lazarus katalogas" - -#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory -msgid "The Lazarus main directory." -msgstr "Lazarus pagrindinis katalogas." - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory -msgid "Create Defines for %s Directory" -msgstr "Sukurti apibrėžtis %s katalogui" - -#: lazarusidestrconsts:liscodetoolsdefsdirectory -msgid "%s directory" -msgstr "%s katalogas" - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc -msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" -msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject -msgid "Create Defines for %s Project" -msgstr "Sukurti apibrėžtis projektui %s" - -#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 -msgid "%s project directory" -msgstr "%s projekto katalogas" - -#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory -msgid "The %s project directory,%swhich contains the .dpr, dpk file." -msgstr "%s projekto katalogas, kuriame yra .dpr ir .dpk failai." - -#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" -msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" - -#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject -msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" -msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: /home/user/kylix%s" - -#: lazarusidestrconsts:liscodetoolsdefsexit -msgid "Exit" -msgstr "Išeiti" - -#: lazarusidestrconsts:liscodetoolsdefssaveandexit -msgid "Save and Exit" -msgstr "Išsaugoti ir išeiti" - -#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave -msgid "Exit without Save" -msgstr "Išeiti neišsaugojus" - -#: lazarusidestrconsts:liscodetoolsdefsedit -msgid "Edit" -msgstr "Keisti" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeup -msgid "Move node up" -msgstr "Perkelti mazgą aukštyn" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodedown -msgid "Move node down" -msgstr "Perkelti mazgą žemyn" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup -msgid "Move node one level up" -msgstr "Mazgą perkelti vienu lygiu aukščiau" - -#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown -msgid "Move node one level down" -msgstr "Mazgą perkelti vienu lygiu žemiau" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow -msgid "Insert node below" -msgstr "Įterpti mazgą žemiau" - -#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild -msgid "Insert node as child" -msgstr "Įterpti mazgą kaip vaiką" - -#: lazarusidestrconsts:liscodetoolsdefsdeletenode -msgid "Delete node" -msgstr "Pašalinti mazgą" - -#: lazarusidestrconsts:liscodetoolsdefsconvertnode -msgid "Convert node" -msgstr "Konvertuoti mazgą" - -#: lazarusidestrconsts:liscodetoolsdefsdefine -msgid "Define" -msgstr "Apibrėžti" - -#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse -msgid "Define Recurse" -msgstr "Rekursyviai apibrėžti" - -#: lazarusidestrconsts:liscodetoolsdefsundefine -msgid "Undefine" -msgstr "Padaryti neapibrėžtu" - -#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse -msgid "Undefine Recurse" -msgstr "Rekursyviai padaryti neapibrėžtu" - -#: lazarusidestrconsts:liscodetoolsdefsundefineall -msgid "Undefine All" -msgstr "Visus padaryti neapibrėžtais" - -#: lazarusidestrconsts:liscodetoolsdefsblock -msgid "Block" -msgstr "Blokas" - -#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory -msgid "Directory" -msgstr "Katalogas" - -#: lazarusidestrconsts:liscodetoolsdefsif -msgid "If" -msgstr "If" - -#: lazarusidestrconsts:liscodetoolsdefsifdef -msgid "IfDef" -msgstr "IfDef" - -#: lazarusidestrconsts:liscodetoolsdefsifndef -msgid "IfNDef" -msgstr "IfNDef" - -#: lazarusidestrconsts:liscodetoolsdefselseif -msgid "ElseIf" -msgstr "ElseIf" - -#: lazarusidestrconsts:liscodetoolsdefselse -msgid "Else" -msgstr "Else" - -#: lazarusidestrconsts:lisctdefstools -msgid "Tools" -msgstr "Įrankiai" - -#: lazarusidestrconsts:lisctdefsopenpreview -msgid "Open Preview" -msgstr "Atverti peržiūros langą" - -#: lazarusidestrconsts:liscodetoolsdefsinserttemplate -msgid "Insert Template" -msgstr "Įterpti šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte -msgid "Insert Free Pascal Project Template" -msgstr "Įterpti FreePascal projekto šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert -msgid "Insert Free Pascal Compiler Template" -msgstr "Įterpti FreePascal kompiliatoriaus šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource -msgid "Insert Free Pascal SVN Source Template" -msgstr "Įterpti FreePascal SVN pirminio kodo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem -msgid "Insert Lazarus Directory Template" -msgstr "Įterpti Lazarus katalogo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp -msgid "Insert Delphi 5 Compiler Template" -msgstr "Įterpti Delphi 5 kompiliatoriaus šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem -msgid "Insert Delphi 5 Directory Template" -msgstr "Įterpti Delphi 5 katalogo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl -msgid "Insert Delphi 5 Project Template" -msgstr "Įterpti Delphi 5 projekto šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp -msgid "Insert Delphi 6 Compiler Template" -msgstr "Įterpti Delphi 6 kompiliatoriaus šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem -msgid "Insert Delphi 6 Directory Template" -msgstr "Įterpti Delphi 6 katalogo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl -msgid "Insert Delphi 6 Project Template" -msgstr "Įterpti Delphi 6 projekto šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp -msgid "Insert Delphi 7 Compiler Template" -msgstr "Įterpti Delphi 7 kompiliatoriaus šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem -msgid "Insert Delphi 7 Directory Template" -msgstr "Įterpti Delphi 7 katalogo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl -msgid "Insert Delphi 7 Project Template" -msgstr "Įterpti Delphi 7 projekto šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp -msgid "Insert Kylix 3 Compiler Template" -msgstr "Įterpti Kylix 3 kompiliatoriaus šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem -msgid "Insert Kylix 3 Directory Template" -msgstr "Įterpti Kylix 3 katalogo šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl -msgid "Insert Kylix 3 Project Template" -msgstr "Įterpti Kylix 3 projekto šabloną" - -#: lazarusidestrconsts:liscodetoolsdefsselectednode -msgid "Selected Node:" -msgstr "Pažymėtas mazgas:" - -#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly -msgid "Node and its children are only valid for this project" -msgstr "Mazgas ir jo vaikai galioja tik šiam projektui" - -#: lazarusidestrconsts:liscodetoolsdefsname -msgid "Name:" -msgstr "Vardas:" - -#: lazarusidestrconsts:liscodetoolsdefsdescription -msgid "Description:" -msgstr "Aprašymas:" - -#: lazarusidestrconsts:liscodetoolsdefsvariable -msgid "Variable:" -msgstr "Kintamasis:" - -#: lazarusidestrconsts:liscodetoolsdefsvalueastext -msgid "Value as Text" -msgstr "Reikšmė teksto pavidalu" - -#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths -msgid "Value as File Paths" -msgstr "Reikšmė failų kelių pavidalu" - -#: lazarusidestrconsts:liscodetoolsdefsaction -msgid "Action: %s" -msgstr "Veiksmas: %s" - -#: lazarusidestrconsts:liscodetoolsdefsautogenerated -msgid "%s, auto generated" -msgstr "%s, sukurtas automatiškai" - -#: lazarusidestrconsts:liscodetoolsdefsprojectspecific -msgid "%s, project specific" -msgstr "%s, priklauso nuo projekto" - -#: lazarusidestrconsts:liscodetoolsdefsnoneselected -msgid "none selected" -msgstr "nėra pažymėtų elementų" - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparent -msgid "Invalid parent" -msgstr "Klaidingas tėvas" - -#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen -msgid "A %s can not hold TControls.%sYou can only put non visual components on it." -msgstr "%s negali turėti TControl klasių.%sĮ jį galima dėti tik nevizualines komponentes." - -#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly -msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." -msgstr "Negalima keisti automatiškai sukurtų mazgų,%stačiau jie gali turėti neautomatiškai sukurtų mazgų-sūnų." - -#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode -msgid "Invalid parent node" -msgstr "Klaidingas tėvinis mazgas" - -#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch -msgid "Parent node can not contain child nodes." -msgstr "Tėvinis mazgas negali turėti mazgų-sūnų." - -#: lazarusidestrconsts:liscodetoolsdefsnewnode -msgid "NewNode" -msgstr "Mazgas" - -#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor -msgid "CodeTools Defines Editor" -msgstr "CodeTools apibrėžčių redaktorius" - -#: lazarusidestrconsts:liscodetempladdcodetemplate -msgid "Add code template" -msgstr "Pridėti kodo šabloną" - -#: lazarusidestrconsts:liscodetempladd -msgid "Add" -msgstr "Pridėti" - -#: lazarusidestrconsts:liscodetempleditcodetemplate -msgid "Edit code template" -msgstr "Keisti kodo šabloną" - -#: lazarusidestrconsts:liscodetemplchange -msgid "Change" -msgstr "Pakeisti" - -#: lazarusidestrconsts:liscodetempltoken -msgid "Token:" -msgstr "Leksema:" - -#: lazarusidestrconsts:liscodetemplcomment -msgid "Comment:" -msgstr "Komentaras:" - -#: lazarusidestrconsts:liscodetemplatokenalreadyexists -msgid " A token %s%s%s already exists! " -msgstr "Leksema %s%s%s jau egzistuoja! " - -#: lazarusidestrconsts:liscodetemplerror -msgid "Error" -msgstr "Klaida" - -#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades -msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." -msgstr "Konstruktorių atverti neis.%s Klasė %s nepaveldi vizualinės klasės, pavyzdžiui tokios kaip TForm ar TDataModule." - -#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic -msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." -msgstr "Klasė konfliktuoja su .lfm failu:%smodulis %s%s naudoja modulį %s,%skuriame yra klasė %s, %stačiau ,lfm faile įrašyta visai kita klasė.%sModulyje gali būti tik viena vizualinė klasė.%s%sPekelkit į kitą modulį." - -#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass -msgid "Unable to find the unit of component class %s%s%s." -msgstr "Nepavyko rasti komponentės klasės %s%s%s modulio." - -#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits -msgid "Unable to load the component class %s%s%s, because it depends on itself." -msgstr "Įkelti komponentės klasės %s%s%s nepavyks, nes ji turi priklausomybę pačiai sau." - -#: lazarusidestrconsts:liscancelloadingthiscomponent -msgid "Cancel loading this component" -msgstr "Neįkelti šio komponento" - -#: lazarusidestrconsts:lisabortwholeloading -msgid "Abort whole loading" -msgstr "Nutraukti įkėlimą" - -#: lazarusidestrconsts:lisignoreusetformasancestor -msgid "Ignore, use TForm as ancestor" -msgstr "Ignoruoti, TForm naudoti kaip protėvį." - -#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor -msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." -msgstr "Resursų klasė %s%s%s paveldėjama nuo %s%s%s. Greičiausiai rašybos klaida TForm'ai." - -#: lazarusidestrconsts:lismakeresourcestring -msgid "Make ResourceString" -msgstr "Kurti resursų eilutę" - -#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect -msgid "Invalid Resourcestring section" -msgstr "Klaidinga resursų eilutės sekcija" - -#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring -msgid "Please choose a resourstring section from the list." -msgstr "Resursų eilutės sekciją pasirinkite iš sąrašo." - -#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis -msgid "Resourcestring already exists" -msgstr "Tokia resursų eilutė jau yra" - -#: lazarusidestrconsts:lismakeresstrchooseanothername -msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." -msgstr "Tokia resursų eilutė %s%s%s jau yra.%sParinkite kitokį vardą.%sNorint ją įdėti to nepaisant, spauskite \"Ignoruoti\"." - -#: lazarusidestrconsts:lismakeresstrstringconstantinsource -msgid "String constant in source" -msgstr "Teksto konstanta pirminiame kode" - -#: lazarusidestrconsts:lismakeresstrconversionoptions -msgid "Conversion Options" -msgstr "Konvertavimo parinktys" - -#: lazarusidestrconsts:lismakeresstridentifierprefix -msgid "Identifier prefix:" -msgstr "Identifikatoriaus prefiksas:" - -#: lazarusidestrconsts:lismakeresstridentifierlength -msgid "Identifier length:" -msgstr "Identifikatoriaus ilgis:" - -#: lazarusidestrconsts:lismakeresstrdialogidentifier -msgid "Identifier" -msgstr "Identifikatorius" - -#: lazarusidestrconsts:lismakeresstrcustomidentifier -msgid "Custom identifier" -msgstr "Naudotojo identifikatorius" - -#: lazarusidestrconsts:lismakeresstrresourcestringsection -msgid "Resourcestring section:" -msgstr "Išteklių eilutės sekcija:" - -#: lazarusidestrconsts:lismakeresstrstringswithsamevalue -msgid "Strings with same value:" -msgstr "Eilutės su tokia pat reikšme:" - -#: lazarusidestrconsts:lismakeresstrappendtosection -msgid "Append to section" -msgstr "Tiesiog pridėti" - -#: lazarusidestrconsts:lismakeresstrinsertalphabetically -msgid "Insert alphabetically" -msgstr "Įterpti pagal abėcėlę" - -#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive -msgid "Insert context sensitive" -msgstr "Įterpti pagal kontekstą" - -#: lazarusidestrconsts:lismakeresstrsourcepreview -msgid "Source preview" -msgstr "Pirminio kodo peržiūra" - -#: lazarusidestrconsts:lisnostringconstantfound -msgid "No string constant found" -msgstr "Nerasta teksto konstanta" - -#: lazarusidestrconsts:lissuccess -msgid "Success" -msgstr "Tvarka" - -#: lazarusidestrconsts:lisallblockslooksok -msgid "All blocks looks ok." -msgstr "Visi blokai geri." - -#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon -msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." -msgstr "Funkcijai \"Kurti išteklių eilutę\" reikia pažymėtos teksto konstantos.%sTad pažymėkite išraišką ir bandykite vėl." - -#: lazarusidestrconsts:lisdiffdlgtext1 -msgid "Text1" -msgstr "Tekstas1" - -#: lazarusidestrconsts:lisdiffdlgonlyselection -msgid "Only selection" -msgstr "Tik pažymėtoje srityje" - -#: lazarusidestrconsts:lisdiffdlgtext2 -msgid "Text2" -msgstr "Tekstas2" - -#: lazarusidestrconsts:lisdiffdlgcaseinsensitive -msgid "Case Insensitive" -msgstr "Skirti didžiąsias ir mažąsias raides" - -#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd -msgid "Ignore if empty lines were added or removed" -msgstr "Nepaisyti įdėtų ar pašalintų tuščių eilučių" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline -msgid "Ignore spaces at start of line" -msgstr "Nepaisyti tarpo simbolių eilutės pradžioje" - -#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline -msgid "Ignore spaces at end of line" -msgstr "Nepaisyti tarpo simbolių eilutės gale" - -#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe -msgid "Ignore difference in line ends (e.g. #10 = #13#10)" -msgstr "Nepaisyti naujos eilutės tipų (pvz.: #10 = #13#10)" - -#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd -msgid "Ignore amount of space chars" -msgstr "Nepaisyti tam tikro tarpo simbolių kiekio" - -#: lazarusidestrconsts:lisdiffdlgignorespaces -msgid "Ignore spaces (newline chars not included)" -msgstr "Nepaisyti tarpo simbolių (neskaitant naujos eilutės simbolių)" - -#: lazarusidestrconsts:lisdiffdlgopendiffineditor -msgid "Open Diff in editor" -msgstr "Diff atverti redaktoriuje" - -#: lazarusidestrconsts:lissave -msgid "Save ..." -msgstr "Išsaugoti" - -#: lazarusidestrconsts:listodolistcaption -msgid "ToDo List" -msgstr "ToDo sąrašas" - -#: lazarusidestrconsts:listodolistrefresh -msgid "Refresh todo items" -msgstr "Atnaujinti ToDo sąrašą" - -#: lazarusidestrconsts:listodolistgotoline -msgid "Goto selected source line" -msgstr "Rodyti eilutę pirminiame kode" - -#: lazarusidestrconsts:listodolistprintlist -msgid "Print todo items" -msgstr "Spauzdinti ToDo sąrašą" - -#: lazarusidestrconsts:listodolistoptions -msgid "ToDo options..." -msgstr "ToDo parinktys..." - -#: lazarusidestrconsts:listodoldescription -msgid "Description" -msgstr "Aprašymas" - -#: lazarusidestrconsts:lisctinsertmacro -msgid "Insert Macro" -msgstr "Įterpti makrokomandą" - -#: lazarusidestrconsts:listodolfile -msgid "File" -msgstr "Failas" - -#: lazarusidestrconsts:listodolline -msgid "Line" -msgstr "Eilutė" - -#: lazarusidestrconsts:lispkgfiletypeunit -msgid "Unit" -msgstr "Modulis" - -#: lazarusidestrconsts:lispkgfiletypevirtualunit -msgid "Virtual Unit" -msgstr "Virtualus modulis" - -#: lazarusidestrconsts:lispkgfiletypelfm -msgid "LFM - Lazarus form text" -msgstr "LFM - Lazarus formos kodas" - -#: lazarusidestrconsts:lispkgfiletypelrs -msgid "LRS - Lazarus resource" -msgstr "LRS - Lazarus ištekliai" - -#: lazarusidestrconsts:lispkgfiletypeinclude -msgid "Include file" -msgstr "Įtraukiamasis" +#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg +msgid "Test directory \"%s\" not found." +msgstr "Nerastas testo katalogas \"%s\"." #: lazarusidestrconsts:lispkgfiletypetext msgid "Text" msgstr "Teksto" -#: lazarusidestrconsts:lispkgfiletypebinary -msgid "Binary" -msgstr "Dvejetainis" +#: lazarusidestrconsts:dlgtextattributes +msgid "Text attributes" +msgstr "Teksto atributai" -#: lazarusidestrconsts:lisviewprojectunits -msgid "View Project Units" -msgstr "Projekto moduliai" +#: lazarusidestrconsts:srkmcatediting +msgid "Text editing commands" +msgstr "Teksto keitimo komandos" -#: lazarusidestrconsts:lisinformationaboutunit -msgid "Information about %s" -msgstr "Informacija apie modulį %s" +#: lazarusidestrconsts:srkmcatmarker +msgid "Text marker commands" +msgstr "Teksto žymeklio komandos" -#: lazarusidestrconsts:lisuidyes -msgid "yes" -msgstr "taip" +#: lazarusidestrconsts:srkmcatsearchreplace +msgid "Text search and replace commands" +msgstr "Teksto ieškos ir pakeitimo komandos" -#: lazarusidestrconsts:lisuidno -msgid "no" -msgstr "ne" +#: lazarusidestrconsts:srkmcatselection +msgid "Text selection commands" +msgstr "Teksto žymėjimo komandos" -#: lazarusidestrconsts:lisuidbytes -msgid "%s bytes" -msgstr "% baitų" +#: lazarusidestrconsts:lisfindfiletexttofind +msgid "Text to find:" +msgstr "Ieškoti teksto:" -#: lazarusidestrconsts:lisuidname -msgid "Name:" -msgstr "Vardas:" +#: lazarusidestrconsts:lisdiffdlgtext1 +msgid "Text1" +msgstr "Tekstas1" -#: lazarusidestrconsts:lisuidtype -msgid "Type:" -msgstr "Tipas:" +#: lazarusidestrconsts:lisdiffdlgtext2 +msgid "Text2" +msgstr "Tekstas2" -#: lazarusidestrconsts:lisuidinproject -msgid "in Project:" -msgstr "Projekte:" +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: /home/user/kylix%s" -#: lazarusidestrconsts:lisuidincludedby -msgid "Included by:" -msgstr "Jį įtraukia:" +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" -#: lazarusidestrconsts:lisuidclear -msgid "Clear" -msgstr "Išvalyti" +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: /home/user/kylix%s" -#: lazarusidestrconsts:lisuidpathsreadonly -msgid "Paths (Read Only)" -msgstr "Keliai (tik skaitymui)" +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" -#: lazarusidestrconsts:lisuidunit -msgid "Unit" -msgstr "Modulis" +#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory +msgid "The %s project directory,%swhich contains the .dpr, dpk file." +msgstr "%s projekto katalogas, kuriame yra .dpr ir .dpk failai." -#: lazarusidestrconsts:lisuidsrc -msgid "Src" -msgstr "pirm.kod." +#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase +msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." +msgstr "FCL - FreePascal komponenčių biblioteka, pateikia visas objektinio paskalio bazines klases." -#: lazarusidestrconsts:lisuidok -msgid "Ok" -msgstr "Tinka" +#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir +msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." +msgstr "FPC pirminio kodo katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"rtl\", \"packages\", \"compiler\", ... ." -#: lazarusidestrconsts:lisuidsize -msgid "Size:" -msgstr "Dydis:" +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir +msgid "The Free Pascal SVN source directory." +msgstr "FreePascal SVN pirminio kodo katalogas." -#: lazarusidestrconsts:lisuidlines -msgid "Lines:" -msgstr "Eilučių:" +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory +msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." +msgstr "FreePascal SVN pirminio teksto katalogas. Nebūtina, tačiau nurodžius tai pagerins paskelbimo kode paiešką bei programos derinimą." -#: lazarusidestrconsts:lisuishowcodetoolsvalues -msgid "Show CodeTools Values" -msgstr "Rodyti CodeTools reikšmes" +#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm +msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." +msgstr "Nerastas FreePascal kompiliatorius (failas: %s).%sRekomenduotina instaliuoti fpc." -#: lazarusidestrconsts:lisueerrorinregularexpression -msgid "Error in regular expression" -msgstr "Klaidingas reguliarusis reiškinys" +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory +msgid "The Free Pascal project directory." +msgstr "FreePascal projekto katalogas." -#: lazarusidestrconsts:lissearchfor -msgid "Search For " -msgstr "Ko ieškoti" +#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun +msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" +msgstr "Nerastas FreePascal pirminių kodų katalogas.%sKai kurios funkcijos neveiks.%sRekomenduotina įdiegti FreePascal pirminius kodus ir nurodyti kelią iki jų%s\"Aplinka -> Aplinkos parinktys -> Failai\"." -#: lazarusidestrconsts:lisuenotfound -msgid "Not found" -msgstr "Nerasta" +#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase +msgid "The LCL - Lazarus Component Library contains all base components for form editing." +msgstr "LCL - Lazarus komponenčių biblioteka, turinti visas pagrindines komponentes reikalingas formos kūrimui." -#: lazarusidestrconsts:lisuesearchstringnotfound -msgid "Search string '%s' not found!" -msgstr "Ieškomasis tekstas %s nerastas!" +#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis +msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." +msgstr "LFM (Lazarus forma) faile aptikta klaidų. Pavyzdžiui, jame yra savybių/klasių, kurių nėra dabartiniame LCL. Yra įprasta šias savybes/klases pašalinti ir po to paskalio kodą taisyti rankiniu būdu." -#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith -msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "Pakeisti rastąjį %s%s%s%s į %s%s%s?" +#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr +msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" +msgstr "Nerastas Lazarus katalogas %s%s%s%s.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." -#: lazarusidestrconsts:lisuesearching -msgid "Searching: %s" -msgstr "Ieškoma: %s" - -#: lazarusidestrconsts:lisuereadonly -msgid "%s/ReadOnly" -msgstr "%s/Tik skaitymui" - -#: lazarusidestrconsts:lisuegotoline -msgid "Goto line :" -msgstr "Rodyti eilutę:" - -#: lazarusidestrconsts:listmfunctionextractfileextension -msgid "Function: extract file extension" -msgstr "Funkcija: ištraukti tik failo prievardį" - -#: lazarusidestrconsts:listmfunctionextractfilepath -msgid "Function: extract file path" -msgstr "Funkcija: ištraukti tik kelią" - -#: lazarusidestrconsts:listmfunctionextractfilenameextension -msgid "Function: extract file name+extension" -msgstr "Funkcija: ištraukti failo vardą ir prievardį" - -#: lazarusidestrconsts:listmfunctionextractfilenameonly -msgid "Function: extract file name only" -msgstr "Funkcija: ištraukti tik failo vardą" - -#: lazarusidestrconsts:listmfunctionappendpathdelimiter -msgid "Function: append path delimiter" -msgstr "Funkcija: kelio gale pridėti kelio skirtuką" - -#: lazarusidestrconsts:listmfunctionchomppathdelimiter -msgid "Function: chomp path delimiter" -msgstr "Funkcija: pašalinti kelio gale esantį skirtuką" - -#: lazarusidestrconsts:listmunknownmacro -msgid "(unknown macro: %s)" -msgstr "(nežinoma makrokomanda: %s)" - -#: lazarusidestrconsts:lissvuoinvalidvariablename -msgid "Invalid variable name" -msgstr "Klaidingas kintamojo vardas" - -#: lazarusidestrconsts:lissvuoisnotavalididentifier -msgid "%s%s%s is not a valid identifier." -msgstr "Identifikatorius %s%s%s klaidingas." - -#: lazarusidestrconsts:lisfriidentifier -msgid "Identifier: %s" -msgstr "Identifikatorius: %s" - -#: lazarusidestrconsts:lissvuooverridesystemvariable -msgid "Override system variable" -msgstr "Kurti viršesnį sistemos kintamąjį" - -#: lazarusidestrconsts:lissvuook -msgid "Ok" -msgstr "Tinka" - -#: lazarusidestrconsts:lissortselsortselection -msgid "Sort selection" -msgstr "Rūšiuoti pažymėtą" - -#: lazarusidestrconsts:lissortselpreview -msgid "Preview" -msgstr "Peržiūra" - -#: lazarusidestrconsts:lissortselascending -msgid "Ascending" -msgstr "Didėjanti" - -#: lazarusidestrconsts:lissortseldescending -msgid "Descending" -msgstr "Mažėjanti" - -#: lazarusidestrconsts:lissortseldomain -msgid "Domain" -msgstr "Sritis" - -#: lazarusidestrconsts:lissortsellines -msgid "Lines" -msgstr "Eilutės" - -#: lazarusidestrconsts:lissortselwords -msgid "Words" -msgstr "Žodžiai" - -#: lazarusidestrconsts:lissortselparagraphs -msgid "Paragraphs" -msgstr "Pastraipos" - -#: lazarusidestrconsts:lissortseloptions -msgid "Options" -msgstr "Parinktys" - -#: lazarusidestrconsts:lissortselcasesensitive -msgid "Case Sensitive" -msgstr "Atsižvelgti į raidžių lygį" - -#: lazarusidestrconsts:lissortselignorespace -msgid "Ignore Space" -msgstr "Tarpai nesvarbūs" - -#: lazarusidestrconsts:lissortselsort -msgid "Accept" -msgstr "Rūšiuoti" - -#: lazarusidestrconsts:lissortselcancel -msgid "Cancel" -msgstr "Atsisakyti" - -#: lazarusidestrconsts:lispublprojinvalidincludefilter -msgid "Invalid Include filter" -msgstr "Klaidingas įtraukiamųjų filtras" - -#: lazarusidestrconsts:lispublprojinvalidexcludefilter -msgid "Invalid Exclude filter" -msgstr "Klaidingas neįtraukiamųjų filtras" - -#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist -msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." -msgstr "Programos pirminiame kode nepavyko pakeisti automatiškai kuriamų formų sąrašą.%sSusimildami, pirmiausiai ištaisykit klaidas." - -#: lazarusidestrconsts:lisprojoptserror -msgid "Error" -msgstr "Klaida" - -#: lazarusidestrconsts:lispatheditselectdirectory -msgid "Select directory" -msgstr "Rinkitės katalogą" - -#: lazarusidestrconsts:lispatheditsearchpaths -msgid "Search paths:" -msgstr "Ieškos keliai:" - -#: lazarusidestrconsts:lispatheditmovepathdown -msgid "Move path down" -msgstr "Perkelti kelią žemyn" - -#: lazarusidestrconsts:lispatheditmovepathup -msgid "Move path up" -msgstr "Perkelti kelią aukštyn" - -#: lazarusidestrconsts:lispatheditbrowse -msgid "Browse" -msgstr "Naršyti" - -#: lazarusidestrconsts:lispatheditpathtemplates -msgid "Path templates" -msgstr "Kelio šablonai" - -#: lazarusidestrconsts:lisnewdlgnoitemselected -msgid "No item selected" -msgstr "Nėra pažymėtų elementų" - -#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst -msgid "Please select an item first." -msgstr "Būtina pažymėti kurį nors iš elementų." - -#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype -msgid "Create a new editor file.