From d7c5f3c7250d4f5f85ac680295268a538b6bd25b Mon Sep 17 00:00:00 2001 From: maxim Date: Thu, 26 May 2011 20:05:11 +0000 Subject: [PATCH] Translations: Ukrainian translation update by Igor Paliychuk, bug #19424 git-svn-id: trunk@30916 - --- .gitattributes | 6 + .../languages/codetoolsstrconsts.uk.po | 125 +- .../languages/syndesignstringconstants.uk.po | 35 + .../synedit/languages/syneditstrconst.uk.po | 199 +-- .../synhighlighterunixshellscript.uk.po | 15 + .../synedit/languages/synmacrorecorder.uk.po | 9 +- doceditor/languages/lazde.uk.po | 661 +++++++++ ideintf/languages/objinspstrconsts.uk.po | 185 +-- languages/installerstrconsts.uk.po | 27 + languages/lazaruside.uk.po | 1208 +++++++---------- lcl/languages/lclstrconsts.uk.po | 507 +++---- tools/jsonviewer/languages/jsonviewer.uk.po | 309 +++++ .../languages/lazdatadesktop.uk.po | 780 +++++++++++ 13 files changed, 2869 insertions(+), 1197 deletions(-) create mode 100644 components/synedit/languages/syndesignstringconstants.uk.po create mode 100644 components/synedit/languages/synhighlighterunixshellscript.uk.po create mode 100644 doceditor/languages/lazde.uk.po create mode 100644 languages/installerstrconsts.uk.po create mode 100644 tools/jsonviewer/languages/jsonviewer.uk.po create mode 100644 tools/lazdatadesktop/languages/lazdatadesktop.uk.po diff --git a/.gitattributes b/.gitattributes index 7d90736a9f..07cfc8bcbc 100644 --- a/.gitattributes +++ b/.gitattributes @@ -2230,6 +2230,7 @@ components/synedit/languages/syndesignstringconstants.po svneol=native#text/plai components/synedit/languages/syndesignstringconstants.pt.po svneol=native#text/plain components/synedit/languages/syndesignstringconstants.pt_BR.po svneol=native#text/plain components/synedit/languages/syndesignstringconstants.ru.po svneol=native#text/plain +components/synedit/languages/syndesignstringconstants.uk.po svneol=native#text/plain components/synedit/languages/syneditstrconst.ca.po svneol=native#text/plain components/synedit/languages/syneditstrconst.cs.po svneol=native#text/plain components/synedit/languages/syneditstrconst.de.po svneol=native#text/plain @@ -2256,6 +2257,7 @@ components/synedit/languages/synhighlighterunixshellscript.po svneol=native#text components/synedit/languages/synhighlighterunixshellscript.pt.po svneol=native#text/plain components/synedit/languages/synhighlighterunixshellscript.pt_BR.po svneol=native#text/plain components/synedit/languages/synhighlighterunixshellscript.ru.po svneol=native#text/plain +components/synedit/languages/synhighlighterunixshellscript.uk.po svneol=native#text/plain components/synedit/languages/synhighlighterunixshellscript.zh_CN.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.ca.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.de.po svneol=native#text/plain @@ -2950,6 +2952,7 @@ doceditor/languages/lazde.po svneol=native#text/plain doceditor/languages/lazde.pt.po svneol=native#text/plain doceditor/languages/lazde.pt_BR.po svneol=native#text/plain doceditor/languages/lazde.ru.po svneol=native#text/plain +doceditor/languages/lazde.uk.po svneol=native#text/plain doceditor/lazde.ico -text svneol=unset#image/ico doceditor/lazde.lpi svneol=native#text/plain doceditor/lazde.lpr svneol=native#text/pascal @@ -4783,6 +4786,7 @@ languages/installerstrconsts.pt_BR.po svneol=native#text/plain languages/installerstrconsts.ru.po svneol=native#text/plain languages/installerstrconsts.sk.po svneol=native#text/plain languages/installerstrconsts.tr.po svneol=native#text/plain +languages/installerstrconsts.uk.po svneol=native#text/plain languages/installerstrconsts.zh_CN.po svneol=native#text/plain languages/lazaruside.af_ZA.po svneol=native#text/plain languages/lazaruside.ar.po svneol=native#text/plain @@ -6081,6 +6085,7 @@ tools/jsonviewer/languages/jsonviewer.po svneol=native#text/plain