From d4146c6f7989c4ddffaeeb5cc0069c6c6dda92b8 Mon Sep 17 00:00:00 2001 From: maxim Date: Sun, 6 Jun 2010 21:19:26 +0000 Subject: [PATCH] IDE: Hebrew translation update by Ezik Shlomi, bug #16653. git-svn-id: trunk@25957 - --- languages/lazaruside.he.po | 630 ++++++++++++++++++------------------- 1 file changed, 315 insertions(+), 315 deletions(-) diff --git a/languages/lazaruside.he.po b/languages/lazaruside.he.po index 0b65609e4d..156a038bdc 100644 --- a/languages/lazaruside.he.po +++ b/languages/lazaruside.he.po @@ -11003,111 +11003,111 @@ msgstr "שם הקובץ %s%s%s בשימוש ע\"י חבילה %s%s%s בקובץ #: lazarusidestrconsts.lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." -msgstr "" +msgstr "הקובץ %s%s%s%s השייך לחבילה s% חסר." #: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." -msgstr "" +msgstr "קודם צריך לשמור את הקובץ %s%s%s%s השייך לחבילה s% ." #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" -msgstr "" +msgstr "החבילה הבאה לא הצליחה להטען:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" -msgstr "" +msgstr "החבילות הבאות לא הצליחו להטען:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "" +msgstr "היחידות הבאות יתוספו לסעיף \"משתמש ב\" של %s%s:%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" -msgstr "" +msgstr "הידור החבילה %s%s%s לא הצליח.להסיר אותה מרשימת ההתקנות?" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." -msgstr "" +msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי של חבילת לזארוס." #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "" +msgstr "החבילה %s היא חבילת זמן ריצה בלבד. אי אפשר להתקין חבילה כזאת ב IDE." #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "" +msgstr "החבילה %s%s%s מסומנת להתקנה, אבל אי אפשר למצוא אותה.להסיר את התלות מרשימת ההתקנות של החבילות?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "" +msgstr "החבילה s% דרושה ע\"י s%, אשר מסומנת להתקנה. ראה גרף החבילה." #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" -msgstr "" +msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי, בחר שם אחר (למשל package1.lpk)." #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." -msgstr "" +msgstr "שם החבילה %s%s%s של הקובץ %s%s%s%s אינו חוקי." #: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "" +msgstr "החבילה s% היא בעלת הקובץ %s%s%s%s. האם לשנות גם את שם החבילה?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "החבילה %s%s%s סומנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "החבילה %s%s%s סומנה להתקנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "" +msgstr "הפרוייקט דורש את החבילה s%s%s%, אבל איאפשר למצוא אותה. ראה Project -> Project Inspector." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" -msgstr "" +msgstr "יש שתי יחידות עם אותן השם: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s." #: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." -msgstr "" +msgstr "יש מעגליות בחבילות הדרושות.ראה גרף החבילות." #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" -msgstr "" +msgstr "יש יחידה של FPC עם אותו שם כמו של החבילה:%s%s%s%s%s%s" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" -msgstr "" +msgstr "יש יחידה של FPC עם אותו שם כמו:%s%s%s%s%s%s מ %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" -msgstr "" +msgstr "יש כבר חבילה אחרת עם השם %s%s%s. מתנגש עם חבילה: %s%s%s%s קובץ %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." -msgstr "" +msgstr "ש כבר חבילה s%s%s% אשר נטענה מקובץ %s%s%s. ראה Components -> Package Graph. החלפה אפשרית." #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." -msgstr "" +msgstr "יש חבילה לא שמורה בין החבילות הדרושות. ראה גרף החבילות." #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" -msgstr "" +msgstr "יש יחידה עם אותן השם כמו חבילה: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s." #: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" -msgstr "" +msgstr "הקובץ נוצר אוטומטית ע\"י לזארוס. אל תערוך אותו!" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." -msgstr "" +msgstr "זאת חבילה וירטואלית. אין לה קוד עדיין. ראשית שמור את החבילה." #: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." -msgstr "" +msgstr "הקוד משמש רק להידור והתקנת החבילה." #: lazarusidestrconsts.lispkgmangunabletocreatedirectory msgid "Unable to create directory" @@ -11139,7 +11139,7 @@ msgstr "לא ניתן למחוק את קובץ המצבים הישן %s%s%s%sע #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" -msgstr "" +msgstr "לא מצליח לטעון את החבילה." #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." @@ -11151,27 +11151,27 @@ msgstr "לא ניתן לקרוא את מצב הקובץ %s%s%s%sשל החביל #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" -msgstr "" +msgstr "לא מצליח לכתוב את החבילה %s%s%s% לקובץ %s%s%s. שגיאה: %s" #: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" -msgstr "" +msgstr "לא מצליח לכתוב קובץ מצב %s%s%s% של חבילה %s. שגיאה: %s" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" -msgstr "" +msgstr "להסיר את החבילה?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 msgid "Uninstall package %s?" -msgstr "" +msgstr "להסיר את החבילה s%?