%sChoose a type." -msgstr "Kurti naują redaktoriaus failą.%sNurodykite jo tipą." - -#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype -msgid "Create a new project.%sChoose a type." -msgstr "Kurti naują projektą.%sNurodykite jo tipą." - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile -msgid "Choose one of these items to create a new File" -msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują failą" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject -msgid "Choose one of these items to create a new Project" -msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują projektą" - -#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage -msgid "Choose one of these items to create a new Package" -msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują paketą" - -#: lazarusidestrconsts:lispackage -msgid "Package" -msgstr "Paketas" - -#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit -msgid "Create a new pascal unit." -msgstr "Kurti naują paskalio modulį." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform -msgid "Create a new unit with a LCL form." -msgstr "Kurti naują modulį su LCL forma." - -#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule -msgid "Create a new unit with a datamodule." -msgstr "Kurti naują modulį su duomenų moduliu." - -#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile -msgid "Create a new empty text file." -msgstr "Kurti naują tuščią teksto failą." - -#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi -msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." -msgstr "Įprastas Paskalio programos failas.%sŠitai galite naudoti greitam bei grubiam testui.%sGeriau kurkite naują projektą." - -#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication -msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "Kurti naują grafinę programą.%sProgramos failu rūpinsis Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewprogram -msgid "Create a new program.%sThe program file is maintained by Lazarus." -msgstr "Kurti naują programą.%sProgramos failu rūpinsis Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram -msgid "Create a new program." -msgstr "Kurti naują programą." - -#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained -msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." -msgstr "Kurti naują cgi programą.%sProgramos failu rūpinsis Lazarus." - -#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun -msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "Kurti naują standartinį paketą.%sPaketas- tai modulių bei komponentų rinkinys." - -#: lazarusidestrconsts:lisunabletocreatefile -msgid "Unable to create file" -msgstr "Failas nesiduoda sukuriamas" - -#: lazarusidestrconsts:liscannotcreatefile -msgid "Can not create file %s%s%s" -msgstr "Nepavyksta sukurti failą %s%s%s" - -#: lazarusidestrconsts:lisextendunitpath -msgid "Extend unit path?" -msgstr "Išplėsti modulio kelią?" - -#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit -msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" -msgstr "Katalogas %s%s%s nefigūruoja modulio kelyje.%sPridėti katalogą prie modulio kelio?" - -#: lazarusidestrconsts:lisunabletocreatefilename -msgid "Unable to create file %s%s%s." -msgstr "Nepavyko sukurti failą %s%s%s." - -#: lazarusidestrconsts:lisunabletowritefile -msgid "Unable to write file" -msgstr "Nepavyko rašyti į failą" - -#: lazarusidestrconsts:lisunabletowritefile2 -msgid "Unable to write file %s%s%s" -msgstr "Nepavyko rašyti į failą %s%s%s" - -#: lazarusidestrconsts:lisfileisnotwritable -msgid "File is not writable" -msgstr "Failas tik skaitymui" - -#: lazarusidestrconsts:lisunabletowritetofile2 -msgid "Unable to write to file %s%s%s" -msgstr "Neįmanoma rašyti į failą %s%s%s" - -#: lazarusidestrconsts:lisunabletowritefilename -msgid "Unable to write file %s%s%s." -msgstr "Nepavyko rašyti į failą %s%s%s." - -#: lazarusidestrconsts:lisunabletoreadfile -msgid "Unable to read file" -msgstr "Nepavyko įkelti failą" - -#: lazarusidestrconsts:lisunabletoreadfilename -msgid "Unable to read file %s%s%s." -msgstr "Nepavyko įkelti failą %s%s%s." - -#: lazarusidestrconsts:liserrordeletingfile -msgid "Error deleting file" -msgstr "Nepavyko ištrinti failą" - -#: lazarusidestrconsts:lisunabletodeleteambiguousfile -msgid "Unable to delete ambiguous file %s%s%s" -msgstr "Nepavyko ištrinti neaiškųjį failą %s%s%s" - -#: lazarusidestrconsts:liserrorrenamingfile -msgid "Error renaming file" -msgstr "Nepavyko pervardyti failą" - -#: lazarusidestrconsts:lisunabletorenameambiguousfileto -msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" -msgstr "Nepavyko neaiškųjį failą %s%s%s%spervardyti į %s%s%s" - -#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis -msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" -msgstr "Dėmesio: rastas neaiškus failas: %s%s%s. Pirminio kodo failas: %s%s%s" - -#: lazarusidestrconsts:lisambiguousfilefound -msgid "Ambiguous file found" -msgstr "Rastas neaiškus failas" - -#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension -msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "Rastas kitas failas tokiu pat vardu bei panašiu prievardžiu.%sFailas: %s%sNeaiškusis failas: %s%s%sPašalinti neaiškųjį failą?" - -#: lazarusidestrconsts:lisprojaddinvalidminmaxversion -msgid "Invalid Min-Max version" -msgstr "Klaidingos versijos ribos" - -#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion -msgid "The Maximum Version is lower than the Minimim Version." -msgstr "Maksimali versija žemesnė nei minimali" - -#: lazarusidestrconsts:lisprojaddinvalidpackagename -msgid "Invalid packagename" -msgstr "Klaidingas paketo vardas" - -#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag -msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "Paketo vardas %s%s%s klaidingas%sNurodykite egzistuojantį paketą." - -#: lazarusidestrconsts:lisprojadddependencyalreadyexists -msgid "Dependency already exists" -msgstr "Priklausomybė jau yra" - -#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency -msgid "The project has already a dependency for the package %s%s%s." -msgstr "Projektas jau turi priklausomybe paketui %s%s%s." - -#: lazarusidestrconsts:lisprojaddpackagenotfound -msgid "Package not found" -msgstr "Paketas nerastas" - -#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage -msgid "This file is not in any loaded package." -msgstr "Failas nerastas nėviename įkeltame pakete" - -#: lazarusidestrconsts:lisprojaddthedependencywasnotfound -msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "Priklausinys %s%s%s nerastas.%sNurodykite egzistuojantį paketą." - -#: lazarusidestrconsts:lisprojaddinvalidversion -msgid "Invalid version" -msgstr "Klaidinga versija" - -#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid -msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" +#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory +msgid "The Lazarus main directory." +msgstr "Lazarus pagrindinis katalogas." #: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "Maksimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" -#: lazarusidestrconsts:lisprojaddinvalidpascalunitname -msgid "Invalid pascal unit name" -msgstr "Klaidingas paskalio modulio vardas" +#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion +msgid "The Maximum Version is lower than the Minimim Version." +msgstr "Maksimali versija žemesnė nei minimali" -#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier -msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "Modulio vardas %s%s%s nėra paskalio identifikatorius." +#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid +msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" -#: lazarusidestrconsts:lisprojaddunitnamealreadyexists -msgid "Unit name already exists" -msgstr "Modulio vardas jau egzistuoja" +#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase +msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." +msgstr "RTL - biblioteka veikos rėžimui, tai visų FreePascal programų bazė." + +#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt +msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" +msgstr "Nerastas katalogas testui:%s%s%s%s%s(tikrinkite aplinkos parinktis)" + +#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit +msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "Protėvio tipo %s%s%s vardas tokspat kaip ir%smodulio %s%s%s." + +#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier +msgid "The ancestor type %s%s%s is not a valid pascal identifier." +msgstr "Protėvio tipas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro +msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." +msgstr "Klasė %s%s%s yra \"TControl\" tipo, todėl jos neis įdėti ne į valdiklį.%sĮdėti nepavyks." + +#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame +msgid "The class name %s%s%s and ancestor type %s%s%s are the same." +msgstr "Klasės vardas %s%s%stokspat kaip ir protėvio tipo %s%s%s." + +#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile +msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" +msgstr "Klasės vardas %s%s%s jau figūruoja%spaketo %s%sfaile: %s%s%s" + +#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit +msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "Klasės vardas %s%s%s tokspat kaip ir%smodulio %s%s%s." + +#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier +msgid "The class name %s%s%s is not a valid pascal identifier." +msgstr "Klasės vardas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:listhecommandafterisnotexecutable +msgid "The command after %s%s%s is not executable." +msgstr "Komanda esanti po %s%s%s nėra vykdomasis failas." + +#: lazarusidestrconsts:listhecommandafterpublishingisinvalid +msgid "The command after publishing is invalid:%s%s%s%s" +msgstr "Komanda esanti po paskelbimo yra klaidinga:%s%s%s%s" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg +msgid "The compiler file \"%s\" is not an executable." +msgstr "Kompiliatoriaus failas \"%s\" nėra paleidžiamasis." + +#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable +msgid "The compiler file for package %s is not a valid executable:%s%s" +msgstr "Paketo %s kompiliatoriaus failas nėra vykdomasis:%s%s" + +#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated +msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" +msgstr "Klasės %s%s%s%s komponentų redaktorius, iššauktas veiksmažodžio #%s %s%s%s,%spadarė klaidą:%s%s%s%s" + +#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror +msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" +msgstr "Klasės %s%s%skomponentų redaktorius padarė klaidą:%s%s%s%s" + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" +msgstr "Dabartinis FreePascal pirminio kodo katalogas %s%s%s%s nėra geras.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis FreePascal pirminių kodų katalogas %s%s%s%s nėra geras.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" +msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" +msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:lisuethecurre +msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." +msgstr "Dabartinis redaktoriaus šriftas nėra suderintas su UTF-8 koduote, o jūsų sistema naudoja būtent šią koduotę.%sTai reiškia kad ne ASCII simboliai greičiausiai bus rodomi klaidingai.%sKitą šriftą galite pasirinkti redaktoriaus parinktyse." + +#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits +msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." +msgstr "Dabartinis failo%s%s%s%s modulio kelias yra%s%s%s%s.%s%sTrūksta įrašo apie kelią iki LCL modulių %s%s%s.%s%sUžuomina naujokams:%ssukurkite Lazarus programą ir patalpinkite failą projekto kataloge." + +#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro +msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" +msgstr "Nerasta derintuvė %s%s%s%s, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Aplinka -> Derintuvės parinktys\"." + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg +msgid "The debugger file \"%s\" is not an executable." +msgstr "Derintuvės failas \"%s\" nėra paleidžiamasis." + +#: lazarusidestrconsts:lisprojaddthedependencywasnotfound +msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." +msgstr "Priklausinys %s%s%s nerastas.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist +msgid "The destination directory%s%s%s%s does not exist." +msgstr "Paskirties katalogas%s%s%s%s neegzistuoja." + +#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit +msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" +msgstr "Katalogo įrašas %s%s%s nebebūtinas modulio kelyje.%sPašalinti katalogo įrašą?" + +#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit +msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" +msgstr "Katalogas %s%s%s nefigūruoja modulio kelyje.%sPridėti katalogą prie modulio kelio?" + +#: lazarusidestrconsts:dlgthedirectory +msgid "The directory \"" +msgstr "Katalogas \"" + +#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp +msgid "The file %s seems to be the program file of an existing lazarus Project." +msgstr "Panašu kad failas %s yra kažkurio Lazarus projekto programos failas." + +#: lazarusidestrconsts:listhefile +msgid "The file %s%s%s" +msgstr "Failas %s%s%s" + +#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage +msgid "The file %s%s%s is already in the package." +msgstr "Failas %s%s%s jau yra pakete" + +#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr +msgid "The file %s%s%s is not a Delphi project (.dpr)" +msgstr "Failas %s%s%s nėra Delphi projektas (.dpr)" + +#: lazarusidestrconsts:listhefileisnotadelphiunit +msgid "The file %s%s%s is not a Delphi unit." +msgstr "Failas %s%s%s nėra Delhi modulis." + +#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage +msgid "The file %s%s%s is not a lazarus package." +msgstr "Failas %s%s%s nėra Lazarus paketas." + +#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea +msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." +msgstr "Failas %s%s%s yra šio projekto dalis.%sDalintis failais tarp projektų bei paketų nėra gerai." + +#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage +msgid "The file %s%s%s%sis already in the package %s." +msgstr "Failas %s%s%s%s jau yra pakete %s." + +#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage +msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" +msgstr "Failas %s%s%s%s yra ne paketo modulių kelyje.%s%s%s%s%s įtraukti kaip modulių kelią?" + +#: lazarusidestrconsts:lispkgmangthefileofpackageismissing +msgid "The file %s%s%s%sof package %s is missing." +msgstr "Trūksta failo %s%s%s%s, priklausančio paketui %s." + +#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst +msgid "The file %s%s%s%sof package %s needs to be saved first." +msgstr "Pirma reikia išsaugoti failą %s%s%s%s, priklausantį paketui %s." + +#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject +msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." +msgstr "Panašu kad failas %s%s%s%s yra programa. Užverti šį projektą ir tai programai sukurti naują Lazarus projektą?%sPaspaudus \"Ne\" failas bus įkeltas kaip įprastas pirminis kodas." + +#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac +msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" +msgstr "Failas %s%s%s%s rastas viename iš paketo %s pradinio kodo katalogų. Panašu kad failas yra kompiliuotas modulis. Kompiliuoti moduliai turi būti paketo išvesties kataloge, kitaip gali kilti problemų kitiems paketams naudojant šį paketą.%s%sPašalinti šį neaiškųjį failą?" + +#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself +msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" +msgstr "Failas %s%s%s%s nerastas.%sIeškosite patys?%s" + +#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject +msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." +msgstr "Failas %s%s%s%s nerastas.%sPaspaudus \"Ignoruoti\" projektas bus įkeliamas toliau,%spaspaudus \"Nutraukti\" įkėlimas bus nutrauktas." + +#: lazarusidestrconsts:uefilerotext1 +msgid "The file \"" +msgstr "Failas \"" + +#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject +msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." +msgstr "Failo vardas %s%s%s yra šio projekto dalis%sProjektai ir paketai neturėtų dalintis failais." + +#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile +msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." +msgstr "Failo vardą %s%s%s naudoja%spaketas %s%s%s%s, esantis faile %s%s%s." + +#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage +msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" +msgstr "Failo vardas %s%s%s ir paketo vardas %s%s%s, įrašytas šiame faile, skiriasi.%sPakeisti paketo vardą į %s%s%s?" + +#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename +msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." +msgstr "Neaiškus failo vardas %s%s%s, nes paketas dar neturi nustatyto katalogo.%sNurodykite pilną kelią iki failo." + +#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth +msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" +msgstr "Šių metodų, kuriuos naudoja %s, nėra pirminiame kode%s%s%s%s%s%sPašalinti betikslius įrašus?" + +#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload +msgid "The following package failed to load:" +msgstr "Nepavyko įkelti šio paketo:" + +#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload +msgid "The following packages failed to load:" +msgstr "Nepavyko įkelti šių paketų:" + +#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren +msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." +msgstr "Šių modulių nepavyko rasti:%s%s%s%s 1) Ko gero šie moduliai nėra modulių kelyje, tada jūs galite nutraukti viską, ištaisyti modulių kelią ir bandyti vėl.%s 2) Arba jūs galite praleisti trūkstamus modulius ir vėliau jiems uždėti komentarą." + +#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable +msgid "The host application %s%s%s is not executable." +msgstr "Programa-šeimininkas %s%s%s nėra vykdomasis failas." + +#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists +msgid "The launching Application Bundle %s%s%s%sdoes not exist or is not executable.%s%sSee Project -> Project options -> Application." +msgstr "Paleidžiančioji programa-rišulys %s%s%s%s nerasta, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Projektas -> Projekto parinktys -> Programa\"." + +#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta +msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" +msgstr "Nerasta paleidžiančioji programa%s%s%s%s, arba ji nėra paleidžiamasis failas.%s%sŽvilgterėkit į \"Startuoti -> Startavimo parametrai -> Vietiniai\"." + +#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir +msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." +msgstr "Lazarus katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"lcl\", \"debugger\", \"designer\", \"components\", ... ." + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg +msgid "The make file \"%s\" is not an executable." +msgstr "Programos make failas \"%s\" nėra vykdomasis." + +#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion +msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "Maksimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" + +#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion +msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "Minimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" + +#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier +msgid "The name %s%s%s is not a valid pascal identifier." +msgstr "Vardas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lisinvalidpascalidentifiertext +msgid "The name \"%s\" is not a valid pascal identifier." +msgstr "Vardas \"%s\" nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages +msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." +msgstr "Paketas %s skirtas tik veikos rėžimui.%s Veikos rėžimo paketų negalima diegti į IKA." + +#: lazarusidestrconsts:lisaf2pthepackageisreadonly +msgid "The package %s is read only." +msgstr "Paketas %s tik skaitymui." + +#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation +msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." +msgstr "Paketo %s reikia %s, kuris paženklintas kaip diegiamasis.%sŽvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed +msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" +msgstr "Paketui %s priklauso failas%s%s%s%s.%sFailą pervardinti ir pakete?" + +#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati +msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" +msgstr "Nepavyko kompiliuoti paketą %s%s%s .%sPašalinti jį iš diegimo sarašo?" + +#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans +msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." +msgstr "Paketas %s%s%s nustatytas automatiniam diegimui.%sTai reiškia, kad jis bus įdiegtas į IKA. Diegimo paketai%sturi būti designtime tipo." + +#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound +msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." +msgstr "Paketas %s%s%s įdiegtas, tačiau nerastas paketo failas (.lpk).%sTodėl sukurtas tuščias paketas." + +#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound +msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" +msgstr "Paketas %s%s%s paženklintas kaip diegiamasis, tačiau jo nepavyko rasti.%sPašalinti priklausinį iš paketų diegimo sąrašo?" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus +msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "Paketas %s%s%s paženklintas diegimui.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad diegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus iš naujo dabar?" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus +msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "Paketas %s%s%s paženklintas.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad išdiegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus išnaujo dabar?" + +#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename +msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." +msgstr "Paketo failo vardas %s%s%s, įrašytas %s%s%s%s, nėra tinkamas Lazarus paketo vardas." + +#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe +msgid "The package has already a dependency for the package %s%s%s." +msgstr "Paketas jau priklauso nuo paketo %s%s%s." + +#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag +msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." +msgstr "Paketo vardas %s%s%s klaidingas%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting +msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." +msgstr "Klaidingas paketo vardas %s%s%s.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean +msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" +msgstr "Paketo vardas %s%s%s yra klaidingas.%sParinkite kitokį vardą (pvz.: paketas.lpk)" + +#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid +msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." +msgstr "Paketo vardas %s%s%s, įrašytas faile %s%s%s, yra klaidingas." + +#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars +msgid "The page name %s%s%s is too long (max 100 chars)." +msgstr "Perilgas lapo vardas %s%s%s (gali būti nedaugiau 100 simbolių)" + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject +msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." +msgstr "Šio projekto FreePascal kompiliatoriaus programa su keliu iki jos. Būtina įrašyti jei žemiau nurodysit FPC SVN pirminio kodo katalogą. Šis įrasa naudojamas automatiškai kuriant makrokomandas." + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample +msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." +msgstr "FreePascal kompiliatoriaus programa su keliu iki jos.%sPavyzdžiui: %s/usr/bin/%s -n%s arba %s/usr/local/bin/fpc @/etc/fpc.cfg%s." + +#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla +msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" +msgstr "Nerasta programa %ssmake%s.%sŠi programa reikalinga Lazarus darymui.%s" + +#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency +msgid "The project has already a dependency for the package %s%s%s." +msgstr "Projektas jau turi priklausomybe paketui %s%s%s." + +#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource +msgid "The project info file %s%s%s%sis equal to the project main source file!" +msgstr "Projekto informacinis failas %s%s%s%s toks pat kaip ir projekto pagrindinio pirminio kodo failas!" + +#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin +msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically." +msgstr "Projektas užvertas. Šiuo atveju yra trys galimybės.%sUžuomina: jums nebūtina pačiam užverti projektą, tai padaroma automatiškai." + +#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest +msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" +msgstr "Prieš darymą projektas turi būti išsaugotas%sAplinkos parinktyse parinkę testo katalogą,%snaujus projektus bus galima kurti ir daryti vienu metu.%sIšsaugoti projektą?" + +#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound +msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." +msgstr "Projektui reikia paketo %s%s%s.%sTačiau jo nepavyko rasti. Žvilgterėkit į \"Projektas -> Projekto inspektorius\"." + +#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor +msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." +msgstr "Resursų klasė %s%s%s paveldėjama nuo %s%s%s. Greičiausiai rašybos klaida TForm'ai." + +#: lazarusidestrconsts:lismakeresstrchooseanothername +msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." +msgstr "Tokia resursų eilutė %s%s%s jau yra.%sParinkite kitokį vardą.%sNorint ją įdėti to nepaisant, spauskite \"Ignoruoti\"." + +#: lazarusidestrconsts:listherootcomponentcannotbedeleted +msgid "The root component can not be deleted." +msgstr "Šakninio komponento negalima Pašalinti." + +#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming +msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." +msgstr "Modulis %s%s%s jau egzistuoja.%sPaspaudus \"Ignoruoti\" bus pervadyjama,%spaspaudus \"Atsisakyti\" šis pirminis kodas nebus išsaugotas,%so paspaudus \"Nutraukti\" bus nutrauktas visas išsaugojimo procesas." + +#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds +msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" +msgstr "Modulio failo varde %s%s%s nevisos raidės yra mažosios.%sFreePascal kompiliatorius 1.0.x priima failus, kurių varduose tik mažosios raidės. Jei jūs nenaudojate FPC 1.0.x, tada jūs galite ignoruoti šį pranešimą.%s%sPervardyti failą?" + +#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus +msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." +msgstr "Jau pačio modulio vardas yra toks %s%s%s. Paskalio identifikatoriai turi būti unikalūs." #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." @@ -7387,321 +8317,1275 @@ msgstr "Pridedamojo modulio vardas %s%s%s jau figūruoja šiame projekte,%sžvil msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "Pridedamųjų failų sąraše yra keli moduliai tokiu pat vardu %s%s%s,%svieno iš jų failas: %s%s%s." -#: lazarusidestrconsts:lisprojaddtoproject -msgid "Add to project" -msgstr "Įdėti į projektą" +#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename +msgid "The unit name %s%s%s does not correspond to the filename." +msgstr "Modulio %s%s%s ir failo vardai neatitinka." -#: lazarusidestrconsts:lisprojaddnewrequirement -msgid "New Requirement" -msgstr "Nauja priklausomybė" +#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier +msgid "The unit name %s%s%s is not a valid pascal identifier." +msgstr "Modulio vardas %s%s%s nėra paskalio identifikatorius." -#: lazarusidestrconsts:lisprojaddfiles -msgid "Add files" -msgstr "Pridėti failus" +#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent +msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." +msgstr "Modulio vardas %s%s%s tokspat kaip ir užregistruota komponentė.%sDėlto galite sulaukti keistų pranešimų apie klaidas." -#: lazarusidestrconsts:lisprojaddeditorfile -msgid "Add editor files" -msgstr "Pridėti redaktoriaus failus" +#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer +msgid "The unit name %s%s%s%sand filename %s%s%s differ." +msgstr "Modulio %s%s%s%s ir failo %s%s%s vardai skiriasi." -#: lazarusidestrconsts:lisprojaddaddfiletoproject -msgid "Add file to project:" -msgstr "Įdėti failą į projektą:" +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage +msgid "The unitname %s%s%s already exists in the package:%s%s" +msgstr "Modulio vardas %s%s%s jau yra pakete:%s%s" -#: lazarusidestrconsts:lisprojaddpackagename -msgid "Package Name:" -msgstr "Paketo vardas:" +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage +msgid "The unitname %s%s%s already exists in this package." +msgstr "Modulio vardas %s%s%s jau yra pakete." -#: lazarusidestrconsts:lisprojaddminimumversionoptional -msgid "Minimum Version (optional):" -msgstr "Minimali versija (nebūtina):" +#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier +msgid "The unitname is not a valid pascal identifier." +msgstr "Modulio vardas nėra paskalio identifikatorius." -#: lazarusidestrconsts:lisprojaddmaximumversionoptional -msgid "Maximum Version (optional):" -msgstr "Maksimali versija (nebūtina)" +#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses +msgid "The unitname is used when the IDE extends uses clauses." +msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą." -#: lazarusidestrconsts:liscomppalopenpackage -msgid "Open package" -msgstr "Atverti paketą" +#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu +msgid "There are more functions in the popupmenu" +msgstr "Daugiau funkcijų yra iškylančiame menių" -#: lazarusidestrconsts:liskmopenpackagefile -msgid "Open package file" -msgstr "Atverti paketo failą" +#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename +msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" +msgstr "Kataloge yra failų, kurių vardai skiriasi tik raidžių lygiais:%s%s%sJuos ištrinti?" -#: lazarusidestrconsts:liscpopenpackage -msgid "Open Package %s" -msgstr "Atverti paketą %s" +#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from +msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" +msgstr "Rasti du moduliai tuo pačiu vardu:%s%s1. %s%s%s iš %s%s2. %s%s%s iš %s%s%s" -#: lazarusidestrconsts:liscpopenunit -msgid "Open Unit %s" -msgstr "Atverti modulį %s" +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage +msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" +msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir paketas:%s%s%s%s%s%s" -#: lazarusidestrconsts:liscomppalopenunit -msgid "Open unit" -msgstr "Atverti modulį" +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom +msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" +msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir:%s%s%s%s%s%s iš %s%s%s" -#: lazarusidestrconsts:liscomppalfindcomponent -msgid "Find component" -msgstr "Ieškoti komponentės" +#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages +msgid "There is a circle in the required packages. See package graph." +msgstr "Reikiamuose paketuose rastas ratas. Žvilgterėkit į paketų grafą." -#: lazarusidestrconsts:lismacropromptenterdata -msgid "Enter data" -msgstr "Įveskite duomenis" - -#: lazarusidestrconsts:lismacropromptenterrunparameters -msgid "Enter run parameters" -msgstr "Įveskite starto parametrus" - -#: lazarusidestrconsts:lisdebuggererror -msgid "Debugger error" -msgstr "Derintuvės klaida" - -#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate -msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." -msgstr "Derintuvės klaida%sAmen! Derintuvė praranda stabilumą!%sNedelsdami išsaugokite darbo rezultatus!%sSpauskite \"Stabdyti\", ir tikėkitės kad viskas baigsis laimingai..." - -#: lazarusidestrconsts:lisexecutionstopped -msgid "Execution stopped" -msgstr "Veika sustabdyta" - -#: lazarusidestrconsts:lisexecutionstoppedon -msgid "Execution stopped%s" -msgstr "Veika sustabdyta%s" - -#: lazarusidestrconsts:lisexecutionpaused -msgid "Execution paused" -msgstr "Veika pristabdyta" - -#: lazarusidestrconsts:lisexecutionpausedadress -msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" -msgstr "Veika pristabdyta%s Adresas: $%s%s Procedūra: %s%s Failas: %s%s(Tarp kitko, kadanors čia turėtų pasirodyti asemblerio langas :)%s" - -#: lazarusidestrconsts:lisfilenotfound -msgid "File not found" -msgstr "Failas nerastas" - -#: lazarusidestrconsts:liscleanupunitpath -msgid "Clean up unit path?" -msgstr "Apvalyti modulio kelią?" - -#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit -msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "Katalogo įrašas %s%s%s nebebūtinas modulio kelyje.%sPašalinti katalogo įrašą?" - -#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself -msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "Failas %s%s%s%s nerastas.%sIeškosite patys?%s" - -#: lazarusidestrconsts:lisruntofailed -msgid "Run-to failed" -msgstr "Nepavyko Startuoti-Iki" - -#: lazarusidestrconsts:lisdbgmangnodebuggerspecified -msgid "No debugger specified" -msgstr "Nenurodyta derintuvė" - -#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno -msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." -msgstr "Nenurodyta derintuvė.%sStabdos taškai neveiks kol nebus nurodyta derintuvė. Ji nurodoma menių esančiame derintuvės parinkčių dialoge." - -#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway -msgid "Set the breakpoint anyway" -msgstr "Vistiek padėti stabdos tašką" - -#: lazarusidestrconsts:lislaunchingapplicationinvalid -msgid "Launching application invalid" -msgstr "Netinkama paleidžiančioji programa" - -#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta -msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "Nerasta paleidžiančioji programa%s%s%s%s, arba ji nėra paleidžiamasis failas.%s%sŽvilgterėkit į \"Startuoti -> Startavimo parametrai -> Vietiniai\"." - -#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists -msgid "The launching Application Bundle %s%s%s%sdoes not exist or is not executable.%s%sSee Project -> Project options -> Application." -msgstr "Paleidžiančioji programa-rišulys %s%s%s%s nerasta, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Projektas -> Projekto parinktys -> Programa\"." - -#: lazarusidestrconsts:lisdebuggerinvalid -msgid "Debugger invalid" -msgstr "Netinkama derintuvė" - -#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro -msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "Nerasta derintuvė %s%s%s%s, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Aplinka -> Derintuvės parinktys\"." - -#: lazarusidestrconsts:lispleaseopenaunitbeforerun -msgid "Please open a unit before run." -msgstr "Prieš startuojant atverkite modulį." - -#: lazarusidestrconsts:lisdiskdifferrorreadingfile -msgid "Error reading file: %s" -msgstr "Klaida skaitant failą: %s" - -#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk -msgid "Some files have changed on disk:" -msgstr "Kai kurie failai buvo pakeisti iš išorės:" - -#: lazarusidestrconsts:lisdiskdiffchangedfiles -msgid "Changed files:" -msgstr "Pakeisti failai:" - -#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff -msgid "Click on one of the above items to see the diff" -msgstr "Spustelėjus ant elemento bus parodytas jo diff" - -#: lazarusidestrconsts:lisdiskdiffrevertall -msgid "Reload from disk" -msgstr "Įkelti išnaujo" - -#: lazarusidestrconsts:lisdiskdiffignorediskchanges -msgid "Ignore disk changes" -msgstr "Ignoruoti pasikeitimus diske" - -#: lazarusidestrconsts:lisedtdefcurrentproject -msgid "Current Project" -msgstr "Veikiamasis projektas" - -#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory -msgid "Current Project Directory" -msgstr "Veikiamasis projekto katalogas" - -#: lazarusidestrconsts:lisedtdefprojectsrcpath -msgid "Project SrcPath" -msgstr "Projekto SrcPath" - -#: lazarusidestrconsts:lisedtdefprojectincpath -msgid "Project IncPath" -msgstr "Projekto IncPath" - -#: lazarusidestrconsts:lisedtdefprojectunitpath -msgid "Project UnitPath" -msgstr "Projekto UnitPath" - -#: lazarusidestrconsts:lisedtdefallpackages -msgid "All packages" -msgstr "Visi paketai" - -#: lazarusidestrconsts:lisedtdefsallprojects -msgid "All projects" -msgstr "Visi projektai" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi -msgid "set FPC mode to DELPHI" -msgstr "perjungti FPC veikseną į DELPHI" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetotp -msgid "set FPC mode to TP" -msgstr "perjungti FPC veikseną į TP" - -#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc -msgid "set FPC mode to GPC" -msgstr "perjungti FPC veikseną į GPC" - -#: lazarusidestrconsts:lisedtdefsetiocheckson -msgid "set IOCHECKS on" -msgstr "Įjungti IOCHECKS" - -#: lazarusidestrconsts:lisedtdefsetrangecheckson -msgid "set RANGECHECKS on" -msgstr "Įjungti RANGECHECKS" - -#: lazarusidestrconsts:lisedtdefsetoverflowcheckson -msgid "set OVERFLOWCHECKS on" -msgstr "Įjungti OVERFLOWCHECKS" - -#: lazarusidestrconsts:lisedtdefuselineinfounit -msgid "use LineInfo unit" -msgstr "naudoti LineInfo modulį" - -#: lazarusidestrconsts:lisedtdefuseheaptrcunit -msgid "use HeapTrc unit" -msgstr "naudoti HeapTrc modulį" - -#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition -msgid "Global Source Path addition" -msgstr "Priedas prie pradinio kodo globalaus katalogo" - -#: lazarusidestrconsts:lisexttoolfailedtoruntool -msgid "Failed to run tool" -msgstr "Nepavyko startuoti įrankį" - -#: lazarusidestrconsts:lisexttoolunabletorunthetool -msgid "Unable to run the tool %s%s%s:%s%s" -msgstr "Nepavyko startuoti įrankį %s%s%s:%s%s" - -#: lazarusidestrconsts:lisexttoolexternaltools -msgid "External tools" -msgstr "Išorės įrankiai" - -#: lazarusidestrconsts:lisexttoolremove -msgid "Remove" -msgstr "Pašalinti" - -#: lazarusidestrconsts:liskeepthemandcontinue -msgid "Keep them and continue" -msgstr "Jį palikti ir tęsti" - -#: lazarusidestrconsts:lisremovethem -msgid "Remove them" -msgstr "Pašalinti elementą" - -#: lazarusidestrconsts:lisexttoolmoveup -msgid "Up" -msgstr "Viršun" - -#: lazarusidestrconsts:lisexttoolmovedown -msgid "Down" -msgstr "Apačion" - -#: lazarusidestrconsts:lisexttoolmaximumtoolsreached -msgid "Maximum Tools reached" -msgstr "Perdaug įrankių" +#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension +msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" +msgstr "Rastas kitas failas tokiu pat vardu bei panašiu prievardžiu.%sFailas: %s%sNeaiškusis failas: %s%s%sPašalinti neaiškųjį failą?" #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Čia daugiausia gali būti %s įrankių." -#: lazarusidestrconsts:lisedtexttooledittool -msgid "Edit Tool" -msgstr "Keisti įrankį" +#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose +msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" +msgstr "Projekte jau yra modulis tokiu vardu %s%s%s.%sParinkite kitokį vardą." -#: lazarusidestrconsts:lisedtexttoolprogramfilename -msgid "Programfilename:" -msgstr "Programos failo vardas:" +#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 +msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" +msgstr "Rastas modulis tuo pačiu vardu kaip ir paketas:%s%s1. %s%s%s iš %s%s2. %s%s%s%s" -#: lazarusidestrconsts:lisedtexttoolparameters -msgid "Parameters:" -msgstr "Parametrai:" +#: lazarusidestrconsts:listhereisalreadyaformwiththename +msgid "There is already a form with the name %s%s%s" +msgstr "Forma tokiu vardu %s%s%s jau yra" + +#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile +msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." +msgstr "Paketas %s%s%s jau yra įkeltas%siš failo %s%s%s.%sŽvilgterėkit į \"Components -> Paketų grafas\".%sPakeitimas neįmanomas." + +#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus +msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." +msgstr "Modulis tokiu vardu %s%s%s jau yra. Paskalio identifikatoriai turi būti unikalūs." + +#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile +msgid "There is already an unit with this name.%sFile: %s" +msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s" + +#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename +msgid "There is already another component with the name %s%s%s." +msgstr "Jau yra komponentas tokiu vardu %s%s%s." + +#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename +msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" +msgstr "Aptiktas paketas jau naudojantis vardą %s%s%s.%sKonfliktinis paketas: %s%s%s%sFailas: %s%s%s" + +#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages +msgid "There is an unsaved package in the required packages. See package graph." +msgstr "Reikiamuose paketuose aptiktas neišsaugotas paketas. Žvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno +msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." +msgstr "Nenurodyta derintuvė.%sStabdos taškai neveiks kol nebus nurodyta derintuvė. Ji nurodoma menių esančiame derintuvės parinkčių dialoge." + +#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent +msgid "There was an error during writing the selected component %s:%s:%s%s" +msgstr "Rašant pažymėtąją komponentę %s:%s įvyko klaida:%s%s" + +#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe +msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" +msgstr "Konvertuojant pažymėtosios komponentės %s:%s dvejetainį srautą įvyko klaida:%s%s" + +#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli +msgid "There was an error while copying the component stream to clipboard:%s%s" +msgstr "Komponentę srautu kopijuojant į iškarpinę įvyko klaida:%s%s" + +#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage +msgid "This file is not in any loaded package." +msgstr "Failas nerastas nėviename įkeltame pakete" + +#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit +msgid "This file was automatically created by Lazarus. Do not edit!" +msgstr "Šį failą automatiškai sukūrė Lazarus. Nekeiskite jo!" + +#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe +msgid "This is a virtual package. It has no source yet. Please save the package first." +msgstr "Tai virtualus paketas. Jis kolkas dar neturi pirminio kodo. Todėl pirma išsaugokite paketą." + +#: lazarusidestrconsts:lisresourcefilecomment +msgid "This is an automatically generated lazarus resource file" +msgstr "Tai automatiškai sugeneruotas Lazarus resursų failas" + +#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents +msgid "This is the default package. Used only for components without a package. These components are outdated." +msgstr "Tai numatytasis paketas. Naudojamas komponenčių be paketo. Tos komponentės yra pasenusios." + +#: lazarusidestrconsts:lisbottomsiblingcomboboxhint +msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." +msgstr "" +"Tai kaimyninė komponentė, prie kurios bus pririštas apatinis kraštas.\n" +"Jei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisleftsiblingcomboboxhint +msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." +msgstr "" +"Tai kaimyninė komponentė, prie kurios bus pririštas kairysis kraštas.\n" +"Jei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisrightsiblingcomboboxhint +msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." +msgstr "" +"Tai kaimyninė komponentė, prie kurios bus pririštas dešinysis kraštas.\n" +"Jei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:listopsiblingcomboboxhint +msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." +msgstr "" +"Tai kaimyninė komponentė, prie kurios bus pririštas viršutinis kraštas.\n" +"Jei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc +msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" +msgstr "Panašu kad tai paskalio failas.%sRekomenduotina failo varde naudoti tik mažąsias raides, tokiu būdu išvengsite problemų, susijusių su įvairiomis failų sistemomis ar įvairiais kompiliatoriais.%sPervardyti mažosiomis raidėmis?" + +#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound +msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." +msgstr "Šis paketas įdiegtas, tačiau nerastas jo lpk failas. Pasyvinami visi jo komponentai. Ištaisykite tai." + +#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage +msgid "This source is only used to compile and install the package." +msgstr "Šis pirminis kodas skirtas tik paketo kompiliavimui ir diegimui." + +#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode +msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." +msgstr "Sakinį ištraukti neis.%sPrieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." + +#: lazarusidestrconsts:lisdebugoptionsfrmthread +msgid "Thread" +msgstr "Gija" + +#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired +msgid "Title and Filename required" +msgstr "Reikia pavadinimo ir failo vardo" + +#: lazarusidestrconsts:dlgpotitle +msgid "Title:" +msgstr "Antraštė:" + +#: lazarusidestrconsts:listodolistcaption +msgid "ToDo List" +msgstr "ToDo sąrašas" + +#: lazarusidestrconsts:listodolistoptions +msgid "ToDo options..." +msgstr "ToDo parinktys..." + +#: lazarusidestrconsts:lishinttoggleformunit +msgid "Toggle Form/Unit" +msgstr "Rodyti formą arba modulį" + +#: lazarusidestrconsts:srkmectogglemode +msgid "Toggle Mode" +msgstr "Perjungti veikseną" + +#: lazarusidestrconsts:liskmtogglebetweenunitandform +msgid "Toggle between Unit and Form" +msgstr "Persijungti tarp formos ir modulio" + +#: lazarusidestrconsts:lismenuviewtoggleformunit +msgid "Toggle form/unit view" +msgstr "Rodyti formą arba modulį" + +#: lazarusidestrconsts:liskmtoggleviewbreakpoints +msgid "Toggle view Breakpoints" +msgstr "Keisti \"Stabdos taškai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewcallstack +msgid "Toggle view Call Stack" +msgstr "Keisti \"Kreipčių dėklas\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewcodeexplorer +msgid "Toggle view Code Explorer" +msgstr "Keisti \"Kodo tyrinėtojas\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput +msgid "Toggle view Debugger Output" +msgstr "Keisti \"Derintuvės išvestis\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor +msgid "Toggle view Documentation Editor" +msgstr "Keisti \"Dokumentacijos redaktorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons +msgid "Toggle view IDE speed buttons" +msgstr "Keisti IKA sparčiųjų mygtukų matomumą" + +#: lazarusidestrconsts:liskmtoggleviewlocalvariables +msgid "Toggle view Local Variables" +msgstr "Keisti \"Vietiniai kintamieji\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewmessages +msgid "Toggle view Messages" +msgstr "Keisti \"Pranešimai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewobjectinspector +msgid "Toggle view Object Inspector" +msgstr "Keisti \"Objektų inspektorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewsearchresults +msgid "Toggle view Search Results" +msgstr "Keisti \"Ieškos rezultatai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewsourceeditor +msgid "Toggle view Source Editor" +msgstr "Keisti \"Pirminio kodo redaktorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewwatches +msgid "Toggle view Watches" +msgstr "Keisti \"Stebimieji\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewcomponentpalette +msgid "Toggle view component palette" +msgstr "Keisti komponenčių paletės matomumą" + +#: lazarusidestrconsts:liscodetempltoken +msgid "Token:" +msgstr "Leksema:" + +#: lazarusidestrconsts:lisctdefstools +msgid "Tools" +msgstr "Įrankiai" + +#: lazarusidestrconsts:srkmcattoolmenu +msgid "Tools menu commands" +msgstr "Meniu \"Įrankiai\" komandos" + +#: lazarusidestrconsts:dlgtooltipeval +msgid "Tooltip expression evaluation" +msgstr "Reiškinio įverčio informacinis langelis" + +#: lazarusidestrconsts:dlgtooltiptools +msgid "Tooltip symbol Tools" +msgstr "Simbolio įrankių informacinis langelis" + +#: lazarusidestrconsts:listopanchoring +msgid "Top anchoring" +msgstr "Viršaus prieraiša" + +#: lazarusidestrconsts:listopborderspacespinedithint +msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." +msgstr "" +"Viršutinės kraštinės plotis.\n" +"Ši reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą viršutinės kraštinės plotį" + +#: lazarusidestrconsts:listopspaceequally +msgid "Top space equally" +msgstr "Tolygiai rikiuoti pagal viršutinius kraštus" + +#: lazarusidestrconsts:dlgtoppos +msgid "Top:" +msgstr "Viršus:" + +#: lazarusidestrconsts:listops +msgid "Tops" +msgstr "Sutapdinti viršutinius kraštus" + +#: lazarusidestrconsts:dlgtrimtrailingspaces +msgid "Trim trailing spaces" +msgstr "Eilučių galuose pašalinti tarpo simbolius" + +#: lazarusidestrconsts:lismenutemplatetutorial +msgid "Tutorial" +msgstr "Pavyzdys" + +#: lazarusidestrconsts:dlgenvtype +msgid "Type" +msgstr "Tipas" + +#: lazarusidestrconsts:lisuidtype +msgid "Type:" +msgstr "Tipas:" + +#: lazarusidestrconsts:dlgcdtuppercase +msgid "UPPERCASE" +msgstr "Didžiosiomis raidėmis" + +#: lazarusidestrconsts:rslanguageukrainian +msgid "Ukrainian" +msgstr "Ukrainiečių" + +#: lazarusidestrconsts:lisunableconvertbinarystreamtotext +msgid "Unable convert binary stream to text" +msgstr "Nepavyko dvejetainį srautą konvertuoti į tekstą" + +#: lazarusidestrconsts:lisunablecopycomponentstoclipboard +msgid "Unable copy components to clipboard" +msgstr "Komponentę kopijuoti į iškarpinę nepavyko" + +#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith +msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." +msgstr "Nepavyko %s įdėti į projektą, nes projekte jau yra modulis tokiu pat vardu." + +#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably +msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "Resurso T%s:FORMDATA nepavyko įrašyti į resursų failą %s%s%s%s.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile +msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "Resursu faile %s%s%s%snepavyko įrašyti resursų antraštinį komentarą.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lisunabletobackupfileto +msgid "Unable to backup file %s%s%s to %s%s%s!" +msgstr "Nepavyko padaryti failo %s%s%s atsarginę kopiją į %s%s%s!" + +#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist +msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." +msgstr "Programos pirminiame kode nepavyko pakeisti automatiškai kuriamų formų sąrašą.%sSusimildami, pirmiausiai ištaisykit klaidas." + +#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions +msgid "Unable to clean up %s%s%s.%sPlease check permissions." +msgstr "Nepavyko apvalyti %s%s%s.%sPatinkrinkite leidimus." + +#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory +msgid "Unable to clean up destination directory" +msgstr "Nepavyko apvalyti tikslo katalogo" + +#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat +msgid "Unable to convert component text into binary format:%s%s" +msgstr "Nepavyko komponentės tekstą konvertuoti į dvejetainį formatą:%s%s" + +#: lazarusidestrconsts:lisunabletoconvertfileerror +msgid "Unable to convert file %s%s%s%sError: %s" +msgstr "Nepavyko konvertuoti į failą %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile +msgid "Unable to convert lfm to lrs and write lrs file." +msgstr "Nepavyko LFM konvertuoti į LRS ir sukurti LRS failą." + +#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream +msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" +msgstr "Nepavyko faile %s%s%s%s%sesantį tekstą konvertuoti į dvejetainį srautą. (%s)" + +#: lazarusidestrconsts:lisunabletocopyfile +msgid "Unable to copy file" +msgstr "Nepavyko kopijuoti failą" + +#: lazarusidestrconsts:lisunabletocopyfileto +msgid "Unable to copy file %s%s%s%sto %s%s%s" +msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s" + +#: lazarusidestrconsts:lisunabletocopyfileto2 +msgid "Unable to copy file %s%s%s%sto %s%s%s." +msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s." + +#: lazarusidestrconsts:lisunabletocreatebackupdirectory +msgid "Unable to create backup directory %s%s%s." +msgstr "Nepavyko sukurti atsarginių kopijų katalogo %s%s%s." + +#: lazarusidestrconsts:lispkgmangunabletocreatedirectory +msgid "Unable to create directory" +msgstr "Nepavyko sukurti katalogą" + +#: lazarusidestrconsts:lisunabletocreatedirectory2 +msgid "Unable to create directory %s%s%s" +msgstr "Nepavyko sukurti katalogą %s%s%s" + +#: lazarusidestrconsts:lisunabletocreatedirectory +msgid "Unable to create directory %s%s%s." +msgstr "Nepavyko sukurti katalogą %s%s%s." + +#: lazarusidestrconsts:lisunabletocreatefile +msgid "Unable to create file" +msgstr "Failas nesiduoda sukuriamas" + +#: lazarusidestrconsts:lisunabletocreatefile2 +msgid "Unable to create file %s%s%s" +msgstr "Nepavyko sukurti failą %s%s%s" + +#: lazarusidestrconsts:lisunabletocreatefilename +msgid "Unable to create file %s%s%s." +msgstr "Nepavyko sukurti failą %s%s%s." + +#: lazarusidestrconsts:lisunabletocreatefile3 +msgid "Unable to create file%s%s%s%s" +msgstr "Nepavyko sukurti failą%s%s%s%s" + +#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin +msgid "Unable to create new method. Plz fix the error shown in the message window." +msgstr "Nepavyko sukurti naują metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage +msgid "Unable to create output directory %s%s%s%sfor package %s." +msgstr "Nepavyko sukurti išvesties katalogą %s%s%s%s, skirtą paketui %s." + +#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage +msgid "Unable to create package source directory %s%s%s%sfor package %s." +msgstr "Nepavyko sukurti katalogą %s%s%s%s paketo %s pradiniam kodui." + +#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus +msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." +msgstr "Nepavyko sukurti Lazarus skirto tikslo katalogo:%s%s%s%s.