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" -msgstr "" +msgstr "חבילה לא שמורה" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" -msgstr "" +msgstr "משתמש ביחידה" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." @@ -11183,27 +11183,27 @@ msgstr "רישום חבילה" #: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" -msgstr "" +msgstr "לא יכול לרשום את הרכיבים ללא יחידה" #: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" -msgstr "" +msgstr "כלי קוד - כלים ופונקציות לפריסה, עיון ועריכה של קוד פסקל" #: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" -msgstr "" +msgstr "מחלקת רכיבים %s%s%s כבר מוגדרת" #: lazarusidestrconsts.lispkgsysfilename msgid "%s%sFile Name: %s%s%s" -msgstr "" +msgstr "שם קובץ: %s%s%s" #: lazarusidestrconsts.lispkgsysinvalidcomponentclass msgid "Invalid component class" -msgstr "" +msgstr "מחלקת רכיבים לא חוקית" #: lazarusidestrconsts.lispkgsysinvalidunitname msgid "Invalid Unitname: %s" -msgstr "" +msgstr "שם יחידה לא חוקי: s%" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" @@ -11211,59 +11211,59 @@ msgstr "הקובץ של החבילה לא נמצא" #: lazarusidestrconsts.lispkgsysregisterprocedureisnil msgid "Register procedure is nil" -msgstr "" +msgstr "פרוצדורת הרישום ריקה" #: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." -msgstr "" +msgstr "יחידת הרישום נקראה, אבל אף חבילה לא נרשמת." #: lazarusidestrconsts.lispkgsysregistrationerror msgid "Registration Error" -msgstr "" +msgstr "שגיאת רישום" #: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" -msgstr "" +msgstr "רכיב העורך SynEdit בשימוש ע\"י לזארוס. http://sourceforge.net/projects/synedit/" #: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." -msgstr "" +msgstr "ספריית הרכיבים FCL של FreePascal מספקת מחלקות בסיסיות לפסקל מונחה עצמים." #: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." -msgstr "" +msgstr "ספריית הרכיבים LCL של FreePascal מכילה את כל הרכיבים הבסיסיים לעריכת טפסים." #: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." -msgstr "" +msgstr "החבילה %s%s%s מותקנת, אבל לא נמצא קובץ חוקי לחבילה (lpk.). חבילה שבורה מדומה נוצרה. " #: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." -msgstr "" +msgstr "ספריית זמן ריצה RTL היא בסיס לכל תכניות Free Pascal." #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." -msgstr "" +msgstr "זאת היא חבילת ברירת המחדל. משמשת רק לרכיבים ללא חבילה. רכיבים אלו לא מעודכנים." #: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." -msgstr "" +msgstr "חבילה זאת מותקנת, אבל קובץ lpk לא נמצא. כל רכיביה נוטרלו. תקן זאת." #: lazarusidestrconsts.lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" -msgstr "" +msgstr "שם יחידה: %s%s%s" #: lazarusidestrconsts.lispkgsysunitnotfound msgid "Unit not found: %s%s%s" -msgstr "" +msgstr "יחידה לא נמצאה: %s%s%s" #: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" -msgstr "" +msgstr "היחידה %s%s%s הוסרה מהחבילה" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." -msgstr "" +msgstr "הקובץ הזה איננו באף חבילה שנטענה." #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" @@ -11271,12 +11271,12 @@ msgstr "לא ניתן לקרוא את קובץ החבילה %s%s%s.%sשגיאה: #: lazarusidestrconsts.lispldexists msgid "Exists" -msgstr "" +msgstr "יציאות" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" msgid "Global" -msgstr "" +msgstr "גלובלי" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" @@ -11288,15 +11288,15 @@ msgstr "קישורי חבילה" #: lazarusidestrconsts.lispldshowgloballinks msgid "Show global links" -msgstr "" +msgstr "הראה קישורים גלובליים" #: lazarusidestrconsts.lispldshowuserlinks msgid "Show user links" -msgstr "" +msgstr "הראה קישורי משתמש" #: lazarusidestrconsts.lisplduser msgid "User" -msgstr "" +msgstr "משתמש" #: lazarusidestrconsts.lispleasecheckthecompilername msgid "Please check the compiler name" @@ -11312,7 +11312,7 @@ msgstr "אנא בחר יחידה לפני ריצה." #: lazarusidestrconsts.lispleaseselectabuildmodefirst msgid "Please select a build mode first." -msgstr "" +msgstr "בחר קודם במצב בניה." #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." @@ -11332,15 +11332,15 @@ msgstr "העתקת שם מתודה ללוח הגזירים" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" -msgstr "" +msgstr "סנן ע\"י התאמת חלק כלשהוא של המתודה" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" -msgstr "" +msgstr "סנן ע\"י התאמת התחלת המתודה" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" -msgstr "" +msgstr "קפוץ אל הקטע שנבחר" #: lazarusidestrconsts.lisplistnone msgid "" @@ -11361,11 +11361,11 @@ msgstr "סוג" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" -msgstr "" +msgstr "בחר תיקייה לקובץ po." #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" -msgstr "" +msgstr "אל תשמור שום מידע session" #: lazarusidestrconsts.lispointer msgid "Pointer" @@ -11373,23 +11373,23 @@ msgstr "מצביע" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" -msgstr "" +msgstr "שמור בתיקיית ההגדרות של ה IDE" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" -msgstr "" +msgstr "שמור בקובץ lpi." #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" -msgstr "" +msgstr "שמור בקובץ lps. בתיקיית הפרוייקט" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" -msgstr "" +msgstr "שמור מידע session ב" #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" -msgstr "" +msgstr "מלה קודמת" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " @@ -11409,7 +11409,7 @@ msgstr "מתודה פרטית" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" -msgstr "" +msgstr "כנראה שאתה צריך להתקין כמה חבילות לפני שתמשיך. אזהרה:s% הפרוייקט תלוי בכמה חבילות, המכילות יחידות עם פרוצדורות רישום. פרוצדורת רישום משמשת בדרך כלל להתקנת רכיבים ב IDE. אבל היחידות הבאות שייכות שייכות לחבילות שעדיין לא מותקנות ב IDE. אם תנסה לפתוח טופס ב IDE, אשר משתמש ברכיבים כאלו, תקבל שגיאה על רכבים חסרים וטעינת הטופס תיתן כנראה תוצאות לא נעימות. אין לזה השפעה על פתיחת הפרוייקט או איזה שהוא קובץ קוד שלו.