%sŠis katalogas reikalingas naujam pakeistam IKA su įdiegtais jūsų paketais." + +#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer +msgid "Unable to create temporary lfm buffer." +msgstr "Nepavyko sukurti laikino lfm buferio." + +#: lazarusidestrconsts:lisunabletodeleteambiguousfile +msgid "Unable to delete ambiguous file %s%s%s" +msgstr "Nepavyko ištrinti neaiškųjį failą %s%s%s" + +#: lazarusidestrconsts:lispkgmangunabletodeletefilename +msgid "Unable to delete file" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:lispkgmangunabletodeletefile +msgid "Unable to delete file %s%s%s." +msgstr "Nepavyko ištrinti failą %s%s%s." + +#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage +msgid "Unable to delete old state file %s%s%s%sfor package %s." +msgstr "Nepavyko ištrinti senąjį būsenos failą %s%s%s%s, priklausantį paketui %s." + +#: lazarusidestrconsts:lisunabletofindinlfmstream +msgid "Unable to find %s in LFM Stream." +msgstr "LFM sraute nepavyko rasti %s." + +#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe +msgid "Unable to find a ResourceString section in this or any of the used units." +msgstr "Nepavyko rasti \"ResourceString\" sekcijos šiame ir kituose naudojamuose moduliuose" + +#: lazarusidestrconsts:lisunabletofindavalidclassnamein +msgid "Unable to find a valid classname in %s%s%s" +msgstr "%s%s%s nepavyko rasti klasę tinkamu vardu" + +#: lazarusidestrconsts:lisunabletofindfile +msgid "Unable to find file %s%s%s." +msgstr "Nerastas failas %s%s%s." + +#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption +msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" +msgstr "Failas %s%s%s nerastas.%sPatikrinkite kelius meniu%s\"Projektas -> Kompiliatoriaus parinktys... -> Keliai -> Kitų modulių failai\"" + +#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage +msgid "Unable to find method. Plz fix the error shown in the message window." +msgstr "Nepavyko rasti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass +msgid "Unable to find the unit of component class %s%s%s." +msgstr "Nepavyko rasti komponentės klasės %s%s%s modulio." + +#: lazarusidestrconsts:lisunabletogathereditorchanges +msgid "Unable to gather editor changes." +msgstr "Nepavyko susekti pokyčių redaktoriuje." + +#: lazarusidestrconsts:lisunabletogetsourcefordesigner +msgid "Unable to get source for designer." +msgstr "Nepavyko gauti pirminio kodo, skirto konstruktoriui." + +#: lazarusidestrconsts:lisdebugunabletoloadfile +msgid "Unable to load file" +msgstr "Nepavyko įkelti failą" + +#: lazarusidestrconsts:lisdebugunabletoloadfile2 +msgid "Unable to load file %s%s%s." +msgstr "Nepavyko įkelti failą %s%s%s." + +#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis +msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." +msgstr "Nepavyko įkelti senąjį resursų failą.%sResursų failas yra pirmasis įdedamasis failas \"initialization\" sekcijoje.%sPavyzdžiui: {$I %s.lrs}.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lispkgmangunabletoloadpackage +msgid "Unable to load package" +msgstr "Įkelti paketą nepavyko" + +#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits +msgid "Unable to load the component class %s%s%s, because it depends on itself." +msgstr "Įkelti komponentės klasės %s%s%s nepavyks, nes ji turi priklausomybę pačiai sau." + +#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades +msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." +msgstr "Konstruktorių atverti neis.%s Klasė %s nepaveldi vizualinės klasės, pavyzdžiui tokios kaip TForm ar TDataModule." + +#: lazarusidestrconsts:lispkgmangunabletoopenthepackage +msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." +msgstr "Nepavyko įkelti paketą %s%s%s.%sŠis paketas paženklintas diegimui." + +#: lazarusidestrconsts:lisunabletoreadfile +msgid "Unable to read file" +msgstr "Nepavyko įkelti failą" + +#: lazarusidestrconsts:lisunabletoreadfile2 +msgid "Unable to read file %s%s%s!" +msgstr "Nepavyko skaityti iš failo %s%s%s!" + +#: lazarusidestrconsts:lisunabletoreadfileerror +msgid "Unable to read file %s%s%s%sError: %s" +msgstr "Nepavyko skaityti iš failo %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletoreadfilename +msgid "Unable to read file %s%s%s." +msgstr "Nepavyko įkelti failą %s%s%s." + +#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror +msgid "Unable to read package file %s%s%s.%sError: %s" +msgstr "Nepavyko skaityti paketo failą %s%s%s.%sKlaida: %s" + +#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror +msgid "Unable to read state file %s of project %s%sError: %s" +msgstr "Nepavyko įkelti būsenos failą %s, priklausantį projektui%s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror +msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" +msgstr "Nepavyko įkelti būsenos failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletoremoveoldbackupfile +msgid "Unable to remove old backup file %s%s%s!" +msgstr "Nepavyko ištrinti seną atsarginės kopijos failą %s%s%s!" + +#: lazarusidestrconsts:lisunabletorenameambiguousfileto +msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" +msgstr "Nepavyko neaiškųjį failą %s%s%s%spervardyti į %s%s%s" + +#: lazarusidestrconsts:lisunabletorenamefile +msgid "Unable to rename file" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:lisunabletorenamefileto +msgid "Unable to rename file %s%s%s to %s%s%s!" +msgstr "Nepavyko pervardyti failą %s%s%s į %s%s%s!" + +#: lazarusidestrconsts:lisunabletorenamefileto2 +msgid "Unable to rename file %s%s%s%sto %s%s%s." +msgstr "Nepavyko pervardyti failą %s%s%s%sį %s%s%s." + +#: lazarusidestrconsts:lisunabletorenameforminsource +msgid "Unable to rename form in source." +msgstr "Nepavyko pirminiame kode pervardyti formą." + +#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag +msgid "Unable to rename method. Plz fix the error shown in the message window." +msgstr "Nepavyko pervardyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletorenamevariableinsource +msgid "Unable to rename variable in source." +msgstr "Nepavyko pirminiame kode pervardyti kintamąjį" + +#: lazarusidestrconsts:lisexttoolunabletorunthetool +msgid "Unable to run the tool %s%s%s:%s%s" +msgstr "Nepavyko startuoti įrankį %s%s%s:%s%s" + +#: lazarusidestrconsts:lisunabletosavefile +msgid "Unable to save file %s%s%s" +msgstr "Nepavyko išsaugoti failą %s%s%s" + +#: lazarusidestrconsts:lisunabletosetanchorsidecontrol +msgid "Unable to set AnchorSide Control" +msgstr "Kraštą pririšti prie komponentės neįmanoma" + +#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage +msgid "Unable to show method. Plz fix the error shown in the message window." +msgstr "Nepavyko parodyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletostreamt +msgid "Unable to stream %s:T%s." +msgstr "Nepavyko siųsti srautu %s:T%s." + +#: lazarusidestrconsts:lisunabletostreamselectedcomponents +msgid "Unable to stream selected components" +msgstr "Pažymėtųjų komponenčių persiųsti srautu nepavyko." + +#: lazarusidestrconsts:lisunabletostreamselectedcomponents2 +msgid "Unable to stream selected components." +msgstr "Nepavyko pasirinktas komponentes nusiųsti srautu." + +#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext +msgid "Unable to transform binary component stream of %s:T%s into text." +msgstr "Nepavyko dvejetainį komponento %s:T%s srautą transformuoti į tekstą." + +#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource +msgid "Unable to update CreateForm statement in project source" +msgstr "Nepavyko projekto pirminiame kode atnaujinti sakinį \"CreateStatement\"" + +#: lazarusidestrconsts:lisunabletowrite +msgid "Unable to write %s%s%s%s%s." +msgstr "Nepavyko rašyti į %s%s%s%s%s." + +#: lazarusidestrconsts:lisunabletowritefile +msgid "Unable to write file" +msgstr "Nepavyko rašyti į failą" + +#: lazarusidestrconsts:lisunabletowritefile2 +msgid "Unable to write file %s%s%s" +msgstr "Nepavyko rašyti į failą %s%s%s" + +#: lazarusidestrconsts:lisunabletowritefileerror +msgid "Unable to write file %s%s%s%sError: %s" +msgstr "Nepavyko rašyti į failą %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletowritefilename +msgid "Unable to write file %s%s%s." +msgstr "Nepavyko rašyti į failą %s%s%s." + +#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror +msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" +msgstr "Nepavyko paketą %s%s%s%sįrašyti į failą %s%s%s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror +msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" +msgstr "Nepavyko rašyti į failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" + +#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror +msgid "Unable to write state file for project %s%sError: %s" +msgstr "Nepavyko rašyti į projektui %s priklausantį failą.%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletowritetofile2 +msgid "Unable to write to file %s%s%s" +msgstr "Neįmanoma rašyti į failą %s%s%s" + +#: lazarusidestrconsts:lisunabletowritetofile +msgid "Unable to write to file %s%s%s!" +msgstr "Nepavyko rašyti į failą %s%s%s!" + +#: lazarusidestrconsts:dlguncertopt +msgid "Uncertain Optimizations" +msgstr "Neužtikrinta optimizacija" + +#: lazarusidestrconsts:lismenuuncommentselection +msgid "Uncomment selection" +msgstr "Nuimti komentarą nuo pažymetojo" + +#: lazarusidestrconsts:liscodetoolsdefsundefine +msgid "Undefine" +msgstr "Padaryti neapibrėžtu" + +#: lazarusidestrconsts:liscodetoolsdefsundefineall +msgid "Undefine All" +msgstr "Visus padaryti neapibrėžtais" + +#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse +msgid "Undefine Recurse" +msgstr "Rekursyviai padaryti neapibrėžtu" + +#: lazarusidestrconsts:dlgedunder +msgid "Underline" +msgstr "Pabraukimas" + +#: lazarusidestrconsts:lismenuundo +msgid "Undo" +msgstr "Grąžinti" + +#: lazarusidestrconsts:dlgundoaftersave +msgid "Undo after save" +msgstr "Išsaugojus grąžinimas neišvalomas" + +#: lazarusidestrconsts:dlgundolimit +msgid "Undo limit" +msgstr "Grąžinimų riba" + +#: lazarusidestrconsts:srkmecblockunindent +msgid "Unindent block" +msgstr "Naikinti bloko įtrauką" + +#: lazarusidestrconsts:lismenuunindentselection +msgid "Unindent selection" +msgstr "Naikinti įtrauką pažymėjime" + +#: lazarusidestrconsts:lispckedituninstall +msgid "Uninstall" +msgstr "Išdiegti" + +#: lazarusidestrconsts:lispckexpluninstallonnextstart +msgid "Uninstall on next start" +msgstr "Išdiegti kitąkart startuojant" + +#: lazarusidestrconsts:lispkgmanguninstallpackage2 +msgid "Uninstall package %s?" +msgstr "Išdiegti paketą %s?" + +#: lazarusidestrconsts:lispkgmanguninstallpackage +msgid "Uninstall package?" +msgstr "Išdiegti paketą?" + +#: lazarusidestrconsts:lisuninstallselection +msgid "Uninstall selection" +msgstr "Išdiegti pažymėtą" + +#: lazarusidestrconsts:lispkgfiletypeunit +msgid "Unit" +msgstr "Modulis" + +#: lazarusidestrconsts:lisunithaschangedsave +msgid "Unit %s%s%s has changed. Save?" +msgstr "Modulis %s%s%s pakeistas. Išsaugoti?" + +#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage +msgid "Unit %s%s%s was removed from package" +msgstr "Modulis %s%s%s pašalintas iš paketo" + +#: lazarusidestrconsts:lisa2punitfilename2 +msgid "Unit File Name:" +msgstr "Modulio failo vardas:" + +#: lazarusidestrconsts:uemshowunitinfo +msgid "Unit Info" +msgstr "Informacija apie modulį" + +#: lazarusidestrconsts:lisa2punitnameinvalid +msgid "Unit Name Invalid" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lisa2punitname +msgid "Unit Name:" +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lisaf2punitname +msgid "Unit Name: " +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lisunitoutputdirectory +msgid "Unit Output directory" +msgstr "Modulio išvesties katalogas" + +#: lazarusidestrconsts:lispkgdefsunitpath +msgid "Unit Path" +msgstr "Kelias iki modulio" + +#: lazarusidestrconsts:dlgcounitstyle +msgid "Unit Style:" +msgstr "Modulio stilius:" + +#: lazarusidestrconsts:dlgunitdepcaption +msgid "Unit dependencies" +msgstr "Modulio priklausomybės" + +#: lazarusidestrconsts:lisa2punitfilename +msgid "Unit file name:" +msgstr "Modulio failo vardas:" + +#: lazarusidestrconsts:lisunitidentifierexists +msgid "Unit identifier exists" +msgstr "Modulio identifikatorius egzistuoja" + +#: lazarusidestrconsts:lisprojaddunitnamealreadyexists +msgid "Unit name already exists" +msgstr "Modulio vardas jau egzistuoja" + +#: lazarusidestrconsts:lisunitnamebeginswith +msgid "Unit name begins with ..." +msgstr "Modulio vardas prasideda..." + +#: lazarusidestrconsts:lisunitnamecontains +msgid "Unit name contains ..." +msgstr "Modulio varde yra..." + +#: lazarusidestrconsts:lisunitnotfound +msgid "Unit not found" +msgstr "Modulis nerastas" + +#: lazarusidestrconsts:lispkgsysunitnotfound +msgid "Unit not found: %s%s%s" +msgstr "Modulis nerastas: %s%s%s" + +#: lazarusidestrconsts:dlgunitoutp +msgid "Unit output directory (-FU):" +msgstr "Modulio išvesties katalogas (-FU):" + +#: lazarusidestrconsts:lisunitpaths +msgid "Unit paths" +msgstr "Modulių keliai" + +#: lazarusidestrconsts:lisunitlfmfile +msgid "Unit: %s%sLFM file: %s" +msgstr "Modulis: %s%sLFM failas: %s" + +#: lazarusidestrconsts:lisa2punitnamealreadyexists +msgid "Unitname already exists" +msgstr "Modulio vardas egzistuoja" + +#: lazarusidestrconsts:lisunitnamealreadyexistscap +msgid "Unitname already in project" +msgstr "Modulio vardas jau paminėtas projekte" + +#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni +msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" +msgstr "Modulio ir failo vardai nesutampa.%Pavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"." + +#: lazarusidestrconsts:lispeunitname +msgid "Unitname:" +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lisunitsnotfound2 +msgid "Units not found" +msgstr "Moduliai nerasti" + +#: lazarusidestrconsts:lismenuviewunits +msgid "Units..." +msgstr "Moduliai..." + +#: lazarusidestrconsts:srvk_unknown +msgid "Unknown" +msgstr "Nežinomas" + +#: lazarusidestrconsts:lispkgmangunsavedpackage +msgid "Unsaved package" +msgstr "Neišsaugotas paketas" + +#: lazarusidestrconsts:dlgupword +msgid "Up" +msgstr "Viršun" + +#: lazarusidestrconsts:lisceoupdate +msgid "Update" +msgstr "Atnaujinimas" + +#: lazarusidestrconsts:lispckoptsupdaterebuild +msgid "Update/Rebuild" +msgstr "Atnaujinti/Daryti" + +#: lazarusidestrconsts:lismenuuppercaseselection +msgid "Uppercase selection" +msgstr "Pažymėjime visas raides didžiosiomis" + +#: lazarusidestrconsts:lispckoptsusage +msgid "Usage" +msgstr "Naudojimas" + +#: lazarusidestrconsts:dlgcoansistr +msgid "Use Ansi Strings" +msgstr "Naudoti ANSI eilutes" + +#: lazarusidestrconsts:dlgpouseappbundle +msgid "Use Application Bundle for running and debugging (darwin only)" +msgstr "Startui ir derinimui naudoti programą-rišulį (tik dėl Darwin)" + +#: lazarusidestrconsts:lisuseexcludefilter +msgid "Use Exclude Filter" +msgstr "Naudoti neįtraukimo filtrą" + +#: lazarusidestrconsts:dlgcoheaptrc +msgid "Use Heaptrc Unit" +msgstr "Naudoti \"Heaptrc\" modulį" + +#: lazarusidestrconsts:lisuseincludefilter +msgid "Use Include Filter" +msgstr "Naudoti įterpimo filtrą" + +#: lazarusidestrconsts:dlgusecustomconfig +msgid "Use addional Compiler Config File" +msgstr "Naudoti papildomą kompiliatoriaus nustatymų failą" + +#: lazarusidestrconsts:dlgedusedefcolor +msgid "Use default color" +msgstr "Naudoti numatytą spalvą" + +#: lazarusidestrconsts:dlgrunousedisplay +msgid "Use display" +msgstr "Dirbti ekrane" + +#: lazarusidestrconsts:dlguselaunchingapp +msgid "Use launching application" +msgstr "Naudoti paleidžiančiąją programą" + +#: lazarusidestrconsts:dlgpousemanifest +msgid "Use manifest file to enable themes (windows only)" +msgstr "Naudoti manifest failą temų įgalinimui (tik dėl Windows)" + +#: lazarusidestrconsts:dlgusefpccfg +msgid "Use standard Compiler Config File (fpc.cfg)" +msgstr "Naudoti standartinį kompiliatoriaus nustatymų failą (fpc.cfg)" + +#: lazarusidestrconsts:dlgusesyntaxhighlight +msgid "Use syntax highlight" +msgstr "Paryškinti sintaksę" + +#: lazarusidestrconsts:lispkgmanguseunit +msgid "Use unit" +msgstr "Naudoti modulį" + +#: lazarusidestrconsts:rsiwpusewindowmanagersetting +msgid "Use windowmanager setting" +msgstr "Naudoti langų tvarkytuvės nuostatas" + +#: lazarusidestrconsts:srkmecuserfirst +msgid "User First" +msgstr "Pirma naudotojas" + +#: lazarusidestrconsts:dlgedcustomext +msgid "User defined extension" +msgstr "Naudotojo nurodytas prievardis" + +#: lazarusidestrconsts:dlgcustomext +msgid "User defined extension (.pp.xxx)" +msgstr "Naudotojo nurodytas prievardis (.pp.xxx)" + +#: lazarusidestrconsts:dlgrunouseroverrides +msgid "User overrides" +msgstr "Naudotojo pakeitimai" + +#: lazarusidestrconsts:dlgvaluecolor +msgid "Value" +msgstr "Reikšmė" + +#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths +msgid "Value as File Paths" +msgstr "Reikšmė failų kelių pavidalu" + +#: lazarusidestrconsts:liscodetoolsdefsvalueastext +msgid "Value as Text" +msgstr "Reikšmė teksto pavidalu" + +#: lazarusidestrconsts:dlgrunovariable +msgid "Variable" +msgstr "Kintamasis" + +#: lazarusidestrconsts:lisctdefvariablename +msgid "Variable Name" +msgstr "Kintamojo vardas" + +#: lazarusidestrconsts:dlgcdtvariableprefix +msgid "Variable prefix" +msgstr "Kintamojo prefiksas" + +#: lazarusidestrconsts:liscodetoolsdefsvariable +msgid "Variable:" +msgstr "Kintamasis:" + +#: lazarusidestrconsts:lisctdefvariable +msgid "Variable: %s" +msgstr "Kintamasis: %s" + +#: lazarusidestrconsts:dlgverbosity +msgid "Verbosity during compilation:" +msgstr "Pranešimų gausa kompiliuojant:" + +#: lazarusidestrconsts:lisversion +msgid "Version" +msgstr "Versija" + +#: lazarusidestrconsts:versioninfotitle +msgid "Version Info" +msgstr "Versijos informacija" + +#: lazarusidestrconsts:lisvertical +msgid "Vertical" +msgstr "Vertikaliai " + +#: lazarusidestrconsts:dlggridyhint +msgid "Vertical grid step size" +msgstr "Vertikalūs tarpai tarp tinklelio taškų" + +#: lazarusidestrconsts:lismenuviewanchoreditor +msgid "View Anchor Editor" +msgstr "Rodyti prieraišų redaktorių" + +#: lazarusidestrconsts:uemviewcallstack +msgid "View Call Stack" +msgstr "Rodyti kreipčių dėklą" + +#: lazarusidestrconsts:srkmectogglecodeexpl +msgid "View Code Explorer" +msgstr "Rodyti kodo tyrinėtoją" + +#: lazarusidestrconsts:lismenuviewcomponentpalette +msgid "View Component Palette" +msgstr "Rodyti komponenčių paletę" + +#: lazarusidestrconsts:srkmectogglelazdoc +msgid "View Documentation Editor" +msgstr "Rodyti dokumentacijos redaktorių" + +#: lazarusidestrconsts:lishintviewforms +msgid "View Forms" +msgstr "Rodyti formas" + +#: lazarusidestrconsts:lismenuviewidespeedbuttons +msgid "View IDE speed buttons" +msgstr "Rodyti IKA sparčiuosius mygtukus" + +#: lazarusidestrconsts:lismenuviewjumphistory +msgid "View Jump-History ..." +msgstr "Rodyti peršokimų istoriją..." + +#: lazarusidestrconsts:srkmectoggleobjectinsp +msgid "View Object Inspector" +msgstr "Rodyti objektų inspektorių" + +#: lazarusidestrconsts:lispckeditviewpackgesource +msgid "View Package Source" +msgstr "Rodyti paketo pirminį kodą" + +#: lazarusidestrconsts:lisviewprojectunits +msgid "View Project Units" +msgstr "Projekto moduliai" + +#: lazarusidestrconsts:srkmectogglesearchresults +msgid "View Search Results" +msgstr "Rodyti ieškos rezultatus" + +#: lazarusidestrconsts:lismenuviewsource +msgid "View Source" +msgstr "Rodyti pirminį kodą" + +#: lazarusidestrconsts:lisviewsourcelfm +msgid "View Source (.lfm)" +msgstr "Rodyti pirminį kodą (.lfm)" + +#: lazarusidestrconsts:srkmectogglesourceeditor +msgid "View Source Editor" +msgstr "Rodyti pirminio kodo redaktorių" + +#: lazarusidestrconsts:lismenuviewprojecttodos +msgid "View ToDo List ..." +msgstr "Rodyti ToDo sąrašą..." + +#: lazarusidestrconsts:lismenuviewunitdependencies +msgid "View Unit Dependencies" +msgstr "Rodyti modulio priklausomybes" + +#: lazarusidestrconsts:liskmviewunitinfo +msgid "View Unit Info" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:lismenuviewunitinfo +msgid "View Unit Information" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:lishintviewunits +msgid "View Units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:srkmecviewanchoreditor +msgid "View anchor editor" +msgstr "Rodyti prieraišų redaktorių" + +#: lazarusidestrconsts:srkmectogglebreakpoints +msgid "View breakpoints" +msgstr "Rodyti stabdos taškus" + +#: lazarusidestrconsts:srkmectogglecallstack +msgid "View call stack" +msgstr "Rodyti kreipčių dėklą" + +#: lazarusidestrconsts:srkmectogglecodebrowser +msgid "View code browser" +msgstr "Rodyti kodo naršyklę" + +#: lazarusidestrconsts:srkmectogglecomppalette +msgid "View component palette" +msgstr "Rodyti komponenčių paletę" + +#: lazarusidestrconsts:srkmectoggledebuggerout +msgid "View debugger output" +msgstr "Rodyti derintuvės išvestį" + +#: lazarusidestrconsts:srkmecviewforms +msgid "View forms" +msgstr "Rodyti formas" + +#: lazarusidestrconsts:liskmviewjumphistory +msgid "View jump history" +msgstr "Rodyti peršokimų istoriją" + +#: lazarusidestrconsts:srkmectogglelocals +msgid "View local variables" +msgstr "Rodyti vietinius kintamuosius" + +#: lazarusidestrconsts:srkmcatviewmenu +msgid "View menu commands" +msgstr "Meniu \"Rodymas\" komandos" + +#: lazarusidestrconsts:srkmectogglemessages +msgid "View messages" +msgstr "Rodyti pranešimus" + +#: lazarusidestrconsts:liskmviewprojecttodolist +msgid "View project ToDo list" +msgstr "Rodyti projekto ToDo sąrašą" + +#: lazarusidestrconsts:dlgmainviewforms +msgid "View project forms" +msgstr "Rodyti projekto formas" + +#: lazarusidestrconsts:liskmviewprojectoptions +msgid "View project options" +msgstr "Rodyti projekto parinktis" + +#: lazarusidestrconsts:liskmviewprojectsource +msgid "View project source" +msgstr "Rodyti projekto pirminį kodą" + +#: lazarusidestrconsts:dlgmainviewunits +msgid "View project units" +msgstr "Rodyti projekto modulius" + +#: lazarusidestrconsts:srkmecviewunitdependencies +msgid "View unit dependencies" +msgstr "Rodyti modulio priklausomybes" + +#: lazarusidestrconsts:srkmecviewunitinfo +msgid "View unit information" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:srkmecviewunits +msgid "View units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:srkmectogglewatches +msgid "View watches" +msgstr "Rodyti stebimuosius" + +#: lazarusidestrconsts:lishlpoptsviewers +msgid "Viewers" +msgstr "Žiūriklės" + +#: lazarusidestrconsts:lispkgfiletypevirtualunit +msgid "Virtual Unit" +msgstr "Virtualus modulis" + +#: lazarusidestrconsts:lisaf2pisvirtualunit +msgid "Virtual unit (source is not in package)" +msgstr "Virtualus modulis (pakete nėra pirminio kodo)" + +#: lazarusidestrconsts:dlgvisiblegutter +msgid "Visible gutter" +msgstr "Kairioji paraštė matoma" + +#: lazarusidestrconsts:dlgvisiblerightmargin +msgid "Visible right margin" +msgstr "Dešinioji paraštė matoma" + +#: lazarusidestrconsts:dlgambigwarn +msgid "Warn on compile" +msgstr "Perspėti prieš kompiliuojant" + +#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena +msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." +msgstr "Perspėjimas: papildomo kompiliatoriaus nustatymų failo vardas yra toks pat kaip ir FreePascal ieškomo standartinio nustatymų failo. Dėl to, praleidžiant standartinį nustatymų failą, bus analizuojamas TIK papildomas nustatymų failas." + +#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject +msgid "Warning: The file %s%s%s%sbelongs to the current project." +msgstr "Dėmesio: failas %s%s%s%s jau priklauso šiam projektui." + +#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis +msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" +msgstr "Dėmesio: rastas neaiškus failas: %s%s%s. Pirminio kodo failas: %s%s%s" + +#: lazarusidestrconsts:liswlwatchlist +msgid "Watch list" +msgstr "Stebimų sąrašas" + +#: lazarusidestrconsts:lismenuviewwatches +msgid "Watches" +msgstr "Stebimieji" + +#: lazarusidestrconsts:dlgautocreatenewforms +msgid "When creating new forms, add them to auto-created forms" +msgstr "Kuriant nauja formą, ją įdėti į automatiškai kuriamų formų sąrašą" + +#: lazarusidestrconsts:lisceowhenswitchingfile +msgid "When switching file in source editor" +msgstr "Perjungiant failą kodo redaktoriuje" + +#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor +msgid "When this file is active in source editor ..." +msgstr "Kai šis failas pirminio kodo redaktoriuje aktyvus..." + +#: lazarusidestrconsts:lisfindfilewhere +msgid "Where" +msgstr "Kur" + +#: lazarusidestrconsts:dlgwholewordsonly +msgid "Whole Words Only" +msgstr "Tik ištisų žodžių" + +#: lazarusidestrconsts:lisfindfilewholewordsonly +msgid "Whole words only" +msgstr "Tik visų žodžių" + +#: lazarusidestrconsts:dlgwidthpos +msgid "Width:" +msgstr "Plotis:" + +#: lazarusidestrconsts:lisdebugoptionsfrmwindow +msgid "Window" +msgstr "Langas" + +#: lazarusidestrconsts:dlgwinpos +msgid "Window Positions" +msgstr "Langų pozicijos" + +#: lazarusidestrconsts:dlgwindows +msgid "Windows" +msgstr "Langai" + +#: lazarusidestrconsts:lislazbuildwithstaticpackages +msgid "With Packages" +msgstr "Su paketais" + +#: lazarusidestrconsts:liswithrequiredpackages +msgid "With required packages" +msgstr "Su reikiamais paketais" + +#: lazarusidestrconsts:liswordatcursorincurrenteditor +msgid "Word at cursor in current editor" +msgstr "Žodis ties žymekliu veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:srkmecwordcompletion +msgid "Word completion" +msgstr "Užbaigti žodį" + +#: lazarusidestrconsts:dlgwordspolicies +msgid "Words" +msgstr "Žodžiai" + +#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2 +msgid "Working Directory (Leave empty for file path)" +msgstr "Darbinis katalogas (palikite tuščią failo keliui)" #: lazarusidestrconsts:lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Darbinis katalogas:" -#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages -msgid "Scan output for Free Pascal Compiler messages" -msgstr "Išvestyje ieškoti FreePascalCompiler pranešimų" +#: lazarusidestrconsts:dlgroworkingdirectory +msgid "Working directory" +msgstr "Darbinis katalogas" -#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages -msgid "Scan output for make messages" -msgstr "Išvestyje ieškoti make pranešimų" - -#: lazarusidestrconsts:lisedtexttoolkey -msgid "Key" -msgstr "Klavišas" - -#: lazarusidestrconsts:lisedtexttoolctrl -msgid "Ctrl" -msgstr "Ctrl" - -#: lazarusidestrconsts:lisedtexttoolalt -msgid "Alt" -msgstr "Alt" - -#: lazarusidestrconsts:lisedtexttoolshift -msgid "Shift" -msgstr "Shift" - -#: lazarusidestrconsts:lisedtexttoolmacros -msgid "Macros" -msgstr "Makrokomandos" +#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath +msgid "Working directory (Leave empty for file path)" +msgstr "Darbinis katalogas (palikite tuščią failo keliui)" #: lazarusidestrconsts:lisworkingdirectoryforbuilding msgid "Working directory for building" @@ -7711,45 +9595,281 @@ msgstr "Darbinis katalogas darant" msgid "Working directory for run" msgstr "Darbinis katalogas startuojant" -#: lazarusidestrconsts:lisconfigurebuild -msgid "Configure Build %s" -msgstr "Derinti %s daryklę" +#: lazarusidestrconsts:liswriteerror +msgid "Write Error" +msgstr "Rašymo klaida" -#: lazarusidestrconsts:lisedtexttoolinsert -msgid "Insert" -msgstr "Įterpti" +#: lazarusidestrconsts:dlgwritefpclogo +msgid "Write an FPC logo" +msgstr "Įrašyti FPC logotipą" -#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired -msgid "Title and Filename required" -msgstr "Reikia pavadinimo ir failo vardo" +#: lazarusidestrconsts:liscodetoolsdefswriteerror +msgid "Write error" +msgstr "Klaida rašant" -#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename -msgid "A valid tool needs at least a title and a filename." -msgstr "Įrankiui mažų mažiausia reikia pavadinimo ir failo vardo." +#: lazarusidestrconsts:dlgcdtwriteprefix +msgid "Write prefix" +msgstr "\"Write\" prefiksas" -#: lazarusidestrconsts:lisfindfiletexttofind -msgid "Text to find:" -msgstr "Ieškoti teksto:" +#: lazarusidestrconsts:lisxmlfiles +msgid "XML files" +msgstr "XML failai" -#: lazarusidestrconsts:lisfindfilecasesensitive -msgid "Case sensitive" -msgstr "Svarbu raidžių lygis" +#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling +msgid "You can not build lazarus while debugging or compiling." +msgstr "Derinimo ar kompiliavimo metu negalima daryti Lazarus." -#: lazarusidestrconsts:lisfindfilewholewordsonly -msgid "Whole words only" -msgstr "Tik visų žodžių" +#: lazarusidestrconsts:dlgdoesnotexist +msgid "\" does not exist." +msgstr "\" neegzistuoja" -#: lazarusidestrconsts:lisfindfileregularexpressions -msgid "Regular expressions" -msgstr "Reguliarusis reiškinys" +#: lazarusidestrconsts:uefilerotext2 +msgid "\" is not writable." +msgstr "\" nėra skirtas rašymui" -#: lazarusidestrconsts:lisfindfilemultiline -msgid "Multiline pattern" -msgstr "Kelių eilučių modelis" +#: lazarusidestrconsts:srkmecabortbuild +msgid "abort build" +msgstr "nutraukti darymą" -#: lazarusidestrconsts:lisfindfilewhere -msgid "Where" -msgstr "Kur" +#: lazarusidestrconsts:srkmecaddbreakpoint +msgid "add break point" +msgstr "padėti stabdos tašką" + +#: lazarusidestrconsts:srkmecaddwatch +msgid "add watch" +msgstr "stebėti" + +#: lazarusidestrconsts:srvk_apps +msgid "application key" +msgstr "programos klavišas" + +#: lazarusidestrconsts:lisoipautoinstalldynamic +msgid "auto install dynamic" +msgstr "automatiškai diegti kaip dinamišką" + +#: lazarusidestrconsts:lisoipautoinstallstatic +msgid "auto install static" +msgstr "automatiškai diegti kaip statišką" + +#: lazarusidestrconsts:lisbegins +msgid "begins" +msgstr "prasideda" + +#: lazarusidestrconsts:srkmecbuildall +msgid "build all files of program/project" +msgstr "daryti visus programos/projekto failus" + +#: lazarusidestrconsts:srkmecbuildfile +msgid "build file" +msgstr "daryti failą" + +#: lazarusidestrconsts:srkmecbuild +msgid "build program/project" +msgstr "daryti programą/projektą" + +#: lazarusidestrconsts:dlglefttopclr +msgid "color for left, top" +msgstr "Apatinės bei viršutinės spalva" + +#: lazarusidestrconsts:dlgrightbottomclr +msgid "color for right, bottom" +msgstr "Kairiosios bei dešiniosios spalva" + +#: lazarusidestrconsts:srkmeccompileroptions +msgid "compiler options" +msgstr "kompiliatoriaus parinktys" + +#: lazarusidestrconsts:liscodetoolsdefscompilerpath +msgid "compiler path" +msgstr "Kompiliatoriaus programa" + +#: lazarusidestrconsts:srkmecconfigbuildfile +msgid "config build file" +msgstr "Derinti failo darytuvę" + +#: lazarusidestrconsts:liscontains +msgid "contains" +msgstr "yra" + +#: lazarusidestrconsts:liscustomoptions +msgid "custom options" +msgstr "naudotojo parinktys" + +#: lazarusidestrconsts:liscodefault +msgid "default (%s)" +msgstr "numatytas (%s)" + +#: lazarusidestrconsts:srkmecevaluate +msgid "evaluate/modify" +msgstr "įvertinti/modifikuoti" + +#: lazarusidestrconsts:lisfilewheredebugoutputiswritten +msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." +msgstr "Failas, į kurį bus rašoma derinimo išvestis. Jei jis nenurodytas, tai derinimo išvestis bus spauzdinama konsolėje." + +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + +#: lazarusidestrconsts:lisuidinproject +msgid "in Project:" +msgstr "Projekte:" + +#: lazarusidestrconsts:lisfriinallopenpackagesandprojects +msgid "in all open packages and projects" +msgstr "visuose atvertuose paketuose ir projektuose" + +#: lazarusidestrconsts:lisfriincurrentunit +msgid "in current unit" +msgstr "šiame modulyje" + +#: lazarusidestrconsts:lisfriinmainproject +msgid "in main project" +msgstr "pagrindiniame projekte" + +#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit +msgid "in project/package owning current unit" +msgstr "projekte/pakete, kuriam priklauso šis modulis" + +#: lazarusidestrconsts:lisincludepath +msgid "include path" +msgstr "kelias iki įterpinių" + +#: lazarusidestrconsts:srkmecinspect +msgid "inspect" +msgstr "inspektuoti" + +#: lazarusidestrconsts:lisoipinstalleddynamic +msgid "installed dynamic" +msgstr "įdiektas kaip dinaminis" + +#: lazarusidestrconsts:lisoipinstalledstatic +msgid "installed static" +msgstr "įdiegtas kaip statinis" + +#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename +msgid "invalid Compiler filename" +msgstr "Klaidingas kompiliatoriaus failo vardas" + +#: lazarusidestrconsts:lislazarusoptionsprojectfilename +msgid "lazarus [options] " +msgstr "lazarus [parinktys] " + +#: lazarusidestrconsts:srvk_lwin +msgid "left windows key" +msgstr "kairysis windows klavišas" + +#: lazarusidestrconsts:lislibrarypath +msgid "library path" +msgstr "kelias iki bibliotekos" + +#: lazarusidestrconsts:lislinkeroptions +msgid "linker options" +msgstr "saistyklės parinktys" + +#: lazarusidestrconsts:dlgcdtlower +msgid "lowercase" +msgstr "Mažosiomis raidėmis" + +#: lazarusidestrconsts:lisprojectmacrounitpath +msgid "macro ProjectUnitPath" +msgstr "makrokomanda ProjectUnitPath" + +#: lazarusidestrconsts:lisoipmissing +msgid "missing" +msgstr "trūksta" + +#: lazarusidestrconsts:lisoipmodified +msgid "modified" +msgstr "pakeistas" + +#: lazarusidestrconsts:lisuidno +msgid "no" +msgstr "ne" + +#: lazarusidestrconsts:dlgnoautomaticrenaming +msgid "no automatic renaming" +msgstr "Automatiškai nepervardyti" + +#: lazarusidestrconsts:lisnoname +msgid "noname" +msgstr "bevardis" + +#: lazarusidestrconsts:lisnone2 +msgid "none" +msgstr "nieks" + +#: lazarusidestrconsts:liscodetoolsdefsnoneselected +msgid "none selected" +msgstr "nėra pažymėtų elementų" + +#: lazarusidestrconsts:lisobjectpath +msgid "object path" +msgstr "kelias iki objekto" + +#: lazarusidestrconsts:lisor +msgid "or" +msgstr "arba" + +#: lazarusidestrconsts:lispckeditpackagenotsaved +msgid "package %s not saved" +msgstr "paketas %s neišsaugotas" + +#: lazarusidestrconsts:lispkgmangpackagemainsourcefile +msgid "package main source file" +msgstr "paketo pagrindinis pirminio kodo failas" + +#: lazarusidestrconsts:srkmecpause +msgid "pause program" +msgstr "pristabdyti programos veiką" + +#: lazarusidestrconsts:lisctpleaseselectamacro +msgid "please select a macro" +msgstr "pažymėkite makrokomandą" + +#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig +msgid "primary config directory, where Lazarus stores its config files. Default is " +msgstr "Pirminis katalogas nustatymamų failams, kuriame Lazarus laikys savo nustatymų failus. Numatytasis yra" + +#: lazarusidestrconsts:srkmecquickcompile +msgid "quick compile, no linking" +msgstr "kompiliuoti greitai, nesaistyti" + +#: lazarusidestrconsts:lisoipreadonly +msgid "readonly" +msgstr "tik skaitymui" + +#: lazarusidestrconsts:srkmecremovebreakpoint +msgid "remove break point" +msgstr "pašalinti stabdos tašką" + +#: lazarusidestrconsts:srkmecresetdebugger +msgid "reset debugger" +msgstr "atstatyti derintuvę" + +#: lazarusidestrconsts:srvk_rwin +msgid "right windows key" +msgstr "dešinysis windows klavišas" + +#: lazarusidestrconsts:srkmecrunfile +msgid "run file" +msgstr "startuoti failą" + +#: lazarusidestrconsts:srkmecrunparameters +msgid "run parameters" +msgstr "starto parametrai" + +#: lazarusidestrconsts:srkmecrun +msgid "run program" +msgstr "startuoti programą" + +#: lazarusidestrconsts:lissaveallmodified +msgid "save all modified files" +msgstr "Išsaugoti visus pakeistus failus" + +#: lazarusidestrconsts:lissavecurrenteditorfile +msgid "save current editor file" +msgstr "Išsaugoti dabartinį redaktoriaus failą" #: lazarusidestrconsts:lisfindfilesearchallfilesinproject msgid "search all files in project" @@ -7763,2531 +9883,67 @@ msgstr "ieškoti visuose atvertuose failuose" msgid "search in directories" msgstr "ieškoti kataloguose" -#: lazarusidestrconsts:lisfindfiledirectoryoptions -msgid "Directory options" -msgstr "Katalogo parinktys" +#: lazarusidestrconsts:dlgtimesecondunit +msgid "sec" +msgstr "s." -#: lazarusidestrconsts:lisfindfilefilemaskbak -msgid "File mask (*;*.*;*.bak?)" -msgstr "Failų vardų kaukė (*;*.*;*.bak?)" +#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor +msgid "secondary config directory, where Lazarus searches for config template files. Default is " +msgstr "Antrinis katalogas nustatymų failams, kuriame Lazarus ieškos nustatymų šablonų failų. Numatytasis yra" -#: lazarusidestrconsts:lisfindfileincludesubdirectories -msgid "Include sub directories" -msgstr "Ir pakatologiuose" +#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi +msgid "set FPC mode to DELPHI" +msgstr "perjungti FPC veikseną į DELPHI" -#: lazarusidestrconsts:lisfindfileonlytextfiles -msgid "Only text files" -msgstr "Tik teksto failai" +#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc +msgid "set FPC mode to GPC" +msgstr "perjungti FPC veikseną į GPC" -#: lazarusidestrconsts:lispkgmangpackage -msgid "Package: %s" -msgstr "Paketui: %s" +#: lazarusidestrconsts:lisedtdefsetfpcmodetotp +msgid "set FPC mode to TP" +msgstr "perjungti FPC veikseną į TP" -#: lazarusidestrconsts:lispkgmangproject -msgid "Project: %s" -msgstr "Projektui: %s" +#: lazarusidestrconsts:lisedtdefsetiocheckson +msgid "set IOCHECKS on" +msgstr "Įjungti IOCHECKS" -#: lazarusidestrconsts:lispkgmanglazarus -msgid "Lazarus" -msgstr "Lazarus" +#: lazarusidestrconsts:lisedtdefsetoverflowcheckson +msgid "set OVERFLOWCHECKS on" +msgstr "Įjungti OVERFLOWCHECKS" -#: lazarusidestrconsts:lispkgmangdependencywithoutowner -msgid "Dependency without Owner: %s" -msgstr "Priklausomybė neturi šeimininko: %s" - -#: lazarusidestrconsts:lispkgmangsavepackagelpk -msgid "Save Package %s (*.lpk)" -msgstr "Išsaugoti paketą %s (*.lpk)" - -#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension -msgid "Invalid package file extension" -msgstr "Klaidingas paketo failo prievardis" - -#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk -msgid "Packages must have the extension .lpk" -msgstr "Paketų failų prievardis turi būti .lpk" - -#: lazarusidestrconsts:lispkgmanginvalidpackagename -msgid "Invalid package name" -msgstr "Klaidingas paketo vardas" - -#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean -msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "Paketo vardas %s%s%s yra klaidingas.%sParinkite kitokį vardą (pvz.: paketas.lpk)" - -#: lazarusidestrconsts:lispkgmangrenamefilelowercase -msgid "Rename File lowercase?" -msgstr "Failo varde vien mažosios raidės?" - -#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto -msgid "Should the file be renamed lowercase to%s%s%s%s?" -msgstr "Failo vardą rašyti vien mažosiomis raidėmis:%s%s%s%s?" - -#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists -msgid "Package name already exists" -msgstr "Paketas šiuo vardu jau egzistuoja" - -#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename -msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" -msgstr "Aptiktas paketas jau naudojantis vardą %s%s%s.%sKonfliktinis paketas: %s%s%s%sFailas: %s%s%s" - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject -msgid "Filename is used by project" -msgstr "Failo vardą naudoja projektas" - -#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject -msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." -msgstr "Failo vardas %s%s%s yra šio projekto dalis%sProjektai ir paketai neturėtų dalintis failais." - -#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage -msgid "Filename is used by other package" -msgstr "Failo vardą naudoja kitas paketas" - -#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile -msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." -msgstr "Failo vardą %s%s%s naudoja%spaketas %s%s%s%s, esantis faile %s%s%s." - -#: lazarusidestrconsts:lispkgmangreplacefile -msgid "Replace File" -msgstr "Pakeisti failą" - -#: lazarusidestrconsts:lispkgmangreplaceexistingfile -msgid "Replace existing file %s%s%s?" -msgstr "Pakeisti esamą failą %s%s%s?" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile -msgid "Delete Old Package File?" -msgstr "Ištrinti seną paketo failą?" - -#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 -msgid "Delete old package file %s%s%s?" -msgstr "Ištrinti seną paketo failą %s%s%s?" - -#: lazarusidestrconsts:lispkgmangdeletefailed -msgid "Delete failed" -msgstr "Nepavyko ištrinti" - -#: lazarusidestrconsts:lisambiguousunitfound -msgid "Ambiguous Unit found" -msgstr "Rastas neaiškus modulis" - -#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac -msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "Failas %s%s%s%s rastas viename iš paketo %s pradinio kodo katalogų. Panašu kad failas yra kompiliuotas modulis. Kompiliuoti moduliai turi būti paketo išvesties kataloge, kitaip gali kilti problemų kitiems paketams naudojant šį paketą.%s%sPašalinti šį neaiškųjį failą?" - -#: lazarusidestrconsts:lispkgmangunabletodeletefile -msgid "Unable to delete file %s%s%s." -msgstr "Nepavyko ištrinti failą %s%s%s." - -#: lazarusidestrconsts:lisdeleteallthesefiles -msgid "Delete all these files?" -msgstr "Pašalinti visus šiuos failus?" - -#: lazarusidestrconsts:lispkgmangunsavedpackage -msgid "Unsaved package" -msgstr "Neišsaugotas paketas" - -#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages -msgid "There is an unsaved package in the required packages. See package graph." -msgstr "Reikiamuose paketuose aptiktas neišsaugotas paketas. Žvilgterėkit į paketų grafą." - -#: lazarusidestrconsts:lispkgmangbrokendependency -msgid "Broken dependency" -msgstr "Sugadinta priklausomybė" - -#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound -msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "Projektui reikia paketo %s%s%s.%sTačiau jo nepavyko rasti. Žvilgterėkit į \"Projektas -> Projekto inspektorius\"." - -#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound -msgid "A required packages was not found. See package graph." -msgstr "Nerasti reikiami paketai. Žvilgterėkit į paketų grafą." - -#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies -msgid "Circle in package dependencies" -msgstr "Ratas paketo priklausiniuose" - -#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages -msgid "There is a circle in the required packages. See package graph." -msgstr "Reikiamuose paketuose rastas ratas. Žvilgterėkit į paketų grafą." - -#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from -msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" -msgstr "Rasti du moduliai tuo pačiu vardu:%s%s1. %s%s%s iš %s%s2. %s%s%s iš %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 -msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" -msgstr "Rastas modulis tuo pačiu vardu kaip ir paketas:%s%s1. %s%s%s iš %s%s2. %s%s%s%s" - -#: lazarusidestrconsts:lispkgmangambiguousunitsfound -msgid "Ambiguous units found" -msgstr "Rasti neaiškūs moduliai" - -#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu -msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." -msgstr "%sAbu paketai yra susiję. Tai reiškia, kad kažkuris iš paketų naudoja kitą, arba juos abu naudoja kažkuris kitas paketas." - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom -msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir:%s%s%s%s%s%s iš %s%s%s" - -#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage -msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir paketas:%s%s%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangerrorwritingfile -msgid "Error writing file" -msgstr "Klaida rašant į failą" - -#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror -msgid "Unable to write state file for project %s%sError: %s" -msgstr "Nepavyko rašyti į projektui %s priklausantį failą.%sKlaida: %s" - -#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror -msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" -msgstr "Nepavyko rašyti į failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" - -#: lazarusidestrconsts:lispkgmangerrorreadingfile -msgid "Error reading file" -msgstr "Klaida įkeliant failą" - -#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror -msgid "Unable to read state file %s of project %s%sError: %s" -msgstr "Nepavyko įkelti būsenos failą %s, priklausantį projektui%s.%sKlaida: %s" - -#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror -msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" -msgstr "Nepavyko įkelti būsenos failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" - -#: lazarusidestrconsts:lispkgmangunabletocreatedirectory -msgid "Unable to create directory" -msgstr "Nepavyko sukurti katalogą" - -#: lazarusidestrconsts:lisunabletocreatedirectory2 -msgid "Unable to create directory %s%s%s" -msgstr "Nepavyko sukurti katalogą %s%s%s" - -#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage -msgid "Unable to create output directory %s%s%s%sfor package %s." -msgstr "Nepavyko sukurti išvesties katalogą %s%s%s%s, skirtą paketui %s." - -#: lazarusidestrconsts:lispkgmangunabletodeletefilename -msgid "Unable to delete file" -msgstr "Nepavyko ištrinti failą" - -#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage -msgid "Unable to delete old state file %s%s%s%sfor package %s." -msgstr "Nepavyko ištrinti senąjį būsenos failą %s%s%s%s, priklausantį paketui %s." - -#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage -msgid "Unable to create package source directory %s%s%s%sfor package %s." -msgstr "Nepavyko sukurti katalogą %s%s%s%s paketo %s pradiniam kodui." - -#: lazarusidestrconsts:lispkgmangunabletoloadpackage -msgid "Unable to load package" -msgstr "Įkelti paketą nepavyko" - -#: lazarusidestrconsts:lispkgmangunabletoopenthepackage -msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." -msgstr "Nepavyko įkelti paketą %s%s%s.%sŠis paketas paženklintas diegimui." - -#: lazarusidestrconsts:lispkgmanginvalidpackagename2 -msgid "Invalid Package Name" -msgstr "Klaidingas paketo vardas" - -#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid -msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." -msgstr "Paketo vardas %s%s%s, įrašytas faile %s%s%s, yra klaidingas." - -#: lazarusidestrconsts:lispkgmangpackageconflicts -msgid "Package conflicts" -msgstr "Paketų konfliktas" - -#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile -msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "Paketas %s%s%s jau yra įkeltas%siš failo %s%s%s.%sŽvilgterėkit į \"Components -> Paketų grafas\".%sPakeitimas neįmanomas." - -#: lazarusidestrconsts:lispkgmangsavepackage -msgid "Save Package?" -msgstr "Išsaugoti paketą?" - -#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage -msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" -msgstr "%keliant paketą %s bus pakeistas paketas %s%s, esanti faile %s.%sSenojo paketo turinys yra pakeistas.%s%sIšsaugoti senojo paketo %s pakeitimus?" - -#: lazarusidestrconsts:lispkgmangnewpackage -msgid "NewPackage" -msgstr "Naujas paketas" - -#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti -msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "Prieš tesiant reiktų įdiegti kai kuriuos paketus.%sDėmesio:%sProjektas priklauso nuo kai kurių paketų, kuriuose yra moduliai su Register procedūra. Įprastai Register procedūra naudojama komponentėms diegti į IKA. Tačiau šie moduliai priklauso paketams, kurie dar nėra įdiegti į IKA. Bandant IKA atverti formą, kuri naudoja šias komponentes, bus pranešta kad trūksta komponenčių ir tolesnis formos įkėlimas gali pridaryti nepageidautinų nemalonumų.%s%sTai neatsilieps projekto atvėrimui ar jo pirminiam kodui.%s%sTai rik reiškia, kad nėra gerai prieš diegiant trūkstamus paketu atverti formas kūrimui.%s%s" - -#: lazarusidestrconsts:lispackageneedsinstallation -msgid "Package needs installation" -msgstr "Paketą reikia įdiegti" - -#: lazarusidestrconsts:lispkgmangskipthispackage -msgid "Skip this package" -msgstr "Praleisti šį paketą" - -#: lazarusidestrconsts:lispkgmanginvalidfileextension -msgid "Invalid file extension" -msgstr "Klaidingas failo prievardis" - -#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage -msgid "The file %s%s%s is not a lazarus package." -msgstr "Failas %s%s%s nėra Lazarus paketas." - -#: lazarusidestrconsts:lispkgmanginvalidpackagefilename -msgid "Invalid package filename" -msgstr "Klaidingas paketo failo vardas" - -#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename -msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." -msgstr "Paketo failo vardas %s%s%s, įrašytas %s%s%s%s, nėra tinkamas Lazarus paketo vardas." - -#: lazarusidestrconsts:lispkgmangfilenotfound -msgid "File %s%s%s not found." -msgstr "Failas %s%s%s nerastas." - -#: lazarusidestrconsts:lispkgmangerrorreadingpackage -msgid "Error Reading Package" -msgstr "Klaida skaitant paketo failą" - -#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror -msgid "Unable to read package file %s%s%s.%sError: %s" -msgstr "Nepavyko skaityti paketo failą %s%s%s.%sKlaida: %s" - -#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename -msgid "Filename differs from Packagename" -msgstr "Failo ir paketo vardai skiriasi" - -#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage -msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" -msgstr "Failo vardas %s%s%s ir paketo vardas %s%s%s, įrašytas šiame faile, skiriasi.%sPakeisti paketo vardą į %s%s%s?" - -#: lazarusidestrconsts:lispkgmangsavepackage2 -msgid "Save package?" -msgstr "Išsaugoti paketą?" - -#: lazarusidestrconsts:lispkgmangpackagefilemissing -msgid "Package file missing" -msgstr "Trūksta paketo failo" - -#: lazarusidestrconsts:lispkgmangthefileofpackageismissing -msgid "The file %s%s%s%sof package %s is missing." -msgstr "Trūksta failo %s%s%s%s, priklausančio paketui %s." - -#: lazarusidestrconsts:lispkgmangpackagefilenotsaved -msgid "Package file not saved" -msgstr "Paketo failas neišsaugotas" - -#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst -msgid "The file %s%s%s%sof package %s needs to be saved first." -msgstr "Pirma reikia išsaugoti failą %s%s%s%s, priklausantį paketui %s." - -#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow -msgid "Ignore and save package now" -msgstr "Ignoruoti ir projektą išsaugoti dabar" - -#: lazarusidestrconsts:lispkgmangpackagechangedsave -msgid "Package %s%s%s changed. Save?" -msgstr "Paketas %s%s%s pakeistas. Išsaugoti pakeitimus?" - -#: lazarusidestrconsts:lispkgmangerrorwritingpackage -msgid "Error Writing Package" -msgstr "Klaida išsaugant paketą" - -#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror -msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" -msgstr "Nepavyko paketą %s%s%s%sįrašyti į failą %s%s%s.%sKlaida: %s" - -#: lazarusidestrconsts:lisseeprojectprojectinspector -msgid "%sSee Project -> Project Inspector" -msgstr "%sŽiūrėkit \"Projektas -> Projekto inspektorius\"" - -#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload -msgid "The following package failed to load:" -msgstr "Nepavyko įkelti šio paketo:" - -#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload -msgid "The following packages failed to load:" -msgstr "Nepavyko įkelti šių paketų:" - -#: lazarusidestrconsts:lismissingpackages -msgid "Missing Packages" -msgstr "Trūksta paketų" - -#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename -msgid "invalid Compiler filename" -msgstr "Klaidingas kompiliatoriaus failo vardas" - -#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable -msgid "The compiler file for package %s is not a valid executable:%s%s" -msgstr "Paketo %s kompiliatoriaus failas nėra vykdomasis:%s%s" - -#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory -msgid "Package %s%s%s has no valid output directory:%s%s%s%s" -msgstr "Paketui %s%s%s nurodytas blogas katalogas:%s%s%s%s" - -#: lazarusidestrconsts:lispkgmangpackagemainsourcefile -msgid "package main source file" -msgstr "paketo pagrindinis pirminio kodo failas" - -#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit -msgid "This file was automatically created by Lazarus. Do not edit!" -msgstr "Šį failą automatiškai sukūrė Lazarus. Nekeiskite jo!" - -#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage -msgid "This source is only used to compile and install the package." -msgstr "Šis pirminis kodas skirtas tik paketo kompiliavimui ir diegimui." - -#: lazarusidestrconsts:lispkgmangrenamefileinpackage -msgid "Rename file in package?" -msgstr "Pervardinti failą pakete?" - -#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed -msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "Paketui %s priklauso failas%s%s%s%s.