זה רק אומר ש: זה רעיון גרוע לפתוח טופס לצורך עיצוב, לפני התקנת חבילות חסרות." #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" @@ -11441,7 +11441,7 @@ msgstr "קובץ קוד המקור של תוכנה חייב להכיל סיומ #: lazarusidestrconsts.lisprojaddaddfilestoproject msgid "Add files to project" -msgstr "" +msgstr "הוסף קודם לפרוייקט" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" @@ -11461,27 +11461,27 @@ msgstr "הוסף קבצים" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" -msgstr "" +msgstr "גירסה מינימלית-מקסימלית לא חוקית" #: lazarusidestrconsts.lisprojaddinvalidpackagename msgid "Invalid packagename" -msgstr "" +msgstr "שם חבילה לא חוקי" #: lazarusidestrconsts.lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" -msgstr "" +msgstr "שם לא חוקי של יחידת פסקל " #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" -msgstr "" +msgstr "גירסה לא חוקית" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" -msgstr "" +msgstr "גירסה מקסימלית (לא חובה):" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" -msgstr "" +msgstr "גגירסה מינימלית (לא חובה):" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" @@ -11497,7 +11497,7 @@ msgstr "החבילה לא נמצאה" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "" +msgstr "התלות %s%s%s לא נמצאה. בחר חבילה קיימת." #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" @@ -11516,23 +11516,23 @@ msgstr "הגרסה המינימלית s%s%s% שגויה. השתמש בצורה b #: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." -msgstr "" +msgstr "שם החבילה %s%s%s לא חוקי. בחר חבילה קיימת." #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." -msgstr "" +msgstr "לפרוייקט כבר יש תלות בחבילה %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." -msgstr "" +msgstr "שם היחידה %s%s%s כבר קיים בפרוייקט עם קובץ: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." -msgstr "" +msgstr "שם היחידה %s%s%s כבר קיים בבחירה עם קובץ: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "שם היחידה %s%s%s אינו מזהה חוקי של פסקל." #: lazarusidestrconsts.lisprojaddtoproject msgctxt "lazarusidestrconsts.lisprojaddtoproject" @@ -11541,7 +11541,7 @@ msgstr "הוסף לפרויקט" #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" -msgstr "" +msgstr "שם היחידה כבר קיים" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" @@ -11549,7 +11549,7 @@ msgstr "הפרויקט השתנה" #: lazarusidestrconsts.lisprojectchangedondisk msgid "Project changed on disk" -msgstr "" +msgstr "הפרוייקט השתנה על הדיסק" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" @@ -11558,7 +11558,7 @@ msgstr "ספריית הפרויקט" #: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar msgid "Title in taskbar shows also directory path of the project" -msgstr "" +msgstr "הכותרת בשורת המשימות מראה גם את הנתיב אל תיקיית הפרוייקט" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" @@ -11566,7 +11566,7 @@ msgstr "שם הקובץ של הפרויקט" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" -msgstr "" +msgstr "פרוייקט כולל נתיב" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" @@ -11586,23 +11586,23 @@ msgstr "מאקרו תכונות הפרויקט" #: lazarusidestrconsts.lisprojectmacrounitpath msgid "macro ProjectUnitPath" -msgstr "" +msgstr "מאקרו ProjectUnitPath" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" -msgstr "" +msgstr "תיקיית הפלט של הפרוייקט (למשל תיקיית ה ppu)" #: lazarusidestrconsts.lisprojectpath msgid "Project Path:" -msgstr "" +msgstr "נתיב הפרוייקט:" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss msgid "Project %s raised exception class '%s'." -msgstr "" +msgstr "הפרוייקט העלה חריגה במחלקה s%" #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess msgid "Project %s raised exception class '%s' with message:%s%s" -msgstr "" +msgstr "הפרוייקט העלה חריגה במחלקה s% עם הודעה: s%s%" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" @@ -11616,7 +11616,7 @@ msgstr "הפרויקט %s%s%s נבנה בהצלחה :)" #: lazarusidestrconsts.lisprojectunit msgid "project unit" -msgstr "" +msgstr "יחידת הפרוייקט" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" @@ -11632,23 +11632,23 @@ msgstr "אשר מחיקת תלויות" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" -msgstr "" +msgstr "אשר הסרת קובץ" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" -msgstr "" +msgstr "למחוק תלות ב s%?" #: lazarusidestrconsts.lisprojinspprojectinspector msgid "Project Inspector - %s" -msgstr "" +msgstr "צופה הפרוייקט s%" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgid "Removed required packages" -msgstr "" +msgstr "חבילות דרושות שהוסרו" #: lazarusidestrconsts.lisprojinspremovefilefromproject msgid "Remove file %s from project?" -msgstr "" +msgstr "להסיר קובץ S% מהפרוייקט" #: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" @@ -11656,7 +11656,7 @@ msgstr "לא ניתן לקרוא את מצב הקובץ %s של הפרויקט % #: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" -msgstr "" +msgstr "לא יכול לכתוב את קובץ המצב של הפרוייקט s%s% שגיאה: s%" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" @@ -11681,7 +11681,7 @@ msgstr "שאל על ערך" #: lazarusidestrconsts.lispropertiesofconditionalcompileroption msgid "Properties of conditional compiler option" -msgstr "" +msgstr "תכונות של אפשרות מהדר מותנה" #: lazarusidestrconsts.lisprotected msgid "Protected" @@ -11705,15 +11705,15 @@ msgstr "פרסם את ספריית הפרויקט" #: lazarusidestrconsts.lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" -msgstr "" +msgstr "מסנן \"אל תכלול\" לא חוקי" #: lazarusidestrconsts.lispublprojinvalidincludefilter msgid "Invalid Include filter" -msgstr "" +msgstr "מסנן \"כלול\" לא חוקי" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" -msgstr "" +msgstr "שמור את קובץ lrs. בתיקיית הפלט" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" @@ -11722,7 +11722,7 @@ msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" -msgstr "" +msgstr "ערוך יחידה וירטואלית" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" @@ -11746,7 +11746,7 @@ msgstr "שם היחידה ושם הקובץ לא מתאימים. לדוגמה: u #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" -msgstr "" +msgstr "המר פרוייקט דלפי" #: lazarusidestrconsts.lispwnewproject msgid "New Project" @@ -11765,7 +11765,7 @@ msgstr "פתח אחרונים" #: lazarusidestrconsts.lisquickfixes msgid "Quick fixes" -msgstr "" +msgstr "תיקונים מהירים" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" @@ -11773,11 +11773,11 @@ msgstr "צא מלזרוס" #: lazarusidestrconsts.lisreaderror msgid "Read Error" -msgstr "" +msgstr "שגיאת קריאה" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" -msgstr "" +msgstr "רשומה/מבנה נתונים" #: lazarusidestrconsts.lisregisters msgctxt "lazarusidestrconsts.lisregisters" @@ -11796,39 +11796,39 @@ msgstr "ערך" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" -msgstr "" +msgstr "ביטוי רגולרי" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" -msgstr "" +msgstr "נתיב יחסי" #: lazarusidestrconsts.lisremove msgid "remove" -msgstr "" +msgstr "הסר" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" -msgstr "" +msgstr "הסר את כל התכונות הלא חוקיות" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" -msgstr "" +msgstr "הסר את כל היחידות" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" -msgstr "" +msgstr "הסר מהפרוייקט" #: lazarusidestrconsts.lisremovefromsearchpath msgid "Remove from search path" -msgstr "" +msgstr "הסר מנתיב החיפוש" #: lazarusidestrconsts.lisremovelocalvariable msgid "Remove local variable %s" -msgstr "" +msgstr "הסר משתנה מקומי s%" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" -msgstr "" +msgstr "הסר את היחידות שנבחרו" #: lazarusidestrconsts.lisremovethem msgid "Remove them" @@ -11836,39 +11836,39 @@ msgstr "הסר אותם" #: lazarusidestrconsts.lisremoveunitfromusessection msgid "Remove unit from uses section" -msgstr "" +msgstr "הסר יחידה מסעיף \"משתמש ב\"" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" -msgstr "" +msgstr "לשנות שם קובץ?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" -msgstr "" +msgstr "שינוי שם הקובץ נכשל" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" -msgstr "" +msgstr "שנה שם לאותיות קטנות" #: lazarusidestrconsts.lisreopenproject msgid "Reopen project" -msgstr "" +msgstr "פתח פרוייקט מחדש" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" -msgstr "" +msgstr "פתח מחדש בקידוד אחר" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" -msgstr "" +msgstr "חזור על הספירה:" #: lazarusidestrconsts.lisreplacementproptypes msgid "Replacement Properties and Types" -msgstr "" +msgstr "תכונות וסוגים תחליפיים" #: lazarusidestrconsts.lisreplaceremoveunknown msgid "Replace unknown types and properties" -msgstr "" +msgstr "החלף תכונות וסוגים לא ידועים" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." @@ -11876,43 +11876,43 @@ msgstr "החלפת הבחירה נכשלה." #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" -msgstr "" +msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" #: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources msgid "Requires FPC 2.4 or above. Like Delphi resources" -msgstr "" +msgstr "דורש FPC 2.4 ומעלה. כמו משאבי דלפי" #: lazarusidestrconsts.lisrescan msgid "Rescan" -msgstr "" +msgstr "סרוק שוב" #: lazarusidestrconsts.lisresourceloaderror msgid "Resource load error" -msgstr "" +msgstr "שגיאה בטעינת משאב" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" -msgstr "" +msgstr "שגיאה בשמירת משאב" #: lazarusidestrconsts.lisresourcetypeofnewfiles msgid "Resource type of project:" -msgstr "" +msgstr "סוג משאב של הפרוייקט" #: lazarusidestrconsts.lisresponsecontinue msgid "Response: %sContinue ?" -msgstr "" +msgstr "תגובה: להמשיך?" #: lazarusidestrconsts.lisresult msgid "Result :=" -msgstr "" +msgstr "תוצאה:=" #: lazarusidestrconsts.lisresult2 msgid "Result:" -msgstr "" +msgstr "תוצאה:" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "returns list of all values of case variable in front of variable" -msgstr "" +msgstr "מחזיר רשימה של כל הערכים של משתנה case לפני המשתנה" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" @@ -11925,87 +11925,87 @@ msgstr "ימין" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" -msgstr "" +msgstr "עיגון לימין" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." -msgstr "" +msgstr "רווח גבול ימני. ערך זה מתווסף לרווח הבסיסי ומשמש לרווח מימין לפקד." #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." -msgstr "" +msgstr "זהו פקד האח איליו מעוגן הצד הימני. השאר ריק עבור הורה." #: lazarusidestrconsts.lisrightsides msgid "Right sides" -msgstr "" +msgstr "צדדים ימניים" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" -msgstr "" +msgstr "רווח מימין במידה שווה" #: lazarusidestrconsts.lisroot msgid "Root" -msgstr "" +msgstr "Root" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" -msgstr "" +msgstr "הקובץ אינו קובץ ריצה" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." -msgstr "" +msgstr "היישום המארח %s%s%s אינו קובץ ריצה" #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" -msgstr "" +msgstr "\"הרץ עד ל\" נכשל" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract methods - not yet overridden" -msgstr "" +msgstr "מתודה מופשטת - עדיין לא נדרסה" #: lazarusidestrconsts.lissamabstractmethodsof msgid "Abstract methods of %s" -msgstr "" +msgstr "מתודה מופשטת של s%" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" -msgstr "" +msgstr "הסמן אינו בהצהרת המחלקה" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" -msgstr "" +msgstr "סביבת הפיתוח עסוקה" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods msgid "%s is an abstract class, it has %s abstract methods." -msgstr "" +msgstr "זוהי מחלקה מופשטת, יש לה מתודה מופשטת." #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" -msgstr "" +msgstr "לא נמצאה מתודה מופשטת" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" -msgstr "" +msgstr "שכתב את כל מה שנבחר" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" -msgstr "" +msgstr "שכתב את מה שנבחר ראשון" #: lazarusidestrconsts.lissamselectnone msgid "Select none" -msgstr "" +msgstr "בחר בכלום" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" -msgstr "" +msgstr "יש מתודות מופשטות לשכתוב. בחר את המתודות שעבורן צריך ליצור זנב" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." -msgstr "" +msgstr "לא נשארו מתודות מופשטות לשכתוב." #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" -msgstr "" +msgstr "אי אפשר לעדכן את המתודה כי היא מוגדרת במחלקה הנוכחית" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" @@ -12025,7 +12025,7 @@ msgstr "שמור את כל הקבצים ששונו" #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" -msgstr "" +msgstr "שמור וצא מהדיאלוג" #: lazarusidestrconsts.lissaveandrebuildide msgid "Save and rebuild IDE" @@ -12041,11 +12041,11 @@ msgstr "לשמור שינויים לפרויקט %s?