%sFailą pervardinti ir pakete?" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage -msgid "%sAdding new Dependency for project %s: package %s%s" -msgstr "%sProjektui %s priskiriamas naujas priklausinys: paketas %s%s" - -#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage -msgid "%sAdding new Dependency for package %s: package %s%s" -msgstr "%sPaketui %s priskiriamas naujas priklausinys: paketas %s%s" - -#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof -msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "%sŠie moduliai bus įtraukti į naudojamųjų modulių sąrašą%s%s:%s%s%s" - -#: lazarusidestrconsts:lisconfirmchanges -msgid "Confirm changes" -msgstr "Patvirtinkit pakeitimus" - -#: lazarusidestrconsts:lispkgmangfilenotsaved -msgid "File not saved" -msgstr "Failas neišsaugotas" - -#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage -msgid "Please save the file before adding it to a package." -msgstr "Failą būtina išsaugoti prieš dedant jį į paketą." - -#: lazarusidestrconsts:lispkgmangfileisinproject -msgid "File is in Project" -msgstr "Projekto failas" - -#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject -msgid "Warning: The file %s%s%s%sbelongs to the current project." -msgstr "Dėmesio: failas %s%s%s%s jau priklauso šiam projektui." - -#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage -msgid "File is already in package" -msgstr "Pakete yra toks failas" - -#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage -msgid "The file %s%s%s%sis already in the package %s." -msgstr "Failas %s%s%s%s jau yra pakete %s." - -#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage -msgid "Package is no designtime package" -msgstr "Paketas nėra skirtas modeliavimo rėžimui" - -#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages -msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "Paketas %s skirtas tik veikos rėžimui.%s Veikos rėžimo paketų negalima diegti į IKA." - -#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages -msgid "Automatically installed packages" -msgstr "Automatiškai įdiegti paketai" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 -msgid "Installing the package %s will automatically install the packages:" -msgstr "Diegiant paketą %s automatiškai bus įdiegti paketai:" - -#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac -msgid "Installing the package %s will automatically install the package:" -msgstr "Diegiant paketą %s automatiškai bus įdiegtas ir paketas:" - -#: lazarusidestrconsts:lispkgmangrebuildlazarus -msgid "Rebuild Lazarus?" -msgstr "Daryti Lazarus išnaujo?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus -msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "Paketas %s%s%s paženklintas diegimui.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad diegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus iš naujo dabar?" - -#: lazarusidestrconsts:lispkgmangpackageisrequired -msgid "Package is required" -msgstr "Paketas reikalingas" - -#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation -msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "Paketo %s reikia %s, kuris paženklintas kaip diegiamasis.%sŽvilgterėkit į paketų grafą." - -#: lazarusidestrconsts:lispkgmanguninstallpackage -msgid "Uninstall package?" -msgstr "Išdiegti paketą?" - -#: lazarusidestrconsts:lispkgmanguninstallpackage2 -msgid "Uninstall package %s?" -msgstr "Išdiegti paketą %s?" - -#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus -msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "Paketas %s%s%s paženklintas.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad išdiegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus išnaujo dabar?" - -#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe -msgid "This is a virtual package. It has no source yet. Please save the package first." -msgstr "Tai virtualus paketas. Jis kolkas dar neturi pirminio kodo. Todėl pirma išsaugokite paketą." - -#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst -msgid "Please save the package first." -msgstr "Pirma išsaugokite paketą." - -#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound -msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "Paketas %s%s%s paženklintas kaip diegiamasis, tačiau jo nepavyko rasti.%sPašalinti priklausinį iš paketų diegimo sąrašo?" +#: lazarusidestrconsts:lisedtdefsetrangecheckson +msgid "set RANGECHECKS on" +msgstr "Įjungti RANGECHECKS" #: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "statinio paketo nustatymų failas" -#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus -msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." -msgstr "Nepavyko sukurti Lazarus skirto tikslo katalogo:%s%s%s%s.%sŠis katalogas reikalingas naujam pakeistam IKA su įdiegtais jūsų paketais." +#: lazarusidestrconsts:srkmecstopprogram +msgid "stop program" +msgstr "sustabdyti programos veiką" -#: lazarusidestrconsts:lispkgsysinvalidunitname -msgid "Invalid Unitname: %s" -msgstr "Klaidingas modulio vardas: %s" +#: lazarusidestrconsts:listhishelpmessage +msgid "this help message" +msgstr "Tai žinyno pranešimas" -#: lazarusidestrconsts:lispkgsysunitnotfound -msgid "Unit not found: %s%s%s" -msgstr "Modulis nerastas: %s%s%s" +#: lazarusidestrconsts:lisunitpath +msgid "unit path" +msgstr "kelias iki modulio" -#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage -msgid "Unit %s%s%s was removed from package" -msgstr "Modulis %s%s%s pašalintas iš paketo" +#: lazarusidestrconsts:srkmecunknown +msgid "unknown editor command" +msgstr "nežinoma redaktoriaus komana" -#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit -msgid "Can not register components without unit" -msgstr "Negalima registruoti komponenčių be modulio" +#: lazarusidestrconsts:lisedtdefuseheaptrcunit +msgid "use HeapTrc unit" +msgstr "naudoti HeapTrc modulį" -#: lazarusidestrconsts:lispkgsysinvalidcomponentclass -msgid "Invalid component class" -msgstr "Klaidinga komponentės klasė" +#: lazarusidestrconsts:lisedtdefuselineinfounit +msgid "use LineInfo unit" +msgstr "naudoti LineInfo modulį" -#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined -msgid "Component Class %s%s%s already defined" -msgstr "Komponentės klasė %s%s%s jau paskelbta" - -#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering -msgid "RegisterUnit was called, but no package is registering." -msgstr "Paleistas RegisterUnit, tačiau paketas nėra registruojamas." - -#: lazarusidestrconsts:lispkgsysunitname -msgid "%s%sUnit Name: %s%s%s" -msgstr "%s%sModulio vardas: %s%s%s" - -#: lazarusidestrconsts:lispkgsysfilename -msgid "%s%sFile Name: %s%s%s" -msgstr "%s%sFailo vardas: %s%s%s" - -#: lazarusidestrconsts:lispkgsysregistrationerror -msgid "Registration Error" -msgstr "Klaida registruojant" - -#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase -msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." -msgstr "RTL - biblioteka veikos rėžimui, tai visų FreePascal programų bazė." - -#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase -msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "FCL - FreePascal komponenčių biblioteka, pateikia visas objektinio paskalio bazines klases." - -#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase -msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "LCL - Lazarus komponenčių biblioteka, turinti visas pagrindines komponentes reikalingas formos kūrimui." - -#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus -msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" -msgstr "SynEdit - Lazarus naudojama redagavimo komponentė.\nhttp://sourceforge.net/projects/synedit/" - -#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc -msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" -msgstr "CodeTools - funkcijos ir įrankiai, skirti nagrinėti, naršyti ir keisti paskalio pirminį tekstą" - -#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents -msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "Tai numatytasis paketas. Naudojamas komponenčių be paketo. Tos komponentės yra pasenusios." - -#: lazarusidestrconsts:lispkgsysregisterprocedureisnil -msgid "Register procedure is nil" -msgstr "Procedūra Register yra nil" - -#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound -msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." -msgstr "Šis paketas įdiegtas, tačiau nerastas jo lpk failas. Pasyvinami visi jo komponentai. Ištaisykite tai." - -#: lazarusidestrconsts:lispkgsyspackagefilenotfound -msgid "Package file not found" -msgstr "Nerastas paketo failas" - -#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound -msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." -msgstr "Paketas %s%s%s įdiegtas, tačiau nerastas paketo failas (.lpk).%sTodėl sukurtas tuščias paketas." - -#: lazarusidestrconsts:lispkgdefsoutputdirectory -msgid "Output directory" -msgstr "Išvesties katalogas" - -#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition -msgid "CompiledSrcPath addition" -msgstr "Priedas prie CompiledSrcPath" - -#: lazarusidestrconsts:lispkgdefsunitpath -msgid "Unit Path" -msgstr "Kelias iki modulio" - -#: lazarusidestrconsts:lisprojprojectsourcedirectorymark -msgid "Project Source Directory Mark" -msgstr "Projekto pradinio katalogo žymė" - -#: lazarusidestrconsts:lispkgdefssrcdirmark -msgid "Package Source Directory Mark" -msgstr "Paketo pradinio katalogo žymė" - -#: lazarusidestrconsts:lisaf2pinvalidpackage -msgid "Invalid Package" -msgstr "Klaidingas paketas" - -#: lazarusidestrconsts:lisaf2pinvalidpackageid -msgid "Invalid package ID: %s%s%s" -msgstr "Klaidingas paketo ID: %s%s%s" - -#: lazarusidestrconsts:lisaf2ppackagenotfound -msgid "Package %s%s%s not found." -msgstr "Paketas %s%s%s nerastas." - -#: lazarusidestrconsts:lisaf2ppackageisreadonly -msgid "Package is read only" -msgstr "Paketas tik skaitymui" - -#: lazarusidestrconsts:lisaf2pthepackageisreadonly -msgid "The package %s is read only." -msgstr "Paketas %s tik skaitymui." - -#: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage -msgid "The file %s%s%s%sis already in the package %s." -msgstr "Failas %s%s%s%sjau yra pakete %s." - -#: lazarusidestrconsts:lisaf2punitname -msgid "Unit Name: " -msgstr "Modulio vardas:" - -#: lazarusidestrconsts:lisaf2phasregisterprocedure -msgid "Has Register procedure" -msgstr "Turi procedūra Register" - -#: lazarusidestrconsts:lisaf2pisvirtualunit -msgid "Virtual unit (source is not in package)" -msgstr "Virtualus modulis (pakete nėra pirminio kodo)" - -#: lazarusidestrconsts:lisaf2pfiletype -msgid "File Type" -msgstr "Failo tipas" - -#: lazarusidestrconsts:lisaf2pdestinationpackage -msgid "Destination Package" -msgstr "Paskirties paketas" - -#: lazarusidestrconsts:lisaf2pshowall -msgid "Show All" -msgstr "Rodyti visus" - -#: lazarusidestrconsts:lisaf2paddfiletoapackage -msgid "Add file to a package" -msgstr "Įdėti į paketą" - -#: lazarusidestrconsts:lisa2pinvalidfilename -msgid "Invalid filename" -msgstr "Klaidingas failo vardas" - -#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename -msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." -msgstr "Neaiškus failo vardas %s%s%s, nes paketas dar neturi nustatyto katalogo.%sNurodykite pilną kelią iki failo." - -#: lazarusidestrconsts:lisa2pfilenotunit -msgid "File not unit" -msgstr "Failas nėra modulis" - -#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas -msgid "Pascal units must have the extension .pp or .pas" -msgstr "Paskalio modulių failų prievardis turi būti .pp arba .pas" - -#: lazarusidestrconsts:lisa2pisnotavalidunitname -msgid "%s%s%s is not a valid unit name." -msgstr "%s%s%s yra klaidingas modulio vardas." - -#: lazarusidestrconsts:lisa2punitnamealreadyexists -msgid "Unitname already exists" -msgstr "Modulio vardas egzistuoja" - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage -msgid "The unitname %s%s%s already exists in this package." -msgstr "Modulio vardas %s%s%s jau yra pakete." - -#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage -msgid "The unitname %s%s%s already exists in the package:%s%s" -msgstr "Modulio vardas %s%s%s jau yra pakete:%s%s" - -#: lazarusidestrconsts:lisa2pambiguousunitname -msgid "Ambiguous Unit Name" -msgstr "Neaiškus modulio vardas" - -#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent -msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." -msgstr "Modulio vardas %s%s%s tokspat kaip ir užregistruota komponentė.%sDėlto galite sulaukti keistų pranešimų apie klaidas." - -#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject -msgid "File %s%s%s already exists in the project." -msgstr "Failas %s%s%s projekte jau yra." - -#: lazarusidestrconsts:lisa2pexistingfile -msgid "%sExisting file: %s%s%s" -msgstr "%sEgzistuojantis failas: %s%s%s" - -#: lazarusidestrconsts:lisa2pfilealreadyexists -msgid "File already exists" -msgstr "Failas jau egzistuoja" - -#: lazarusidestrconsts:lisa2pfileisused -msgid "File is used" -msgstr "Failas jau naudojamas" - -#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea -msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." -msgstr "Failas %s%s%s yra šio projekto dalis.%sDalintis failais tarp projektų bei paketų nėra gerai." - -#: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion -msgid "The Maximum Version is lower than the Minimim Version." -msgstr "Maksimali versija žemesnė nei minimali." - -#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting -msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." -msgstr "Klaidingas paketo vardas %s%s%s.%sNurodykite egzistuojantį paketą." - -#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe -msgid "The package has already a dependency for the package %s%s%s." -msgstr "Paketas jau priklauso nuo paketo %s%s%s." - -#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting -msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." -msgstr "%s%s%s priklausiniui nerastas paketas.%sNurodykite egzistuojantį paketą." - -#: lazarusidestrconsts:lisa2pinvalidunitname -msgid "Invalid Unit Name" -msgstr "Klaidingas modulio vardas" - -#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer -msgid "The unit name %s%s%s%sand filename %s%s%s differ." -msgstr "Modulio %s%s%s%s ir failo %s%s%s vardai skiriasi." - -#: lazarusidestrconsts:lisa2pfilealreadyinpackage -msgid "File already in package" -msgstr "Pakete jau yra toks failas" - -#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage -msgid "The file %s%s%s is already in the package." -msgstr "Failas %s%s%s jau yra pakete" - -#: lazarusidestrconsts:lisa2pinvalidfile -msgid "Invalid file" -msgstr "Klaidingas failo vardas" - -#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas -msgid "A pascal unit must have the extension .pp or .pas" -msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" - -#: lazarusidestrconsts:lisa2pinvalidancestortype -msgid "Invalid Ancestor Type" -msgstr "Klaidingas protėvio tipas" - -#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier -msgid "The ancestor type %s%s%s is not a valid pascal identifier." -msgstr "Protėvio tipas %s%s%s nėra paskalio identifikatorius." - -#: lazarusidestrconsts:lisa2ppagenametoolong -msgid "Page Name too long" -msgstr "Perilgas vardas" - -#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars -msgid "The page name %s%s%s is too long (max 100 chars)." -msgstr "Perilgas lapo vardas %s%s%s (gali būti nedaugiau 100 simbolių)" - -#: lazarusidestrconsts:lisa2punitnameinvalid -msgid "Unit Name Invalid" -msgstr "Klaidingas modulio vardas" - -#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename -msgid "The unit name %s%s%s does not correspond to the filename." -msgstr "Modulio %s%s%s ir failo vardai neatitinka." - -#: lazarusidestrconsts:lisa2pinvalidclassname -msgid "Invalid Class Name" -msgstr "Klaidingas klasės vardas" - -#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier -msgid "The class name %s%s%s is not a valid pascal identifier." -msgstr "Klasės vardas %s%s%s nėra paskalio identifikatorius." - -#: lazarusidestrconsts:lisa2pinvalidcircle -msgid "Invalid Circle" -msgstr "Klaidingas ratas" - -#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame -msgid "The class name %s%s%s and ancestor type %s%s%s are the same." -msgstr "Klasės vardas %s%s%stokspat kaip ir protėvio tipo %s%s%s." - -#: lazarusidestrconsts:lisa2pambiguousancestortype -msgid "Ambiguous Ancestor Type" -msgstr "Neaiškus protėvio tipas" - -#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit -msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "Protėvio tipo %s%s%s vardas tokspat kaip ir%smodulio %s%s%s." - -#: lazarusidestrconsts:lisa2pambiguousclassname -msgid "Ambiguous Class Name" -msgstr "Neaiškus klasės vardas" - -#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit -msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." -msgstr "Klasės vardas %s%s%s tokspat kaip ir%smodulio %s%s%s." - -#: lazarusidestrconsts:lisa2pclassnamealreadyexists -msgid "Class Name already exists" -msgstr "Dubliuojasi klasės vardas " - -#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile -msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" -msgstr "Klasės vardas %s%s%s jau figūruoja%spaketo %s%sfaile: %s%s%s" - -#: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor -msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" - -#: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor -msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" -msgstr "Maksimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" - -#: lazarusidestrconsts:lisa2paddunit -msgid "Add Unit" -msgstr "Pridėti modulį" - -#: lazarusidestrconsts:lisa2pnewfile -msgid "New File" -msgstr "Naujas failas" - -#: lazarusidestrconsts:lisa2pnewcomponent -msgid "New Component" -msgstr "Nauja komponentė" - -#: lazarusidestrconsts:lisa2paddfile -msgid "Add File" -msgstr "Pridėti failą" - -#: lazarusidestrconsts:lisa2paddfiles -msgid "Add Files" -msgstr "Pridėti failus" - -#: lazarusidestrconsts:lisa2punitfilename -msgid "Unit file name:" -msgstr "Modulio failo vardas:" - -#: lazarusidestrconsts:lisa2pchooseanexistingfile -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist -msgid "Add LFM, LRS files, if they exist" -msgstr "Pridėti esamus LFM bei LRS failus" - -#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure -msgid "Scan Unit for Unit Name and Register procedure" -msgstr "Modulyje ieškoti modulio vardo ir užregistruoti procedūrą" - -#: lazarusidestrconsts:lisa2pancestortype -msgid "Ancestor Type" -msgstr "Protėvio tipas" - -#: lazarusidestrconsts:lisa2pshowall -msgid "Show all" -msgstr "Rodyti visus" - -#: lazarusidestrconsts:lisa2pnewclassname -msgid "New class name:" -msgstr "Naujos klasės vardaas:" - -#: lazarusidestrconsts:lisa2ppalettepage -msgid "Palette Page:" -msgstr "Paletės lapas:" - -#: lazarusidestrconsts:lisa2punitfilename2 -msgid "Unit File Name:" -msgstr "Modulio failo vardas:" - -#: lazarusidestrconsts:lisa2punitname -msgid "Unit Name:" -msgstr "Modulio vardas:" - -#: lazarusidestrconsts:lisa2pshortenorexpandfilename -msgid "Shorten or expand filename" -msgstr "Suskleisti ar išplėsti failo vardą" - -#: lazarusidestrconsts:lisa2psavefiledialog -msgid "Save file dialog" -msgstr "Išsaugoti failą" - -#: lazarusidestrconsts:lisa2pfilename -msgid "File name:" -msgstr "Failo vardas:" - -#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies -msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." -msgstr "Keičiant paketo vardą ar versiją bus sugadintos priklausomybės. Keisti šias priklausomybes kaip priklauso?%sPaspaudus \"Taip\" bus pakeistos visos pateiktos priklausomybės.%sPaspaudus \"Ignoruoti\" priklausomybės bus sugadintos." - -#: lazarusidestrconsts:lisa2pdependency -msgid "Dependency" -msgstr "Priklausomybės" - -#: lazarusidestrconsts:lisa2pbrokendependencies -msgid "Broken Dependencies" -msgstr "Sugadintos priklausomybės" - -#: lazarusidestrconsts:lisoipfilename -msgid "Filename: %s" -msgstr "Failo vardas: %s" - -#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated -msgid "%sThis package was automatically created" -msgstr "%sŠis paketas sukurtas automatiškai" - -#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound -msgid "%sThis package is installed, but the lpk file was not found" -msgstr "%sŠis paketas įdiegtas, tačiau nerastas lpk failas" - -#: lazarusidestrconsts:lisoipdescriptiondescription -msgid "%sDescription: %s" -msgstr "%sAprašymas: %s" - -#: lazarusidestrconsts:lisoipdescription -msgid "Description: " -msgstr "Aprašymas:" - -#: lazarusidestrconsts:lisoippleaseselectapackage -msgid "Please select a package" -msgstr "Pažymėkite paketą" - -#: lazarusidestrconsts:lisoipnopackageselected -msgid "No package selected" -msgstr "Paketas nepažymėtas" - -#: lazarusidestrconsts:lisoippleaseselectapackagetoopen -msgid "Please select a package to open" -msgstr "Nurodykit kurį paketą atverti" - -#: lazarusidestrconsts:lisoippackagename -msgid "Package Name" -msgstr "Paketo vardas" - -#: lazarusidestrconsts:lisoipstate -msgid "State" -msgstr "Būsena" - -#: lazarusidestrconsts:lisoipmodified -msgid "modified" -msgstr "pakeistas" - -#: lazarusidestrconsts:lisoipmissing -msgid "missing" -msgstr "trūksta" - -#: lazarusidestrconsts:lisoipinstalledstatic -msgid "installed static" -msgstr "įdiegtas kaip statinis" - -#: lazarusidestrconsts:lisoipinstalleddynamic -msgid "installed dynamic" -msgstr "įdiektas kaip dinaminis" - -#: lazarusidestrconsts:lisoipautoinstallstatic -msgid "auto install static" -msgstr "automatiškai diegti kaip statišką" - -#: lazarusidestrconsts:lisoipautoinstalldynamic -msgid "auto install dynamic" -msgstr "automatiškai diegti kaip dinamišką" - -#: lazarusidestrconsts:lisoipreadonly -msgid "readonly" -msgstr "tik skaitymui" - -#: lazarusidestrconsts:lisoipopenloadedpackage -msgid "Open loaded package" -msgstr "Atverti įkeltą paketą" - -#: lazarusidestrconsts:lispckeditremovefile -msgid "Remove file" -msgstr "Pašalinti failą" - -#: lazarusidestrconsts:lispckeditreaddfile -msgid "Re-Add file" -msgstr "Išnaujo talpinti failą" - -#: lazarusidestrconsts:lispckeditremovedependency -msgid "Remove dependency" -msgstr "Pašalinti priklausinį" - -#: lazarusidestrconsts:lispckeditmovedependencyup -msgid "Move dependency up" -msgstr "Perkelti priklausinį aukštyn" - -#: lazarusidestrconsts:lispckeditmovedependencydown -msgid "Move dependency down" -msgstr "Perkelti priklausinį žemyn" - -#: lazarusidestrconsts:lispckeditreadddependency -msgid "Re-Add dependency" -msgstr "Išnaujo talpinti priklausinį" - -#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename -msgid "Store dependency filename" -msgstr "Talpinti priklausomo failo vardą" - -#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename -msgid "Clear dependency filename" -msgstr "Išvalyti priklausomo failo vardą" - -#: lazarusidestrconsts:lispckeditcompile -msgid "Compile" -msgstr "Kompiliuoti" - -#: lazarusidestrconsts:lispckeditrecompileclean -msgid "Recompile clean" -msgstr "Kompiliuoti išvalant" - -#: lazarusidestrconsts:lispckeditrecompileallrequired -msgid "Recompile all required" -msgstr "Kompiliuoti visus būtinus" - -#: lazarusidestrconsts:lispckeditcreatemakefile -msgid "Create Makefile" -msgstr "Sukurti Makefile" - -#: lazarusidestrconsts:lispckeditaddtoproject -msgid "Add to project" -msgstr "Įdėti į projektą" - -#: lazarusidestrconsts:lispckeditinstall -msgid "Install" -msgstr "Įdiegti" - -#: lazarusidestrconsts:lispckedituninstall -msgid "Uninstall" -msgstr "Išdiegti" - -#: lazarusidestrconsts:lispckeditviewpackgesource -msgid "View Package Source" -msgstr "Rodyti paketo pirminį kodą" - -#: lazarusidestrconsts:lispckeditgeneraloptions -msgid "General Options" -msgstr "Pagrindinės parinktys" - -#: lazarusidestrconsts:lispckeditsavechanges -msgid "Save Changes?" -msgstr "Išsaugoti pakeitimus?" - -#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage -msgid "Package %s%s%s has changed.%sSave package?" -msgstr "Paketas %s%s%s pakeistas.