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "save current editor file" -msgstr "" +msgstr "שמור את הקובץ הנוכחי שבעורך" #: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" -msgstr "" +msgstr "שמור מידע עורך על קבצים שאינם של הפרוייקט" #: lazarusidestrconsts.lissavefileas msgid "Save file as" @@ -12053,19 +12053,19 @@ msgstr "שמור קובץ כ" #: lazarusidestrconsts.lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "" +msgstr "לשמור את הקובץ %s%s%s%s לפני סגירת הטופס %s%s%s?" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" -msgstr "" +msgstr "שמור מידע של קבצי עורך סגורים" #: lazarusidestrconsts.lissaveproject msgid "Save project %s (*%s)" -msgstr "" +msgstr "שמור את פרוייקט %s " #: lazarusidestrconsts.lissavesettings msgid "Save Settings" -msgstr "" +msgstr "שמור הגדרות" #: lazarusidestrconsts.lissavespace msgid "Save " @@ -12073,7 +12073,7 @@ msgstr "שמור" #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" -msgstr "" +msgstr "קנה מידה:" #: lazarusidestrconsts.lissearchfor msgid "Search For " @@ -12081,7 +12081,7 @@ msgstr "חפש את" #: lazarusidestrconsts.lissearchunit msgid "Search unit" -msgstr "" +msgstr "חפש יחידה" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " @@ -12089,15 +12089,15 @@ msgstr "ספריית הגדרות משנית, המיקום בו לזרוס יח #: lazarusidestrconsts.lisseemessages msgid "See messages." -msgstr "" +msgstr "ראה הודעות." #: lazarusidestrconsts.lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" -msgstr "" +msgstr "ראה Project -> Project Inspector" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" -msgstr "" +msgstr "בחר פריט עזרה" #: lazarusidestrconsts.lisselectanode msgid "Select a node" @@ -12105,31 +12105,31 @@ msgstr "בחר מצב" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" -msgstr "" +msgstr "בחר בדלפי מקבצי (dfm.*)" #: lazarusidestrconsts.lisselected msgid "Selected" -msgstr "" +msgstr "נבחר" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" -msgstr "" +msgstr "(שכן תחתון שנבחר)" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" -msgstr "" +msgstr "(שכן שמאלי שנבחר)" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" -msgstr "" +msgstr "(שכן ימני שנבחר)" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" -msgstr "" +msgstr "(שכן עליון שנבחר)" #: lazarusidestrconsts.lisselectfile msgid "Select the file" -msgstr "" +msgstr "בחר את הקובץ" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" @@ -12141,19 +12141,19 @@ msgstr "כלי בחירה" #: lazarusidestrconsts.lisselecttheactivebuildmode msgid "Select the active build mode" -msgstr "" +msgstr "בחר את אופן הבניה הפעיל" #: lazarusidestrconsts.lissetdefault msgid "Set default" -msgstr "" +msgstr "קבע ברירת מחדל" #: lazarusidestrconsts.lissetupdefaultindentation msgid "(Setup default indentation)" -msgstr "" +msgstr "(קבע זיהוי ברירת מחדל)" #: lazarusidestrconsts.lissetvalue msgid "Set value" -msgstr "" +msgstr "קבע ערך" #: lazarusidestrconsts.lisshort msgid "Short:" @@ -12165,11 +12165,11 @@ msgstr "הצג" #: lazarusidestrconsts.lisshowdeclarationhints msgid "Show declaration hints" -msgstr "" +msgstr "הראה טיפים של הצהרה" #: lazarusidestrconsts.lisshowemptyunitspackages msgid "Show empty units/packages" -msgstr "" +msgstr "הראה יחידות/חבילות ריקות" #: lazarusidestrconsts.lisshowglyphsfor msgid "Show Glyphs for:" @@ -12181,35 +12181,35 @@ msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" -msgstr "" +msgstr "הראה רמזים" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" -msgstr "" +msgstr "הראה מזהים" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" -msgstr "" +msgstr "הראה תיבת מידע" #: lazarusidestrconsts.lisshowoldtaborder msgid "Show old tab order" -msgstr "" +msgstr "הראה סדר לשוניות ישן" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" -msgstr "" +msgstr "הראה חבילות" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" -msgstr "" +msgstr "הראה תווים מיוחדים" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" -msgstr "" +msgstr "הראה שורת מצב" #: lazarusidestrconsts.lisshowunits msgid "Show units" -msgstr "" +msgstr "הראה יחידות" #: lazarusidestrconsts.lisshowvaluehintswhiledebugging msgid "Show value hints while debugging" @@ -12217,27 +12217,27 @@ msgstr "" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" -msgstr "" +msgstr "הראה גירסה וצא" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" -msgstr "" +msgstr "כווץ לקטן ביותר" #: lazarusidestrconsts.lissibling msgid "Sibling" -msgstr "" +msgstr "אח" #: lazarusidestrconsts.lissimplesyntax msgid "Simple Syntax" -msgstr "" +msgstr "תחביר פשוט" #: lazarusidestrconsts.lisskipfile msgid "Skip file" -msgstr "" +msgstr "דלג על הקובץ" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" -msgstr "" +msgstr "דלג על הקובץ והמשך בטעינה" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project" @@ -12249,19 +12249,19 @@ msgstr "קטן מאשר מהיר" #: lazarusidestrconsts.lissmatches msgid "Matches" -msgstr "" +msgstr "התאמות" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" -msgstr "" +msgstr "מצטער, לא ממומש עדיין" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" -msgstr "" +msgstr "מצטער, סוג זה לא ממומש עדיין" #: lazarusidestrconsts.lissortselascending msgid "Ascending" -msgstr "" +msgstr "עולה" #: lazarusidestrconsts.lissortselcancel msgctxt "lazarusidestrconsts.lissortselcancel" @@ -12279,7 +12279,7 @@ msgstr "יורד" #: lazarusidestrconsts.lissortseldomain msgid "Domain" -msgstr "" +msgstr "מתחם" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" @@ -12309,7 +12309,7 @@ msgstr "קבל" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" -msgstr "" +msgstr "סדר את הבחירה" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" @@ -12318,35 +12318,35 @@ msgstr "מילים" #: lazarusidestrconsts.lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" -msgstr "" +msgstr "המקור והיעד זהים: %s%s" #: lazarusidestrconsts.lissourcebreakpoint msgid "&Source breakpoint" -msgstr "" +msgstr "נקודת עצירה בקוד" #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." -msgstr "" +msgstr "תיקיית המקור %s%s%s% ותיקיית היעד %s%s%s% זהות. יתכן שלא הבנת תכונה זאת. היא תנקה/תיצור מחדש את תיקיית היעד ותעתיק אליה את החבילה/פרוייקט." #: lazarusidestrconsts.lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." -msgstr "" +msgstr "תיקיית המקור %s%s%s לא קיימת" #: lazarusidestrconsts.lissourcemodified msgid "Source modified" -msgstr "" +msgstr "המקור השתנה" #: lazarusidestrconsts.lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" -msgstr "" +msgstr "המקור של דף השתנה %s%s%s. לשמור?" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" -msgstr "" +msgstr "נתיב למקור" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" -msgstr "" +msgstr "רווח במידה שווה" #: lazarusidestrconsts.lissrcos msgid "Src OS" @@ -12362,43 +12362,43 @@ msgstr "חפש טקסט" #: lazarusidestrconsts.lisstartconversion msgid "Start Conversion" -msgstr "" +msgstr "התחל בהמרה" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" -msgstr "" +msgstr "התחל עם פרוייקט חדש" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" -msgstr "" +msgstr "להפסיק את ניפוי השגיאות הנוכחי ולבנות מחדש?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" -msgstr "" +msgstr "להפסיק את ניפוי השגיאות?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" -msgstr "" +msgstr "להפסיק את ניפוי השגיאות?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" -msgstr "" +msgstr "עצור אם יש חריגה" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" -msgstr "" +msgstr "להפסיק את ניפוי השגיאות?" #: lazarusidestrconsts.lisstrangelpifile msgid "Strange lpi file" -msgstr "" +msgstr "קובץ lpi מוזר" #: lazarusidestrconsts.lisstreamerror msgid "Stream Error" -msgstr "" +msgstr "שגיאת זרימה" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" -msgstr "" +msgstr "שגיאת זרימה" #: lazarusidestrconsts.lisstring msgid "String" @@ -12411,47 +12411,47 @@ msgstr "סגנון" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" -msgstr "" +msgstr "תת שגרה" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" -msgstr "" +msgstr "תת שגרה באותה רמה" #: lazarusidestrconsts.lissuccess msgid "Success" -msgstr "" +msgstr "הצלחה" #: lazarusidestrconsts.lissvnrevision msgid "SVN Revision: " -msgstr "" +msgstr "SVN Revision: " #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" -msgstr "" +msgstr "שם משתנה לא חוקי" #: lazarusidestrconsts.lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." -msgstr "" +msgstr " לא מזהה חוקי %s%s%s" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" -msgstr "" +msgstr "עדכן את משתני המערכת" #: lazarusidestrconsts.lissynedit msgid "SynEdit" -msgstr "" +msgstr "SynEdit" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" -msgstr "" +msgstr "מצב תחביר" #: lazarusidestrconsts.listab msgid "Tab" -msgstr "" +msgstr "לשונית" #: lazarusidestrconsts.listaborderof msgid "Tab Order of" -msgstr "" +msgstr "סדר לשוניות של " #: lazarusidestrconsts.listargetcpu msgid "Target CPU" @@ -12459,11 +12459,11 @@ msgstr "מעבד היעד" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" -msgstr "" +msgstr "קובץ המטרה של הפרוייקט" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" -msgstr "" +msgstr "שם קובץ המטרה והפרמטרים שלו" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" @@ -12472,7 +12472,7 @@ msgstr "יעד מערכת ההפעלה" #: lazarusidestrconsts.listcompilerinternalerror msgid "Internal compiler error! (%d)" -msgstr "" +msgstr "שגיאת מהדר פנימית" #: lazarusidestrconsts.listddinserttodo msgid "Insert ToDo" @@ -12480,326 +12480,326 @@ msgstr "הוסף ToDO" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" -msgstr "" +msgstr "תא בר עריכה" #: lazarusidestrconsts.listemplateeditparamcellhelp msgid "" "Inserts an editable Cell, with a default value\n" "\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n" "\"default\",Sync, to Sync with a previous cell of equal default\n" -msgstr "" +msgstr "מכניס תא בר עריכה, עם ערך ברירת מחדל, (Sync=n (,S=n, לסינכרון עם התא הקודם מ n=1 ועד לתא הקודם הגבוה ביותר. ברירת המחדל היא לסנכרן עם התא הקודם עם אותה ברירת מחדל" #: lazarusidestrconsts.listestdirectory msgid "Test directory" -msgstr "" +msgstr "תיקיית ביקורת" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." -msgstr "" +msgstr "המחלקה %s%s%s היא TControl ואי אפשר להדביק אותה על מחלקה שאינה פקד. לא יכול להדביק." #: lazarusidestrconsts.listhecodetoolsfoundanerror msgid "The codetools found an error:%s%s%s" -msgstr "" +msgstr "כלי הקוד מצא שגיאה: %s%s%s" #: lazarusidestrconsts.listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." -msgstr "" +msgstr "הפקודה אחרי %s%s%s אינה ברת ביצוע" #: lazarusidestrconsts.listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" -msgstr "" +msgstr "הפקודה אחריהפירסום אינה חוקית: %s%s%s%s" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." -msgstr "" +msgstr "לא ניתן למחוק את הרכיב, כי הוא שייך ל s%." #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" -msgstr "" +msgstr "עורך הרכיבים של מחלקה %s%s%s גרם לשגיאה: %s%s%s%s" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" -msgstr "" +msgstr "עורך הרכיבים של מחלקה %s%s%s שהופעל ע\"י פעולה #%s %s%s%s%s גרם לשגיאה: %s%s%s%s" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." -msgstr "" +msgstr "הרכיב s% הוא ירושה מ s%. כדי למחוק רכיב מורש פתח את האב ומחק אותו שם." #: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." -msgstr "" +msgstr "הרכיב s% הוא ירושה מ s%. כדי לשנות שם רכיב מורש פתח את האב ומחק אותו שם." #: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier." -msgstr "" +msgstr "שם הרכיב חייב להיות יחודי בין כל הרכיבים של הטופס/מודול הנתונים.