%sIšsaugoti paketą?" - -#: lazarusidestrconsts:lispckeditpage -msgid "%s, Page: %s" -msgstr "%s, lapas: %s" - -#: lazarusidestrconsts:lisfpfindpalettecomponent -msgid "Find palette component" -msgstr "Ieškoti komponentės paletėje" - -#: lazarusidestrconsts:lisfpcomponents -msgid "Components" -msgstr "Komponentės" - -#: lazarusidestrconsts:lispckeditremovefile2 -msgid "Remove file?" -msgstr "Išmesti failą?" - -#: lazarusidestrconsts:lispckeditremovefilefrompackage -msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "Išmesti failą %s%s%s%siš paketo %s%s%s?" - -#: lazarusidestrconsts:lispckeditremovedependency2 -msgid "Remove Dependency?" -msgstr "Panaikinti priklausomybę?" - -#: lazarusidestrconsts:lispckeditremovedependencyfrompackage -msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" -msgstr "Panaikinti priklausomybę %s%s%s%spaketui %s%s%s?" - -#: lazarusidestrconsts:lispckeditinvalidminimumversion -msgid "Invalid minimum version" -msgstr "Klaidinga minimali versija" - -#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion -msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "Minimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" - -#: lazarusidestrconsts:lispckeditinvalidmaximumversion -msgid "Invalid maximum version" -msgstr "Klaidinga maksimali versija" - -#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion -msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" -msgstr "Maksimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" - -#: lazarusidestrconsts:lispckeditcompileeverything -msgid "Compile everything?" -msgstr "Kompiliuoti viską?" - -#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages -msgid "Re-Compile this and all required packages?" -msgstr "Kompiliuoti išnaujo šį ir kitus reikiamus paketus?" - -#: lazarusidestrconsts:lispckeditcompileroptionsforpackage -msgid "Compiler Options for Package %s" -msgstr "Paketo %s kompiliavimo parinktys" - -#: lazarusidestrconsts:lispckeditsavepackage -msgid "Save package" -msgstr "Išsaugoti paketą" - -#: lazarusidestrconsts:lispckeditcompilepackage -msgid "Compile package" -msgstr "Kompiliuoti paketą" - -#: lazarusidestrconsts:lispckeditaddanitem -msgid "Add an item" -msgstr "Pridėti elementą" - -#: lazarusidestrconsts:lispckeditremoveselecteditem -msgid "Remove selected item" -msgstr "Pašalinti pažymėtą elementą" - -#: lazarusidestrconsts:lispckeditinstallpackageintheide -msgid "Install package in the IDE" -msgstr "Įdiegti paketą į IKA" - -#: lazarusidestrconsts:lispckediteditgeneraloptions -msgid "Edit General Options" -msgstr "Keisti pagrindines parinktis" - -#: lazarusidestrconsts:lispckeditcompopts -msgid "Compiler Options" -msgstr "Kompiliatoriaus parinktys" - -#: lazarusidestrconsts:lispckedithelp -msgid "Help" -msgstr "Žinynas" - -#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu -msgid "There are more functions in the popupmenu" -msgstr "Daugiau funkcijų yra iškylančiame menių" - -#: lazarusidestrconsts:lispckeditmore -msgid "More ..." -msgstr "Daugiau..." - -#: lazarusidestrconsts:lispckediteditoptionstocompilepackage -msgid "Edit Options to compile package" -msgstr "Keisti paketo kompiliavimo parinktis" - -#: lazarusidestrconsts:lispckeditrequiredpackages -msgid "Required Packages" -msgstr "Būtini paketai" - -#: lazarusidestrconsts:lispckeditfileproperties -msgid "File Properties" -msgstr "Failo savybės" - -#: lazarusidestrconsts:lispckeditregisterunit -msgid "Register unit" -msgstr "Registruoti modulį" - -#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit -msgid "Call %sRegister%s procedure of selected unit" -msgstr "Iškviesti pažymėto modulio %sRegister%s procedūrą" - -#: lazarusidestrconsts:lispckeditregisteredplugins -msgid "Registered plugins" -msgstr "Registruoti įskiepiai" - -#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit -msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." -msgstr "Pridėti modulį prie paketo naudojamų modulių. Pasyvinkite tik tiems moduliams, kurių jokiu būdu nereikia kompiliuoti." - -#: lazarusidestrconsts:lispkgmanguseunit -msgid "Use unit" -msgstr "Naudoti modulį" - -#: lazarusidestrconsts:lispckeditminimumversion -msgid "Minimum Version:" -msgstr "Minimali versija:" - -#: lazarusidestrconsts:lispckeditmaximumversion -msgid "Maximum Version:" -msgstr "Maksimali versija:" - -#: lazarusidestrconsts:lispckeditapplychanges -msgid "Apply changes" -msgstr "Pritaikyti keitimus" - -#: lazarusidestrconsts:lispckeditpackage -msgid "Package %s" -msgstr "Paketas %s" - -#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile -msgid "Removed Files (these entries are not saved to the lpk file)" -msgstr "Pašalinti failai (šie įrašai lpk faile neįrašyti)" - -#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved -msgid "Removed required packages (these entries are not saved to the lpk file)" -msgstr "Pašalinti reikiami paketai (šie įrašai lpk faile neįrašyti)" - -#: lazarusidestrconsts:lispckeditdependencyproperties -msgid "Dependency Properties" -msgstr "Priklausomybių savybės" - -#: lazarusidestrconsts:lispckeditpackagenotsaved -msgid "package %s not saved" -msgstr "paketas %s neišsaugotas" - -#: lazarusidestrconsts:lispckeditreadonly -msgid "Read Only: %s" -msgstr "Tik skaitymui: %s" - -#: lazarusidestrconsts:lispckeditmodified -msgid "Modified: %s" -msgstr "Pakeista: %s" - -#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath -msgid "New unit not in unitpath" -msgstr "Naujojo modulio nėra modulių kelyje" - -#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage -msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "Failas %s%s%s%s yra ne paketo modulių kelyje.%s%s%s%s%s įtraukti kaip modulių kelią?" - -#: lazarusidestrconsts:lispkgeditrevertpackage -msgid "Revert package?" -msgstr "Atstatyti paketą?" - -#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand -msgid "Do you really want to forget all changes to package %s and reload it from file?" -msgstr "Ar ištikro norite panaikinti visus keitimus pakete %s ir jį įkelti išnaujo?" - -#: lazarusidestrconsts:lispckoptsusage -msgid "Usage" -msgstr "Naudojimas" - -#: lazarusidestrconsts:lispochoosepofiledirectory -msgid "Choose .po file directory" -msgstr "Nurodykit .po failo katalogą" - -#: lazarusidestrconsts:lispckoptsideintegration -msgid "IDE Integration" -msgstr "IKA dalis" - -#: lazarusidestrconsts:lispckoptsdescriptionabstract -msgid "Description/Abstract" -msgstr "Aprašymas/Santrauka" - -#: lazarusidestrconsts:lispckoptsauthor -msgid "Author:" -msgstr "Autorius:" - -#: lazarusidestrconsts:lispckoptslicense -msgid "License:" -msgstr "Licenzija:" - -#: lazarusidestrconsts:lispckoptsmajor -msgid "Major" -msgstr "Didysis" - -#: lazarusidestrconsts:lispckoptsminor -msgid "Minor" -msgstr "Mažasis" - -#: lazarusidestrconsts:lispckoptsrelease -msgid "Release" -msgstr "Laida" - -#: lazarusidestrconsts:lisbuildnumber -msgid "Build Number" -msgstr "Darymo numeris" - -#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild -msgid "Automatically increment version on build" -msgstr "Padarius, automatiškai didinti versijos numerį" - -#: lazarusidestrconsts:lispckoptspackagetype -msgid "PackageType" -msgstr "Paketo tipas" - -#: lazarusidestrconsts:lispckoptsdesigntimeonly -msgid "Designtime only" -msgstr "Tik konstravimo metu" - -#: lazarusidestrconsts:lispckoptsruntimeonly -msgid "Runtime only" -msgstr "Tik vykdymo metu" - -#: lazarusidestrconsts:lispckoptsdesigntimeandruntime -msgid "Designtime and Runtime" -msgstr "Konstravimo bei vykdymo metu" - -#: lazarusidestrconsts:lispckoptsupdaterebuild -msgid "Update/Rebuild" -msgstr "Atnaujinti/Daryti" - -#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded -msgid "Automatically rebuild as needed" -msgstr "Automatiškai daryti kai reikia" - -#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall -msgid "Auto rebuild when rebuilding all" -msgstr "Daryti automatiškai kai daromi visi" - -#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically -msgid "Manual compilation (never automatically)" -msgstr "Kompiliuoti rankiniu būdu (ne automatiškai)" - -#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects -msgid "Add paths to dependent packages/projects" -msgstr "Įdėti kelius į priklausomus paketus/projektus" - -#: lazarusidestrconsts:lispckoptsinclude -msgid "Include" -msgstr "Įtraukti" - -#: lazarusidestrconsts:lispckoptsobject -msgid "Object" -msgstr "Objektas" - -#: lazarusidestrconsts:lispckoptslibrary -msgid "Library" -msgstr "Biblioteka" - -#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects -msgid "Add options to dependent packages and projects" -msgstr "Įdėti parinktis į priklausomus paketus bei projektus" - -#: lazarusidestrconsts:lispckoptslinker -msgid "Linker" -msgstr "Saistyklė" - -#: lazarusidestrconsts:lispckoptscustom -msgid "Custom" -msgstr "Naudotojo" - -#: lazarusidestrconsts:lispckoptsinvalidpackagetype -msgid "Invalid package type" -msgstr "Klaidingas paketo tipas" - -#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans -msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." -msgstr "Paketas %s%s%s nustatytas automatiniam diegimui.%sTai reiškia, kad jis bus įdiegtas į IKA. Diegimo paketai%sturi būti designtime tipo." - -#: lazarusidestrconsts:lispckoptspackageoptions -msgid "Package Options" -msgstr "Paketo parinktys" - -#: lazarusidestrconsts:lispckexplloadedpackages -msgid "Loaded Packages:" -msgstr "Įkelti paketai:" - -#: lazarusidestrconsts:lispckexplisrequiredby -msgid "Selected package is required by:" -msgstr "Pažymėtojo paketo reikia:" - -#: lazarusidestrconsts:lispckexplpackagenotfound -msgid "Package %s not found" -msgstr "%s paketas nerastas" - -#: lazarusidestrconsts:lispckexplstate -msgid "%sState: " -msgstr "%sBūsena: " - -#: lazarusidestrconsts:lispckexplautocreated -msgid "AutoCreated" -msgstr "sukurtas automatiškai" - -#: lazarusidestrconsts:lispckexplinstalled -msgid "Installed" -msgstr "įdiegtas" - -#: lazarusidestrconsts:lispckexplinstallonnextstart -msgid "Install on next start" -msgstr "Įdiegti kitąkart startuojant" - -#: lazarusidestrconsts:lispckexpluninstallonnextstart -msgid "Uninstall on next start" -msgstr "Išdiegti kitąkart startuojant" - -#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency -msgid "Confirm deleting dependency" -msgstr "Patvirtinimas naikinat priklausomybę" - -#: lazarusidestrconsts:lisprojinspconfirmremovingfile -msgid "Confirm removing file" -msgstr "Patvirtinimas šalinant failą" - -#: lazarusidestrconsts:lisprojinspdeletedependencyfor -msgid "Delete dependency for %s?" -msgstr "Naikinti %s priklausomybę?" - -#: lazarusidestrconsts:lisprojinspremovefilefromproject -msgid "Remove file %s from project?" -msgstr "Pašalinti failą %s iš projekto?" - -#: lazarusidestrconsts:lisprojinspremovedrequiredpackages -msgid "Removed required packages" -msgstr "Pašalinti reikiami paketai" - -#: lazarusidestrconsts:lisprojinspprojectinspector -msgid "Project Inspector - %s" -msgstr "Projekto inspektorius - %s" - -#: lazarusidestrconsts:lismenueditormenueditor -msgid "Menu Editor" -msgstr "Meniu redaktorius" - -#: lazarusidestrconsts:lismenueditorselectmenu -msgid "Select Menu:" -msgstr "Rinkitės menių:" - -#: lazarusidestrconsts:lismenueditorselecttemplate -msgid "Select Template:" -msgstr "Rinkitės šabloną:" - -#: lazarusidestrconsts:lismenueditortemplatepreview -msgid "Template Preview" -msgstr "Šablono peržiūra" - -#: lazarusidestrconsts:lismenueditornewtemplatedescription -msgid "New Template Description..." -msgstr "Naujas šablono aprašymas..." - -#: lazarusidestrconsts:lismenueditorcancel -msgid "Cancel" -msgstr "Atsisakyti" - -#: lazarusidestrconsts:lismenueditorinsertnewitemafter -msgid "Insert New Item (after)" -msgstr "Įterpti naują elementą (po)" - -#: lazarusidestrconsts:lismenueditorinsertnewitembefore -msgid "Insert New Item (before)" -msgstr "Įterpti naują elementą (prieš)" - -#: lazarusidestrconsts:lismenueditordeleteitem -msgid "Delete Item" -msgstr "Pašalinti elementą" - -#: lazarusidestrconsts:lismenueditorcreatesubmenu -msgid "Create Submenu" -msgstr "Sukurti pomenių" - -#: lazarusidestrconsts:lismenueditorhandleonclickevent -msgid "Handle OnClick Event" -msgstr "Apdoroti OnClick įvykį" - -#: lazarusidestrconsts:lismenueditormoveup -msgid "Move Up (or left)" -msgstr "Stumti viršun (arba kairėn)" - -#: lazarusidestrconsts:lismenueditormovedown -msgid "Move Down (or right)" -msgstr "Stumti žemyn (arba dešinėn)" - -#: lazarusidestrconsts:lismenueditorinsertfromtemplate -msgid "Insert From Template..." -msgstr "Įterpti iš šablono..." - -#: lazarusidestrconsts:lismenueditorsaveastemplate -msgid "Save As Template..." -msgstr "Išsaugoti kaip šabloną..." - -#: lazarusidestrconsts:lismenueditordeletefromtemplate -msgid "Delete From Template..." -msgstr "Pašalinti iš šablono..." - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu -msgid "Standard File Menu" -msgstr "Standartinis failo meniu" - -#: lazarusidestrconsts:lismenutemplatefile -msgid "File" -msgstr "Failas" - -#: lazarusidestrconsts:lismenutemplatenew -msgid "New" -msgstr "Naujas" - -#: lazarusidestrconsts:liskmnewunit -msgid "New Unit" -msgstr "Naujas modulis" - -#: lazarusidestrconsts:lismenutemplateopen -msgid "Open" -msgstr "Atverti" - -#: lazarusidestrconsts:lismenutemplateopenrecent -msgid "Open Recent" -msgstr "Atverti paskiausiuosius" - -#: lazarusidestrconsts:lismenutemplatesave -msgid "Save" -msgstr "Išsaugoti" - -#: lazarusidestrconsts:lismenutemplatesaveas -msgid "Save As" -msgstr "Išsaugoti kaip" - -#: lazarusidestrconsts:lismenutemplateclose -msgid "Close" -msgstr "Užverti" - -#: lazarusidestrconsts:lismenutemplateexit -msgid "Exit" -msgstr "Baigti darbą" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu -msgid "Standard Edit Menu" -msgstr "Standartinis redaktoriaus meniu" - -#: lazarusidestrconsts:lismenutemplateedit -msgid "Edit" -msgstr "Keisti" - -#: lazarusidestrconsts:lismenutemplateundo -msgid "Undo" -msgstr "Grąžinti" - -#: lazarusidestrconsts:lismenutemplateredo -msgid "Redo" -msgstr "Pakartoti" - -#: lazarusidestrconsts:lismenutemplatecut -msgid "Cut" -msgstr "Iškirpti" - -#: lazarusidestrconsts:lismenutemplatecopy -msgid "Copy" -msgstr "Kopijuoti" - -#: lazarusidestrconsts:lismenutemplatepaste -msgid "Paste" -msgstr "Įdėti" - -#: lazarusidestrconsts:lismenutemplatefind -msgid "Find" -msgstr "Ieškoti" - -#: lazarusidestrconsts:lismenutemplatefindnext -msgid "Find Next" -msgstr "Ieškoti toliau" - -#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu -msgid "Standard Help Menu" -msgstr "Standartinis žinyno meniu" - -#: lazarusidestrconsts:lismenutemplatehelp -msgid "Help" -msgstr "Žinynas" - -#: lazarusidestrconsts:lismenutemplatecontents -msgid "Contents" -msgstr "Turinys" - -#: lazarusidestrconsts:lismenutemplatetutorial -msgid "Tutorial" -msgstr "Pavyzdys" - -#: lazarusidestrconsts:lismenutemplateabout -msgid "About" -msgstr "Apie" - -#: lazarusidestrconsts:liscontributors -msgid "Contributors" -msgstr "Talkininkai" - -#: lazarusidestrconsts:lisacknowledgements -msgid "Acknowledgements" -msgstr "Padėkos" - -#: lazarusidestrconsts:lischaractermap -msgid "Character Map" -msgstr "Simbolių lentelė" - -#: lazarusidestrconsts:lisctdefchoosedirectory -msgid "Choose Directory" -msgstr "Parinkite katalogą" - -#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues -msgid "CodeTools Directory Values" -msgstr "CodeTools katalogo reikšmės" - -#: lazarusidestrconsts:lisctdefvariable -msgid "Variable: %s" -msgstr "Kintamasis: %s" - -#: lazarusidestrconsts:lisctdefnovariableselected -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisctdefvariablename -msgid "Variable Name" -msgstr "Kintamojo vardas" - -#: lazarusidestrconsts:liscldircleansubdirectories -msgid "Clean sub directories" -msgstr "Valyti pakatalogius" - -#: lazarusidestrconsts:liscldirremovefilesmatchingfilter -msgid "Remove files matching filter" -msgstr "Pašalinti nurodytus failus" - -#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof -msgid "Simple Syntax (e.g. * instead of .*)" -msgstr "Paprasta sintaksė (pvz.: * vietoje .*)" - -#: lazarusidestrconsts:liscldirkeepalltextfiles -msgid "Keep all text files" -msgstr "Palikti visus tekstinius failus" - -#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter -msgid "Keep files matching filter" -msgstr "Palikti filtre nurodytus failus" - -#: lazarusidestrconsts:liscldircleandirectory -msgid "Clean Directory" -msgstr "Valyti katalogą" - -#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis -msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "LFM (Lazarus forma) faile aptikta klaidų. Pavyzdžiui, jame yra savybių/klasių, kurių nėra dabartiniame LCL. Yra įprasta šias savybes/klases pašalinti ir po to paskalio kodą taisyti rankiniu būdu." - -#: lazarusidestrconsts:lisfixlfmfile -msgid "Fix LFM file" -msgstr "LFM failo taisa" - -#: lazarusidestrconsts:lismissingevents -msgid "Missing Events" -msgstr "Trūksta įvykių" - -#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth -msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" -msgstr "Šių metodų, kuriuos naudoja %s, nėra pirminiame kode%s%s%s%s%s%sPašalinti betikslius įrašus?" - -#: lazarusidestrconsts:lisnocodeselected -msgid "No code selected" -msgstr "Kodas nepažymėtas" - -#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod -msgid "Please select some code to extract a new procedure/method." -msgstr "Prieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." - -#: lazarusidestrconsts:lisinvalidselection -msgid "Invalid selection" -msgstr "Klaidingas žymėjimas" - -#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode -msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "Sakinį ištraukti neis.%sPrieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." - -#: lazarusidestrconsts:lisextractprocedure -msgid "Extract Procedure" -msgstr "Ištraukti procedūrą" - -#: lazarusidestrconsts:lisnameofnewprocedure -msgid "Name of new procedure" -msgstr "Naujos procedūros vardas" - -#: lazarusidestrconsts:lisextract -msgid "Extract" -msgstr "Ištraukti" - -#: lazarusidestrconsts:lisinvalidprocname -msgid "Invalid proc name" -msgstr "Klaidingas procedūros vardas" - -#: lazarusidestrconsts:lispublicmethod -msgid "Public Method" -msgstr "Public metodas" - -#: lazarusidestrconsts:lisprivatemethod -msgid "Private Method" -msgstr "Private metodas" - -#: lazarusidestrconsts:lisprotectedmethod -msgid "Protected Method" -msgstr "Protected metodas" - -#: lazarusidestrconsts:lispublishedmethod -msgid "Published Method" -msgstr "Published metodas" - -#: lazarusidestrconsts:lisprocedure -msgid "Procedure" -msgstr "Procedūra" - -#: lazarusidestrconsts:lisprocedurewithinterface -msgid "Procedure with interface" -msgstr "Procedūra su interfeisu" - -#: lazarusidestrconsts:lissubprocedure -msgid "Sub Procedure" -msgstr "Vidinė procedūra" - -#: lazarusidestrconsts:lissubprocedureonsamelevel -msgid "Sub Procedure on same level" -msgstr "Vidinė procedūra tame pačiame lygyje" - -#: lazarusidestrconsts:lisfreepascalcompilernotfound -msgid "Free Pascal Compiler not found" -msgstr "Nerastas FreePascal kompiliatorius" - -#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm -msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "Nerastas FreePascal kompiliatorius (failas: %s).%sRekomenduotina instaliuoti fpc." - -#: lazarusidestrconsts:lisinvalidcompilerfilename -msgid "Invalid Compiler Filename" -msgstr "Blogas kompiliatoriaus vardas" - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" -msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:lisfreepascalsourcesnotfound -msgid "Free Pascal Sources not found" -msgstr "Nerasti FreePascal pirminiai kodai" - -#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun -msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "Nerastas FreePascal pirminių kodų katalogas.%sKai kurios funkcijos neveiks.%sRekomenduotina įdiegti FreePascal pirminius kodus ir nurodyti kelią iki jų%s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory -msgid "Invalid Free Pascal source directory" -msgstr "Klaidingas FreePascal pirminio kodo katalogas" - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "Dabartinis FreePascal pirminio kodo katalogas %s%s%s%s nėra geras.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:lislazarusdirectorynotfound -msgid "Lazarus directory not found" -msgstr "Nerastas Lazarus katalogas" - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou -msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr -msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" -msgstr "Nerastas Lazarus katalogas %s%s%s%s.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr -msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "Dabartinis FreePascal pirminių kodų katalogas %s%s%s%s nėra geras.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho -msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"." - -#: lazarusidestrconsts:lishlpoptshelpoptions -msgid "Help Options" -msgstr "Žinyno parinktys" - -#: lazarusidestrconsts:lishlpoptsviewers -msgid "Viewers" -msgstr "Žiūriklės" - -#: lazarusidestrconsts:lishofpcdochtmlpath -msgid "FPC Doc HTML Path" -msgstr "FPC Doc HTML kelias" - -#: lazarusidestrconsts:lishlpoptsproperties -msgid "Properties:" -msgstr "Savybės:" - -#: lazarusidestrconsts:lishlpoptsdatabases -msgid "Databases" -msgstr "Duomenų bazės" - -#: lazarusidestrconsts:lisencloseselection -msgid "Enclose Selection" -msgstr "Apgaubti pažymėtąjį" - -#: lazarusidestrconsts:lisenclose -msgid "Enclose" -msgstr "Apgaubti" - -#: lazarusidestrconsts:lischoosestructuretoencloseselection -msgid "Choose structure to enclose selection" -msgstr "Nurodykite kokią struktūrą apgaubti pažymėtąjį kodą" - -#: lazarusidestrconsts:liserrors -msgid "Errors" -msgstr "Klaidos" - -#: lazarusidestrconsts:lislfmfile -msgid "LFM file" -msgstr "LFM failas" - -#: lazarusidestrconsts:lisremoveallinvalidproperties -msgid "Remove all invalid properties" -msgstr "Pašalinti klaidingas savybes" - -#: lazarusidestrconsts:liscomptest -msgid "Test" -msgstr "Testas" - -#: lazarusidestrconsts:lisa2pswitchpaths -msgid "Switch Paths" -msgstr "Kitoks kelias" - -#: lazarusidestrconsts:lisa2paddfilestopackage -msgid "Add files to package" -msgstr "Įdėti failus į paketą" - -#: lazarusidestrconsts:lisa2paddtopackage -msgid "Add to package" -msgstr "Įdėti į paketą" - -#: lazarusidestrconsts:lisa2pfilename2 -msgid "Filename" -msgstr "Failo vardas" - -#: lazarusidestrconsts:lisfrifindorrenameidentifier -msgid "Find or Rename Identifier" -msgstr "Ieškoti identifikatoriaus arba jį pervardyti" - -#: lazarusidestrconsts:lishelpselectordialog -msgid "Help selector" -msgstr "Žinyno parinktys" - -#: lazarusidestrconsts:lisselectahelpitem -msgid "Select a help item:" -msgstr "Rinkitės žinyno elementą:" - -#: lazarusidestrconsts:liserrormovingcomponent -msgid "Error moving component" -msgstr "Klaida perkeliant komponentę" - -#: lazarusidestrconsts:liserrormovingcomponent2 -msgid "Error moving component %s:%s" -msgstr "Įvyko klaida perkeliant komponentę %s:%s" - -#: lazarusidestrconsts:lisinstalledpackages -msgid "Installed Packages" -msgstr "Įdiegti paketai" - -#: lazarusidestrconsts:lisavailablepackages -msgid "Available packages" -msgstr "Galimi paketai" - -#: lazarusidestrconsts:lisexportlist -msgid "Export list" -msgstr "Eksportuoti sąrašą" - -#: lazarusidestrconsts:lisimportlist -msgid "Import list" -msgstr "Importuoti sąrašą" - -#: lazarusidestrconsts:lisuninstallselection -msgid "Uninstall selection" -msgstr "Išdiegti pažymėtą" - -#: lazarusidestrconsts:lispackagestoinstallintheide -msgid "Packages to install in the IDE" -msgstr "Į IKA diegtini paketai" - -#: lazarusidestrconsts:lisinstallselection -msgid "Install selection" -msgstr "Įdiegti pažymėtą" - -#: lazarusidestrconsts:lispackageinfo -msgid "Package Info" -msgstr "Informacija apie paketą" - -#: lazarusidestrconsts:lissaveandrebuildide -msgid "Save and rebuild IDE" -msgstr "Išsaugoti ir daryti IKA" - -#: lazarusidestrconsts:lissaveandexitdialog -msgid "Save and exit dialog" -msgstr "Išsaugoti ir uždaryti" - -#: lazarusidestrconsts:lisalignment -msgid "Alignment" -msgstr "Lygiuotė" - -#: lazarusidestrconsts:lishorizontal -msgid "Horizontal" -msgstr "Horizontaliai" - -#: lazarusidestrconsts:lisnochange -msgid "No change" -msgstr "Nekeisti" - -#: lazarusidestrconsts:listops -msgid "Tops" -msgstr "Sutapdinti viršutinius kraštus" - -#: lazarusidestrconsts:lisleftsides -msgid "Left sides" -msgstr "Sutapdinti kairiuosius kraštus" - -#: lazarusidestrconsts:liscenters -msgid "Centers" -msgstr "Sutapdinti centrus" - -#: lazarusidestrconsts:lisbottoms -msgid "Bottoms" -msgstr "Sutapdinti apatinius kraštus" - -#: lazarusidestrconsts:lisrightsides -msgid "Right sides" -msgstr "Sutapdinti dešiniuosius kraštus" - -#: lazarusidestrconsts:liscenterinwindow -msgid "Center in window" -msgstr "Centruoti lange" - -#: lazarusidestrconsts:lisspaceequally -msgid "Space equally" -msgstr "Vienodais tarpais tarp elementu" - -#: lazarusidestrconsts:listopspaceequally -msgid "Top space equally" -msgstr "Tolygiai rikiuoti pagal viršutinius kraštus" - -#: lazarusidestrconsts:lisbottomspaceequally -msgid "Bottom space equally" -msgstr "Tolygiai rikiuoti pagal apatinius kraštus" - -#: lazarusidestrconsts:lisleftspaceequally -msgid "Left space equally" -msgstr "Tolygiai rikiuoti pagal kairiuosius kraštus" - -#: lazarusidestrconsts:lisrightspaceequally -msgid "Right space equally" -msgstr "Tolygiai rikiuoti pagal dešiniuosius kraštus" - -#: lazarusidestrconsts:lisvertical -msgid "Vertical" -msgstr "Vertikaliai " - -#: lazarusidestrconsts:lisscalingfactor -msgid "Scaling factor:" -msgstr "Santykinis mastelis:" - -#: lazarusidestrconsts:liscustomprogram -msgid "Custom Program" -msgstr "naudotojo programa" - -#: lazarusidestrconsts:lisprogram -msgid "Program" -msgstr "Programa" - -#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic -msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "Programa%sFreePascal programa. Lazarus automatiškai rūpinsis programos failu." - -#: lazarusidestrconsts:liscustomprogramafreepascalprogram -msgid "Custom Program%sA freepascal program." -msgstr "Naudotojo programa%sFreePascal programa." - -#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin -msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." -msgstr "Biblioteka%sFreePascal biblioteka (.dll Windows aplinkoje, .so Linux aplinkoje, .dylib MacOsX aplinkoje). Lazarus automatiškai rūpinsis bibliotekos pirminio kodo failu." - -#: lazarusidestrconsts:lisnpselectaprojecttype -msgid "Select a project type" -msgstr "Pasirinkite projekto tipą" - -#: lazarusidestrconsts:lisnpcreateanewproject -msgid "Create a new project" -msgstr "Kurti naują projektą" - -#: lazarusidestrconsts:lisnpcreate -msgid "Create" -msgstr "Sukurti" - -#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty -msgid "Choose a base class for the favourite property %s%s%s." -msgstr "Mėgstamiausiąjai savybei %s%s%s parinkite bazinę klasę." - -#: lazarusidestrconsts:lisoifaddtofavouriteproperties -msgid "Add to favourite properties" -msgstr "Pridėti prie mėgstamiausiųjų savybių" - -#: lazarusidestrconsts:lisoifremovefromfavouriteproperties -msgid "Remove from favourite properties" -msgstr "Pašalinti iš mėgstamiausiųjų savybių" - -#: lazarusidestrconsts:lisreplacingselectionfailed -msgid "Replacing selection failed." -msgstr "Pakeisti pažymėtąjį nepavyko." - -#: lazarusidestrconsts:lisunabletofindinlfmstream -msgid "Unable to find %s in LFM Stream." -msgstr "LFM sraute nepavyko rasti %s." - -#: lazarusidestrconsts:liserrorparsinglfmcomponentstream -msgid "Error parsing lfm component stream." -msgstr "Įvyko klaida analizuojant lfm komponentės srautą." - -#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer -msgid "Unable to create temporary lfm buffer." -msgstr "Nepavyko sukurti laikino lfm buferio." - -#: lazarusidestrconsts:lisunabletogetsourcefordesigner -msgid "Unable to get source for designer." -msgstr "Nepavyko gauti pirminio kodo, skirto konstruktoriui." - -#: lazarusidestrconsts:lisunabletogathereditorchanges -msgid "Unable to gather editor changes." -msgstr "Nepavyko susekti pokyčių redaktoriuje." - -#: lazarusidestrconsts:lisunabletostreamselectedcomponents2 -msgid "Unable to stream selected components." -msgstr "Nepavyko pasirinktas komponentes nusiųsti srautu." - -#: lazarusidestrconsts:lisunabletochangeclassofto -msgid "%s%sUnable to change class of %s to %s" -msgstr "%s%sNepavyko %s klasę