השם מושווה ללא רגישות לראשיות כמו כל מזהה פסקל נורמלי." #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "השם הנוכחי של המהדר %s%s%s%s אינו קובץ ריצה חוקי. בחר OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" -msgstr "" +msgstr "השם הנוכחי של המהדר %s%s%s%s אינו קובץ ריצה חוקי. בדוק Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית הקוד הנוכחית של Free Pascal אינה נראית תקינה. בחר OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית הקוד הנוכחית של Free Pascal אינה נראית תקינה. בדוק Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית לזארוס הנוכחית אינה נראית תקינה. בלעדיה לא תוכל ליצור יישומי LCL. בחר OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק Environment ->Environment Options -> Files" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית לזארוס הנוכחית אינה נראית תקינה. בלעדיה לא תוכל ליצור יישומי LCL. בדוק Environment ->Environment Options -> Files" #: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." -msgstr "" +msgstr "הנתיב הנוכחי של היחידה עבור הקובץ %s%s%s%s היא %s%s%s%s. הנתיב ליחידות LCL חסר.טיפ לטירונים: צור יישום לזארוס ושים את הקובץ בתיקיית הפרוייקט." #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" -msgstr "" +msgstr "מנפה השגיאות אינו קיים או שאינו קובץ ריצה. ראה Environment -> Debugger Options" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." -msgstr "" +msgstr "תיקיית היעד %s%s%s%s אינה קיימת. " #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." -msgstr "" +msgstr "תיקיית היעד %s%s%s%s אינה קיימת. בדוק את שם קובץ המטרה של הפרוייקט Menu > Project > Project Options." #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "" +msgstr "התיקייה %s%s%s%s אינה דרושה עוד בנתיב היחידה. להסיר אותה?" #: lazarusidestrconsts.listhedirectoryisnotwritable msgid "The directory %s%s%s is not writable." -msgstr "" +msgstr "התיקייה %s%s%s%s אינה מורשה לכתיבה." #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" -msgstr "" +msgstr "התיקייה %s%s%s%s עדיין אינה בנתיב היחידה. להוסיף אותה?" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." -msgstr "" +msgstr "התיקייה %s לא נמצאה. " #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" -msgstr "" +msgstr " הקובץ %s%s%s" #: lazarusidestrconsts.listhefiledoesnotlooklikealpifile msgid "The file %s does not look like a lpi file." -msgstr "" +msgstr "הקובץ s% לא נראה כמו קובץ lpi." #: lazarusidestrconsts.listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" -msgstr "" +msgstr "הקובץ %s%s%s הוא קישור סימבולי. לפתוח את %s%s%s במקומו?" #: lazarusidestrconsts.listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" -msgstr "" +msgstr "הקובץ %s%s%s אינו פרוייקט של דלפי (dpr.)" #: lazarusidestrconsts.listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." -msgstr "" +msgstr "הקובץ %s%s%s אינו יחידה של דלפי." #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?" -msgstr "" +msgstr "הקובץ %s%s%s אינו פרוייקט של לזארוס. האם ליצור פרוייקט חדש בשבילו?" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "" +msgstr "הקובץ %s%s%s נראה כתוכנית. לסגור את הפרוייקט הנוכחי וליצור פרוייקט לזארוס חדש? No יגרום לטעינת הקובץ כקובץ קוד רגיל." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." -msgstr "" +msgstr "הקובץ %s נראה כקובץ תוכנית של פרוייקט לזארוס קיים." #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" -msgstr "" +msgstr "הקובץ %s%s%s%s נמצא באחת מתיקיות הקוד של החבילה ונראה כמו יחידה מהודרת. יחידות מהודרות חייבות להיות בתיקיית הפלט של החבילה, אחרת חבילות אחרות ייתקלו בבעיות בשימוש בחבילה זאת. האם למחוק את הקובץ הבעייתי?" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" -msgstr "" +msgstr "הקובץ %s%s%s%s לא נמצא. האם אתה רוצה למצוא אותו בעצמך?" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "" +msgstr "הקובץ %s%s%s%s לא נמצא. Ignore יגרום להמשך טעינת הפרוייקט, Abort יעצור את הטעינה." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" -msgstr "" +msgstr "המתודות הבאות שבשימוש s% אינם במקורות %s%s%s%s%s%s האם להסיר את המקורות הרעועים?" #: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." -msgstr "" +msgstr "המהדר של Free Pascal (שם קובץ\" s%) לא נמצא. מומלץ שתתקין fpc." #: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית הקוד של Free Pascal לא נמצאה. חלק מאפשרויות הקוד לא יעבדו. מומלץ שתתקין ותגדיר את הנתיב Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s" -msgstr "" +msgstr "מנפה השגיאות של GNU דרך ssh מאפשר ניםוי מרחוק דרך חיבור ssh. לפרטים ראה docs/RemoteDebugging.txt. הנתיב חייב להכיל את שם לקוח ה ssh,שם המארח עם אפשרות לשם משתמש ושם קובץ ה gdb במחשב המרוחק. לדוגמה: usr/bin/ssh username@hostname gdb/או usr/bin/setsid /usr/bin/ssh username@hostname gdb/" #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." -msgstr "" +msgstr "המזהה הוא יחידה. השתמש ב File - Save כאמצעי לשינוי שם היחידה." #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" -msgstr "" +msgstr "המפתח %s% כבר מוקצה ל s%. להסיר את ההקצאה הישנה למפתח עבור הפונקציה החדשה?" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." -msgstr "" +msgstr "חבורת היישומים s%s% הדרושה להרצה לא קיימת או שאינה ברת ריצה. האם אתה רוצה ליצור אחת? ראה Project -> Project Options -> Application for settings." #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" -msgstr "" +msgstr "היישום המשגר %s%s%s%s לא קיים או שאינו בר ריצה. ראה Run -> Run parameters -> Local" #: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files" -msgstr "" +msgstr "תיקיית לזארוס לא נמצאה.לא תוכל ליצור יישומי LCL. בדוק Environment -> Environment Options -> Files" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "" +msgstr "קובץ ה LFM (טופס לזארוס) מכיל תכונות לא חוקיות. כלומר הוא מכיל למשל כמה תכונות/מחלקות, אשר לא קיימות ב LCL הנוכחי. התיקון הרגיל הוא להסיר תכונות אלו מקובץ ה lfm ולתקן ידנית את קוד הפסקל." #: lazarusidestrconsts.listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." -msgstr "" +msgstr "השם %s%s%s אינו שם חוקי למזהה פסקל." #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" -msgstr "" +msgstr "היחידה החדשה עדיין אינה בנתיב חיפוש היחידות. להוסיף תיקייה?" #: lazarusidestrconsts.listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." -msgstr "" +msgstr "תיקיית הפלט %s%s%s חסרה." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." -msgstr "" +msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של קבצי ה\"כלול\"." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." -msgstr "" +msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש המורשים של קבצי ה\"כלול\"." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." -msgstr "" +msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות המורשות." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." -msgstr "" +msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות." #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." -msgstr "" +msgstr "תיקיית הפלט של צריכה להיות תיקייה נפרדת שאינה מכילה קבצי קוד." #: lazarusidestrconsts.listheownerclasshasthisname msgid "The owner class has this name" -msgstr "" +msgstr "למחלקה שהיא הבעלים יש את השם הזה" #: lazarusidestrconsts.listheownerhasthisname msgid "The owner has this name" -msgstr "" +msgstr "לבעלים יש את השם הזה" #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." -msgstr "" +msgstr "החבילה כבר מכילה יחידה עם שםזה." #: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth msgid "The package %s can not be uninstalled, because it is needed by the IDE itself." -msgstr "" +msgstr "אי אפשר להסיר את התקנת החבילה, כי היא דרושה ל IDE עצמו." #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" -msgstr "" +msgstr "התוכנית make לא נמצאה. כלי זה דרוש לבניית לזארוס." #: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces." -msgstr "" +msgstr "הפרוייקט לא משתמש ביחידות ממשקים של LCL, אבל נראה שהיא זקוקה להן. תקבל שגיאות מקשר מוזרות אם תשתמש בטפסי LCL ללא ממשקים." #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "" +msgstr "קובץ מידע הפרוייקט %s%s%s%s זהה לקובץ הקוד הראשי של הפרוייקט!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk msgid "The project information file %s%s%s%shas changed on disk." -msgstr "" +msgstr "קובץ מידע הפרוייקט %s%s%s%s השתנה על הדיסק." #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" -msgstr "" +msgstr "הפרוייקט חייב להשמר לפני הבנייה. אם תקבע את תיקיית הביקורת באפשרויות הסביבה, תוכל ליצור פרוייקטים חדשים ולבנות אותם מיד. לשמור את הפרוייקט?" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." -msgstr "" +msgstr "הפרוייקט משתמש כמטרה במערכת ההפעלה = s% ובמעבד = s%. הקובץ system.ppu עבור מטרה זאת לא נמצא בתיקיית הקבצים הבינאריים של FPC.ודא ש fpc מותקו כראוי עבור מטרה זאת ושהקובץ fpc.cfg מכיל את התיקיות הנכונות." #: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea msgid "The project uses the new FPC resources, which requires at least FPC 2.4" -msgstr "" +msgstr "הפרוייקט משתמש במשאבי FPC חדשים, אשר דורשים לפחות FPC 2.4" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "" +msgstr "יש קבצים נוספים בתיקייה בעלי אותו שם, אשר נבדלים רק בראשיות: האם למחוק אותם?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "" +msgstr "יש קובץ בעל אותו שם וסיומת דומה בדיסק קובץ: %s%s קובץ בעייתי: %s%s%s , האם למחוק את הבעייתי?" #: lazarusidestrconsts.listhereisalreadyabuildvarwiththename msgid "There is already a build variable with the name %s%s%s." -msgstr "" +msgstr "יש כבר משתנה בניה עם השם %s%s%s. " #: lazarusidestrconsts.listhereisalreadyacomponentwiththisname msgid "There is already a component with this name" -msgstr "" +msgstr "יש כבר רכיב עם שם זה. " #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" -msgstr "" +msgstr "יש כבר טופס עם השם %s%s%s. " #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." -msgstr "" +msgstr "יש כבר יחידה עם השם %s%s%s. מזהה פסקל חייב להיות ייחודי." #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" -msgstr "" +msgstr "יש כבר יחידה עם השם %s%s%s בפרוייקט. בחר שם אחר." #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." -msgstr "" +msgstr "ימחלקת המשאבים %s%s%sעברה בירושה מ s%s%s%. כנראה זאת שגיאת דפוס של TForm." #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" -msgstr "" +msgstr "הייתה שגיאה בזמן כתיבת הרכיב שנבחר %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" -msgstr "" +msgstr "הייתה שגיאה בזמן המרת הזרימה הבינארית של הרכיב שנבחר %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" -msgstr "" +msgstr "הייתה שגיאה בזמן העתקת זרימת הרכיב שנבחר ללוח הזמני:%s%s" #: lazarusidestrconsts.listherootcomponentcannotbedeleted msgid "The root component can not be deleted." -msgstr "" +msgstr "אי אפשר למחוק את רכיב השורש." #: lazarusidestrconsts.listhesesettingsarestoredwiththeproject msgid "These settings are stored with the project." -msgstr "" +msgstr "ההגדרות אוחסנו עם הפרוייקט." #: lazarusidestrconsts.listheseunitswerenotfound msgid "These units were not found:"