pakeisti į %s" - -#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents -msgid "Can only change the class of TComponents." -msgstr "Galima keisti tik TComponen'ų klasę." - -#: lazarusidestrconsts:lisoldclass -msgid "Old Class" -msgstr "Buvusi klasė" - -#: lazarusidestrconsts:lisnewclass -msgid "New Class" -msgstr "Nauja klasė" - -#: lazarusidestrconsts:lisoldancestors -msgid "Old Ancestors" -msgstr "Buvęs protėvis" - -#: lazarusidestrconsts:lisnewancestors -msgid "New Ancestors" -msgstr "Naujas protėvis" - -#: lazarusidestrconsts:lisceocodeexplorer -msgid "CodeExplorer Options" -msgstr "Kodo tyrinėtojo parinktys" - -#: lazarusidestrconsts:lisceoupdate -msgid "Update" -msgstr "Atnaujinimas" - -#: lazarusidestrconsts:lisceorefreshautomatically -msgid "Refresh automatically" -msgstr "Atnaujinti automatiškai" - -#: lazarusidestrconsts:lisceoneveronlymanually -msgid "Never, only manually" -msgstr "Niekada, tik rankiniu būdu" - -#: lazarusidestrconsts:lisceowhenswitchingfile -msgid "When switching file in source editor" -msgstr "Perjungiant failą kodo redaktoriuje" - -#: lazarusidestrconsts:lisceoonidle -msgid "On idle" -msgstr "Neveikos metu" - -#: lazarusidestrconsts:liscefollowcursor -msgid "Follow cursor" -msgstr "Sekti žymeklį" - -#: lazarusidestrconsts:lismenulazdoc -msgid "LazDoc Editor" -msgstr "LazDoc redaktorius" - -#: lazarusidestrconsts:lislazdocmainformcaption -msgid "LazDoc editor" -msgstr "LazDoc redaktorius" - -#: lazarusidestrconsts:lislazdocnotagcaption -msgid "" -msgstr "" - -#: lazarusidestrconsts:lislazdocnodocumentation -msgid "Documentation entry does not exist" -msgstr "Dokumento įrašas neegzistuoja" - -#: lazarusidestrconsts:lislazdocinherited -msgid "Inherited" -msgstr "Paveldas" - -#: lazarusidestrconsts:lislazdocshorttag -msgid "Short" -msgstr "Santrumpa" - -#: lazarusidestrconsts:lislazdocdescrtag -msgid "Description" -msgstr "Aprašymas" - -#: lazarusidestrconsts:lislazdocerrorstag -msgid "Errors" -msgstr "Klaidos" - -#: lazarusidestrconsts:lislazdocseealsotag -msgid "See also" -msgstr "Taip pat žiūrėkite" - -#: lazarusidestrconsts:lislazdocaddpathbutton -msgid "Add path" -msgstr "Pridėti kelią" - -#: lazarusidestrconsts:lislazdocdeletepathbutton -msgid "Remove path" -msgstr "Pašalinti kelią" - -#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow -msgid "NOTE: only absolute paths are supported now" -msgstr "Pastaba: šiuo metu palaikomi tik absoliutūs keliai" - -#: lazarusidestrconsts:lislazdocpathsgroupbox -msgid "LazDoc settings" -msgstr "LazDoc nuostatos" - -#: lazarusidestrconsts:lislazdochintboldformat -msgid "Insert bold formatting tag" -msgstr "Įterpti pusjuodžio formatavimo gairę" - -#: lazarusidestrconsts:lislazdochintitalicformat -msgid "Insert italic formatting tag" -msgstr "Įterpti kursyvo formatavimo gairę" - -#: lazarusidestrconsts:lislazdochintunderlineformat -msgid "Insert underline formatting tag" -msgstr "Įterpti pabraukimo formatavimo gairę" - -#: lazarusidestrconsts:lislazdochintinsertcodetag -msgid "Insert code formatting tag" -msgstr "Įterpti kodo formatavimo gairę" - -#: lazarusidestrconsts:lislazdochintremarktag -msgid "Insert remark formatting tag" -msgstr "Įterpti pastabos formatavimo gairę" - -#: lazarusidestrconsts:lislazdochintvartag -msgid "Insert var formatting tag" -msgstr "Įterpti kintamojo formatavimo gairę" - -#: lazarusidestrconsts:lislazdocaddlinkbutton -msgid "Add link" -msgstr "Pridėti nuorodą" - -#: lazarusidestrconsts:lislazdocdeletelinkbutton -msgid "Delete link" -msgstr "Pašalinti nuorodą" - -#: lazarusidestrconsts:lislazdocexampletag -msgid "Example" -msgstr "Pavyzdys" - -#: lazarusidestrconsts:lislazdocbrowseexamplebutton -msgid "Browse" -msgstr "Naršyti" - -#: lazarusidestrconsts:lisldmoveentriestoinherited -msgid "Move entries to inherited" -msgstr "Įrašus perkelti į paveldą" - -#: lazarusidestrconsts:lisldcopyfrominherited -msgid "Copy from inherited" -msgstr "Kopijuoti iš paveldo" - -#: lazarusidestrconsts:lisenablemacros -msgid "Enable Macros" -msgstr "Įgalinti makrokomandas" - -#: lazarusidestrconsts:lisctselectcodemacro -msgid "Select Code Macro" -msgstr "Išrink kodo makrokomandą" - -#: lazarusidestrconsts:lispdprogress -msgid "Progress" -msgstr "Eiga" - -#: lazarusidestrconsts:lispdabort -msgid "Abort" -msgstr "Nutraukti" - -#: lazarusidestrconsts:lisposaveinlpifil -msgid "Save in .lpi file" -msgstr "Išsaugoti .lpi faile" - -#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory -msgid "Save in .lps file in project directory" -msgstr "Išsaugoti .lps faile, projekto kataloge" - -#: lazarusidestrconsts:lisposaveinideconfigdirectory -msgid "Save in IDE config directory" -msgstr "Išsaugoti IKA nustatymų kataloge" - -#: lazarusidestrconsts:lispodonotsaveanysessioninfo -msgid "Do not save any session info" -msgstr "Sesijos informacijos neišsaugoti" - -#: lazarusidestrconsts:lisposavesessioninformationin -msgid "Save session information in" -msgstr "Sesijos informaciją išsaugoti į" - -#: lazarusidestrconsts:lismvsavemessagestofiletxt -msgid "Save messages to file (*.txt)" -msgstr "Išsaugoti pranešimus faile (*.txt)" - -#: lazarusidestrconsts:lisshowoldtaborder -msgid "Show old tab order" -msgstr "Rodyti buvusią vietą tabuliatoriaus eilėje" - -#: lazarusidestrconsts:listaborderof -msgid "Tab Order of" -msgstr "Vieta tabuliatoriaus eilėje" - -#: lazarusidestrconsts:lisanchorenabledhint -msgid "Enabled = Include %s in Anchors" -msgstr "Veiksnus = %s įtraukti į prieraišų sąrašą" - -#: lazarusidestrconsts:lisaroundborderspacehint -msgid "Borderspace around the control. The other four borderspaces are added to this value." -msgstr "Pagrindinis kraštinės plotis apie komponentę.\nŠi reikšmė bus pridedama prie kitų kraštinių pločių" - -#: lazarusidestrconsts:listopborderspacespinedithint -msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." -msgstr "Viršutinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą viršutinės kraštinės plotį" - -#: lazarusidestrconsts:lisbottomborderspacespinedithint -msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." -msgstr "Apatinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą apatinės kraštinės plotį" - -#: lazarusidestrconsts:lisleftborderspacespinedithint -msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." -msgstr "Kairės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą kairiosios kraštinės plotį" - -#: lazarusidestrconsts:lisrightborderspacespinedithint -msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." -msgstr "Dešinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą dešiniosios kraštinės plotį" - -#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling -msgid "Center control vertically relative to the given sibling" -msgstr "Komponentę centruoti vertikaliai pagal nurodytą kaimyną" - -#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling -msgid "Center control horizontally relative to the given sibling" -msgstr "Komponentę centruoti horizontaliai pagal nurodytą kaimyną" - -#: lazarusidestrconsts:lisanchortotopsidekeepborderspace -msgid "Anchor to top side of sibling, keep border space" -msgstr "Kraštinės pločio atstumu pririšti prie kaimyno viršutiniojo krašto" - -#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace -msgid "Anchor to bottom side of sibling, keep border space" -msgstr "Kraštinės pločio atstumu pririšti prie kaimyno apatiniojo krašto" - -#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace -msgid "Anchor to left side of sibling, keep border space" -msgstr "Kraštinės pločio atstumu pririšti prie kaimyno kairiojo krašto" - -#: lazarusidestrconsts:lisanchortorightsidekeepborderspace -msgid "Anchor to right side of sibling, keep border space" -msgstr "Kraštinės pločio atstumu pririšti prie kaimyno dešiniojo krašto" - -#: lazarusidestrconsts:listopsiblingcomboboxhint -msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." -msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas viršutinis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." - -#: lazarusidestrconsts:lisbottomsiblingcomboboxhint -msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." -msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas apatinis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." - -#: lazarusidestrconsts:lisrightsiblingcomboboxhint -msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." -msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas dešinysis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." - -#: lazarusidestrconsts:lisleftsiblingcomboboxhint -msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." -msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas kairysis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." - -#: lazarusidestrconsts:lisborderspace -msgid "BorderSpace" -msgstr "Kraštinės plotis" - -#: lazarusidestrconsts:lissibling -msgid "Sibling" -msgstr "Kaimynas" - -#: lazarusidestrconsts:lisenabled -msgid "Enabled" -msgstr "Veiksnus" - -#: lazarusidestrconsts:lisrightanchoring -msgid "Right anchoring" -msgstr "Dešinės prieraiša" - -#: lazarusidestrconsts:listopanchoring -msgid "Top anchoring" -msgstr "Viršaus prieraiša" - -#: lazarusidestrconsts:lisleftgroupboxcaption -msgid "Left anchoring" -msgstr "Kairės prieraiša" - -#: lazarusidestrconsts:lisbottomgroupboxcaption -msgid "Bottom anchoring" -msgstr "Apačios prieraiša" - -#: lazarusidestrconsts:lisunabletosetanchorsidecontrolŠ -msgid "Unable to set AnchorSide Control" -msgstr "Kraštą pririšti prie komponentės neįmanoma" - -#: lazarusidestrconsts:lisanchoreditornocontrolselected -msgid "Anchor Editor - no control selected" -msgstr "Prieraišų redaktorius - nėra pažymėtų komponenčių" - -#: lazarusidestrconsts:lisanchorsofselectedcontrols -msgid "Anchors of selected controls" -msgstr "Pažymėtos komponentės prieraišos" - -#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath -msgid "Additional search path" -msgstr "Papildomi paieškos keliai" - -#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions -msgid "Debugger general options" -msgstr "Derintuvės pagrindinės parinktys" - -#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop -msgid "Show message on stop" -msgstr "Rodyti pranešimą sustabdžius" - -#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific -msgid "Debugger specific options (depends on type of debugger)" -msgstr "Derintuvės specifinės parinktys (priklauso nuo derintuvės tipo)" - -#: lazarusidestrconsts:lisdebugoptionsfrmeventlog -msgid "Event Log" -msgstr "Įvykių žurnalas" - -#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun -msgid "Clear log on run" -msgstr "Išvalyti žurnalą paleidžiant" - -#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto -msgid "Limit linecount to" -msgstr "Riboti eilučių kiekį iki" - -#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint -msgid "Breakpoint" -msgstr "Stabdos taškas" - -#: lazarusidestrconsts:lisdebugoptionsfrmprocess -msgid "Process" -msgstr "Procesas" - -#: lazarusidestrconsts:lisdebugoptionsfrmthread -msgid "Thread" -msgstr "Gija" - -#: lazarusidestrconsts:lisdebugoptionsfrmmodule -msgid "Module" -msgstr "Modulis" - -#: lazarusidestrconsts:lisdebugoptionsfrmoutput -msgid "Output" -msgstr "Išvestis" - -#: lazarusidestrconsts:lisdebugoptionsfrmwindow -msgid "Window" -msgstr "Langas" - -#: lazarusidestrconsts:lisdebugoptionsfrminterface -msgid "Interface" -msgstr "Interfeisas" - -#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions -msgid "Language Exceptions" -msgstr "Kalbos išimtinės situacijos" - -#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions -msgid "Ignore these exceptions" -msgstr "Ignoruoti šias išimtines situacijas" - -#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions -msgid "Break on Lazarus Exceptions" -msgstr "Stabdyti esant Lazarus išimtinei situacijai" - -#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions -msgid "OS Exceptions" -msgstr "OS išimtinės situacijos" - -#: lazarusidestrconsts:lisdebugoptionsfrmsignals -msgid "Signals" -msgstr "Signalai" - -#: lazarusidestrconsts:lisdebugoptionsfrmname -msgid "Name" -msgstr "Vardas" - -#: lazarusidestrconsts:lisdebugoptionsfrmid -msgid "ID" -msgstr "ID" - -#: lazarusidestrconsts:lisdebugoptionsfrmhandledby -msgid "Handled by" -msgstr "Apdoroja" - -#: lazarusidestrconsts:lisdebugoptionsfrmresume -msgid "Resume" -msgstr "Tęsti" - -#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram -msgid "Handled by Program" -msgstr "Apdoroja programa" - -#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger -msgid "Handled by Debugger" -msgstr "Apdoroja derintuvė" - -#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled -msgid "Resume Handled" -msgstr "Tęsti apdorojant" - -#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled -msgid "Resume Unhandled" -msgstr "Tęsti praleidžiant" - -#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage -msgid "Help for FreePascal Compiler message" -msgstr "Informacija apie FreePascal Compiler pranešimą" - -#: lazarusidestrconsts:lisrelativepaths -msgid "Relative paths" -msgstr "Santykiniai keliai" - -#: lazarusidestrconsts:lislazbuildsavesettings -msgid "Save settings" -msgstr "Išsaugoti nuostatas" - -#: lazarusidestrconsts:rsformdatafiledfm -msgid "Form data file (*.dfm)|*.dfm" -msgstr "Formos duomenų failas (*.dfm)|*.dfm" - -#: lazarusidestrconsts:liswlwatchlist -msgid "Watch list" -msgstr "Stebimų sąrašas" - -#: lazarusidestrconsts:liswlexpression -msgid "Expression" -msgstr "Išraiška" - -#: lazarusidestrconsts:liskmchoosekeymappingscheme -msgid "Choose Keymapping scheme" -msgstr "Rinkitės klavišų priskyrimo schemą" - -#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme -msgid "Note: All keys will be set to the values of the choosen scheme." -msgstr "Pastaba: visi klavišai bus nustatyti pagal pasirinktą schemą" - -#: lazarusidestrconsts:liskmkeymappingscheme -msgid "Keymapping Scheme" -msgstr "Klavišų priskyrimo schema" - -#: lazarusidestrconsts:lisifdok -msgid "OK" -msgstr "Tinka" - -#: lazarusidestrconsts:lispvueditvirtualunit -msgid "Edit virtual unit" -msgstr "Keisti virtualų modulį" - -#: lazarusidestrconsts:versioninfotitle -msgid "Version Info" -msgstr "Versijos informacija" - -#: lazarusidestrconsts:lisplistobjects -msgid "&Objects" -msgstr "&Objektai" - -#: lazarusidestrconsts:lisplistjumptoselection -msgid "Jump To Selection" -msgstr "Rodyti žymėjimą" - -#: lazarusidestrconsts:lisplistfilterany -msgid "Filter by matching any part of method" -msgstr "Filtruoti pagal bet kurią metodo dalį" - -#: lazarusidestrconsts:lisplistfilterstart -msgid "Filter by matching with start of method" -msgstr "Filtruoti pagal metodo pradžią" - -#: lazarusidestrconsts:lisplistchangefont -msgid "Change Font" -msgstr "Keisti šriftą" - -#: lazarusidestrconsts:lisplistcopymethodtoclipboard -msgid "Copy method name to the clipboard" -msgstr "Metodo vardą kopijuoti į iškarpinę" - -#: lazarusidestrconsts:lisplisttype -msgid "Type" -msgstr "Tipas" - -#: lazarusidestrconsts:lisplistall -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisplistnone -msgid "" -msgstr "" - -#: lazarusidestrconsts:lisuiclearincludedbyreference -msgid "Clear include cache" -msgstr "Išvalyti įtraukiamų failų podėlį" - -#: lazarusidestrconsts:lischangeparent -msgid "Change parent ..." -msgstr "Pakeisti tėvą..." - -#: lazarusidestrconsts:lislazaruside -msgid "Lazarus IDE" -msgstr "Lazarus IKA" +#: lazarusidestrconsts:lisuidyes +msgid "yes" +msgstr "taip" diff --git a/languages/lazaruside.nl.po b/languages/lazaruside.nl.po index 32db5f8329..9fd2483481 100644 --- a/languages/lazaruside.nl.po +++ b/languages/lazaruside.nl.po @@ -1685,6 +1685,10 @@ msgstr "Conflict " msgid "Conflict found" msgstr "Conflict gevonden" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "Richting" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Folder" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Level 0 (geen extra optimalisaties)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Level 1(Snelle optimalisaties)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Level 2(Level 1 + Langzame optimalisaties)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Level 3 (Level 2 + onzeker)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Linker" msgid "Linking" msgstr "Linken" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Laad desktop instelling van een bestand" @@ -9673,6 +9685,10 @@ msgstr "bereken/wijzig" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "bestand, waar de debug uitvoer naar geschreven wordt. Als dit niet wordt gegeven, wordt de uitvoer naar de console geschreven." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "in Project:" diff --git a/languages/lazaruside.pb.po b/languages/lazaruside.pb.po index 4d3ccfd935..69d6d15544 100644 --- a/languages/lazaruside.pb.po +++ b/languages/lazaruside.pb.po @@ -1677,6 +1677,10 @@ msgstr "Conflito " msgid "Conflict found" msgstr "Conflito encontrado" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "O nome do Construtor precisa ser 'init' (e o destrutor precisa ser 'done')" @@ -2305,6 +2309,10 @@ msgstr "Arquivos do editor Diff" msgid "Direction" msgstr "Direção" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Diretório" @@ -4634,16 +4642,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Nível 0 (nenhuma Otimização extra)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Nível 1 (Rápido Otimização)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Nível 2 (Nível 1 + Otimizações mais lentas)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Nível 3 (Nível 2 + Incertas)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4709,6 +4717,10 @@ msgstr "Vinculador" msgid "Linking" msgstr "Vinculando" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Carregar configurações da Área de Trabalho para arquivo" @@ -9665,6 +9677,10 @@ msgstr "avaliar/modificar" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "arquivo, onde saída do debug é escrita. Se não especificado, saída do debug é escrita no console." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "no Projeto:" diff --git a/languages/lazaruside.pl.po b/languages/lazaruside.pl.po index 7b524cb111..875b30d710 100644 --- a/languages/lazaruside.pl.po +++ b/languages/lazaruside.pl.po @@ -1689,6 +1689,10 @@ msgstr "Konflikt " msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Konstruktor musi nazywać się 'init' (destruktor - 'done')" @@ -2317,6 +2321,10 @@ msgstr "" msgid "Direction" msgstr "Kierunek" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Katalog" @@ -4646,16 +4654,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Poziom 1 (szybkie optymalizacje)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Poziom 2 (Poziom 1 + wolniejsze optymalizacje)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Poziom 3 (Poziom 2 + mniej istotne)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4721,6 +4729,10 @@ msgstr "Linker" msgid "Linking" msgstr "Łączenie" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Odczytaj z pliku" @@ -9677,6 +9689,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "w projekcie:" diff --git a/languages/lazaruside.pliso.po b/languages/lazaruside.pliso.po index 5818d2cba5..d9b78d3e8d 100644 --- a/languages/lazaruside.pliso.po +++ b/languages/lazaruside.pliso.po @@ -1685,6 +1685,10 @@ msgstr "Konflikt " msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Konstruktor musi nazywa si 'init' (destruktor - 'done')" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "Kierunek" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Katalog" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Poziom 1 (szybkie optymalizacje)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Poziom 2 (Poziom 1 + wolniejsze optymalizacje)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Poziom 3 (Poziom 2 + mniej istotne)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Linker" msgid "Linking" msgstr "czenie" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Odczytaj z pliku" @@ -9673,6 +9685,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "w projekcie:" diff --git a/languages/lazaruside.plwin.po b/languages/lazaruside.plwin.po index fe51b44e24..5fbb11ac67 100644 --- a/languages/lazaruside.plwin.po +++ b/languages/lazaruside.plwin.po @@ -1685,6 +1685,10 @@ msgstr "Konflikt " msgid "Conflict found" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Konstruktor musi nazywa si 'init' (destruktor - 'done')" @@ -2313,6 +2317,10 @@ msgstr "" msgid "Direction" msgstr "Kierunek" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Katalog" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Poziom 1 (szybkie optymalizacje)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Poziom 2 (Poziom 1 + wolniejsze optymalizacje)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Poziom 3 (Poziom 2 + mniej istotne)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Linker" msgid "Linking" msgstr "czenie" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Odczytaj z pliku" @@ -9673,6 +9685,10 @@ msgstr "" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "w projekcie:" diff --git a/languages/lazaruside.po b/languages/lazaruside.po index 32ab705b10..1ec8e16072 100644 --- a/languages/lazaruside.po +++ b/languages/lazaruside.po @@ -3567,15 +3567,15 @@ msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" +msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" +msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" +msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts:dlgtargetos @@ -5962,6 +5962,10 @@ msgstr "" msgid "Afrikaans" msgstr "" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgunitdepcaption msgid "Unit dependencies" msgstr "" @@ -9698,6 +9702,14 @@ msgstr "" msgid "Program" msgstr "" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgstr "" @@ -10270,3 +10282,7 @@ msgstr "" msgid "Lazarus IDE" msgstr "" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + diff --git a/languages/lazaruside.ru.po b/languages/lazaruside.ru.po index 4cfcc778c9..b6436b5c72 100644 --- a/languages/lazaruside.ru.po +++ b/languages/lazaruside.ru.po @@ -1685,6 +1685,10 @@ msgstr "Конфликт " msgid "Conflict found" msgstr "Найден конфликт" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Конструктор должен быть 'init' (деструктор - 'done')" @@ -2313,6 +2317,10 @@ msgstr "Сравнить открытые в редакторе файлы" msgid "Direction" msgstr "Направление" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Каталог" @@ -4642,16 +4650,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Уровень 0 (без особой оптимизации)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Уровень 1 (быстрая)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Уровень 2 (уровень 1 + более медленная)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Уровень 3 (уровень 3 + нестандартная)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4717,6 +4725,10 @@ msgstr "Компоновщик" msgid "Linking" msgstr "Связывание" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Загрузить рабочий стол из файла" @@ -9673,6 +9685,10 @@ msgstr "рассчитать/изменить" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "файл, куда записывается вывод отладки. Если он не указан, вывод отладки записывается в консоль." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "в проекте:" diff --git a/languages/lazaruside.ua.po b/languages/lazaruside.ua.po index cc6987efef..cb0d14d67b 100644 --- a/languages/lazaruside.ua.po +++ b/languages/lazaruside.ua.po @@ -1674,6 +1674,10 @@ msgstr "Конфлікт " msgid "Conflict found" msgstr "Знайдений конфлікт" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Конструктор має бути 'init' (деструктор має бути 'done')" @@ -2302,6 +2306,10 @@ msgstr "" msgid "Direction" msgstr "Напрямок" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Тека" @@ -4631,16 +4639,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Рівень 0 (без екстра-оптимізації)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Рівень 1 (Швидкий з оптимізацією)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Рівень 2 (Рівень 1 + Повільніше з оптимізацією)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Рівень 3 (Рівень 2 + непевний)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4706,6 +4714,10 @@ msgstr "Компонувальник" msgid "Linking" msgstr "Створення посилань" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Завантаження налаштувань робочого столу з файлу" @@ -9662,6 +9674,10 @@ msgstr "розрахувати/змінити" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "файл, куди буде записуватись налагоджувальна інформація. Якщо не вказан., налагоджувальна інформація виводиться в консоль." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "в проекті:" diff --git a/languages/lazaruside.zh_CN.po b/languages/lazaruside.zh_CN.po index a042509d15..820a069950 100644 --- a/languages/lazaruside.zh_CN.po +++ b/languages/lazaruside.zh_CN.po @@ -1688,6 +1688,10 @@ msgstr "冲突" msgid "Conflict found" msgstr "发现冲突" +#: lazarusidestrconsts:lisconsoleapplication +msgid "Console application" +msgstr "" + #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "构造函数名必须是 'init' (析构函数名必须是 'done')" @@ -2316,6 +2320,10 @@ msgstr "" msgid "Direction" msgstr "方向" +#: lazarusidestrconsts:lisdirectives +msgid "Directives" +msgstr "" + #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "目录" @@ -4645,16 +4653,16 @@ msgid "Level 0 (no extra Optimizations)" msgstr "Level 0 (没有扩展优化)" #: lazarusidestrconsts:dlglevel1opt -msgid "Level 1 (Quick Optimizations)" -msgstr "Level 1 (快速优化)" +msgid "Level 1 (quick and debugger friendly)" +msgstr "" #: lazarusidestrconsts:dlglevel2opt -msgid "Level 2 (Level 1 + Slower Optimizations)" -msgstr "Level 2 (Level 1 + 更慢的优化)" +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "" #: lazarusidestrconsts:dlglevel3opt -msgid "Level 3 (Level 2 + Uncertain)" -msgstr "Level 3 (Level 2 + 不确定的优化)" +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "" #: lazarusidestrconsts:lislevels msgid "Levels" @@ -4720,6 +4728,10 @@ msgstr "连接器" msgid "Linking" msgstr "链接" +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "" + #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "从文件载入 Lazarus 工作区域设置" @@ -9676,6 +9688,10 @@ msgstr "评价/更改" msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "调试信息输出的文件. 如果没有指定, 调试信息将输出到命令行." +#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych +msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." +msgstr "" + #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "在工程中:"