tools/jsonviewer/languages/jsonviewer.pt.po svneol=native#text/plain tools/jsonviewer/languages/jsonviewer.pt_BR.po svneol=native#text/plain tools/jsonviewer/languages/jsonviewer.ru.po svneol=native#text/plain +tools/jsonviewer/languages/jsonviewer.uk.po svneol=native#text/plain tools/jsonviewer/mainform.ico -text tools/jsonviewer/msgjsonviewer.pp svneol=native#text/plain tools/lazdatadesktop/README.txt svneol=native#text/plain @@ -6142,6 +6147,7 @@ tools/lazdatadesktop/languages/lazdatadesktop.po svneol=native#text/plain tools/lazdatadesktop/languages/lazdatadesktop.pt.po svneol=native#text/plain tools/lazdatadesktop/languages/lazdatadesktop.pt_BR.po svneol=native#text/plain tools/lazdatadesktop/languages/lazdatadesktop.ru.po svneol=native#text/plain +tools/lazdatadesktop/languages/lazdatadesktop.uk.po svneol=native#text/plain tools/lazdatadesktop/lazdatadeskstr.pas svneol=native#text/plain tools/lazdatadesktop/lazdatadesktop.lpi svneol=native#text/plain tools/lazdatadesktop/lazdatadesktop.lpr svneol=native#text/plain diff --git a/components/codetools/languages/codetoolsstrconsts.uk.po b/components/codetools/languages/codetoolsstrconsts.uk.po index 998e14a8a4..8dde06ad15 100644 --- a/components/codetools/languages/codetoolsstrconsts.uk.po +++ b/components/codetools/languages/codetoolsstrconsts.uk.po @@ -1,5 +1,10 @@ msgid "" msgstr "" +"Last-Translator: Igor Paliychuk \n" +"Project-Id-Version: lazaruside\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-25 14:33+0200\n" +"Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" @@ -26,7 +31,7 @@ msgstr "" #: codetoolsstrconsts.ctsaddsdirtoincludepath msgid "adds %s to IncPath" -msgstr "" +msgstr "додає %s до IncPath" #: codetoolsstrconsts.ctsaddsdirtosourcepath msgid "adds %s to SrcPath" @@ -42,7 +47,7 @@ msgstr "проект LCL" #: codetoolsstrconsts.ctsanonymdefinitionsarenotallowed msgid "Anonymous %s definitions are not allowed" -msgstr "" +msgstr "Анонімні %s визначення не дозволені" #: codetoolsstrconsts.ctsawithoutb msgid "%s without %s" @@ -54,7 +59,7 @@ msgstr "не знайдений основний тип \"%s\"" #: codetoolsstrconsts.ctsbeginatwithoutend msgid "begin at %s without end" -msgstr "" +msgstr "початок на %s без кінця" #: codetoolsstrconsts.ctsbinaryoperator msgid "binary operator" @@ -74,7 +79,7 @@ msgstr "очікується відкриваюча дужка, але знай #: codetoolsstrconsts.ctscharacterconstantoutofrange msgid "character constant out of range" -msgstr "" +msgstr "символьна константа поза допустимими межами" #: codetoolsstrconsts.ctscircleindefinitions msgid "circle in definitions" @@ -130,7 +135,7 @@ msgstr "константа" #: codetoolsstrconsts.ctsconverterdirectory msgid "Converter Directory" -msgstr "" +msgstr "Каталог Конвертера" #: codetoolsstrconsts.ctscpudirectory msgid "CPU directory" @@ -154,23 +159,23 @@ msgstr "не знайдений клас-предок за замовчуван #: codetoolsstrconsts.ctsdefaultfpcsource2operatingsystem msgid "Default fpc source Operating System 2" -msgstr "" +msgstr "Типова Операційна Система вихідного коду fpc 2" #: codetoolsstrconsts.ctsdefaultfpcsourceoperatingsystem msgid "Default fpc source Operating System" -msgstr "" +msgstr "Типова Операційна Система вихідного коду fpc" #: codetoolsstrconsts.ctsdefaultfpcsymbol msgid "Default fpc symbol" -msgstr "" +msgstr "Символ fpc за замовчуванням" #: codetoolsstrconsts.ctsdefaultfpctargetoperatingsystem msgid "Default fpc target Operating System" -msgstr "" +msgstr "Цільова Операційна Система fpc за зомовчуванням" #: codetoolsstrconsts.ctsdefaultfpctargetprocessor msgid "Default fpc target processor" -msgstr "" +msgstr "Цільовий процесор fpc за зомовчуванням" #: codetoolsstrconsts.ctsdefaultinterfaceancestoriinterfacenotfound msgid "default interface ancestor IInterface not found" @@ -182,7 +187,7 @@ msgstr "очікується параметр за замовчуванням, #: codetoolsstrconsts.ctsdefaultpropertynotfound msgid "default property not found" -msgstr "" +msgstr "стандартна властивість не знайдена" #: codetoolsstrconsts.ctsdefaultspecifierredefined msgid "default specifier redefined" @@ -194,11 +199,11 @@ msgstr "Визначити " #: codetoolsstrconsts.ctsdefinelcl msgid "Define LCL" -msgstr "" +msgstr "Визначити LCL" #: codetoolsstrconsts.ctsdefinelclwidgetset msgid "Define LCLwidgetset, e.g. LCLgtk" -msgstr "" +msgstr "Визначити LCLwidgetset, напр. LCLgtk" #: codetoolsstrconsts.ctsdefinemacrocarbon1 msgid "Define macro carbon1" @@ -218,11 +223,11 @@ msgstr "Визначити макрос %s" #: codetoolsstrconsts.ctsdefinemacroqt1 msgid "Define macro qt1" -msgstr "" +msgstr "Визначити макрос qt1" #: codetoolsstrconsts.ctsdefinemacrowince1 msgid "Define macro wince1" -msgstr "" +msgstr "Визначити макрос wince1" #: codetoolsstrconsts.ctsdefineprocessortype msgid "Define processor type" @@ -250,11 +255,11 @@ msgstr "тека компонентів в %s не є текою" #: codetoolsstrconsts.ctsdispidparameterexpectedbutatomfound msgid "dispid parameter expected, but %s found" -msgstr "" +msgstr "очікується параметр dispid, але знайдено %s" #: codetoolsstrconsts.ctsdispidspecifierredefined msgid "dispid specifier redefined" -msgstr "" +msgstr "специфікатор dispid перевизначений" #: codetoolsstrconsts.ctsdoceditordirectory msgid "Doc Editor Directory" @@ -278,21 +283,19 @@ msgstr "не знайдений кінець запису" #: codetoolsstrconsts.ctsendoffile msgid "end of file" -msgstr "" +msgstr "кінець файлу" #: codetoolsstrconsts.ctsendofsourceexpectedbutatomfound msgid "expected end., but %s found" msgstr "очікується end., а знайдено %s" #: codetoolsstrconsts.ctsendofsourcenotfound -#, fuzzy -#| msgid "End of source not found" msgid "End of source not found." -msgstr "Не знайдено кінця коду" +msgstr "Не знайдено кінця коду." #: codetoolsstrconsts.ctsenumerationtype msgid "enumeration type" -msgstr "" +msgstr "перераховуваний тип" #: codetoolsstrconsts.ctserrorduringcreationofnewprocbodies msgid "error during creation of new proc bodies" @@ -304,7 +307,7 @@ msgstr "помилка при вставці нових частин класу" #: codetoolsstrconsts.ctserrorduringinsertingnewusessection msgid "error during inserting new units to the main uses section" -msgstr "" +msgstr "помилка під час вставляння нових модулів в основну секцію uses" #: codetoolsstrconsts.ctserrorindirectiveexpression msgid "error in directive expression" @@ -320,23 +323,23 @@ msgstr "немає доступу до виконання %s" #: codetoolsstrconsts.ctsexpectedbutfound msgid "expected (, but found %s" -msgstr "" +msgstr "очікується (, але знайдено %s" #: codetoolsstrconsts.ctsexpectedbutfound2 msgid "expected ), but found %s" -msgstr "" +msgstr "очікується ), але знайдено %s" #: codetoolsstrconsts.ctsexpectedbutfound3 msgid "expected :=, but %s found" -msgstr "" +msgstr "очікується :=, але знайдено %s" #: codetoolsstrconsts.ctsexpectedidentifierbutfound msgid "expected identifier, but found %s" -msgstr "" +msgstr "очікується ідентифікатор, але знайдено %s" #: codetoolsstrconsts.ctsexpectedstatementbutfound msgid "expected statement, but found %s" -msgstr "" +msgstr "очікується інструкція, але знайдено %s" #: codetoolsstrconsts.ctsexportsclauseonlyallowedinlibraries msgid "exports clause only allowed in libraries" @@ -364,7 +367,7 @@ msgstr "файл тільки для читання" #: codetoolsstrconsts.ctsforward msgid "Forward" -msgstr "" +msgstr "Вперед" #: codetoolsstrconsts.ctsforwardclassdefinitionnotresolved msgid "Forward class definition not resolved: %s" @@ -372,7 +375,7 @@ msgstr "Не знайдено опису раніше описаного кла #: codetoolsstrconsts.ctsfpdocsystemon msgid "enable FPDocSystem" -msgstr "" +msgstr "ввімкнути FPDocSystem" #: codetoolsstrconsts.ctsfreepascalcompilerinitialmacros msgid "Free Pascal Compiler initial macros" @@ -393,16 +396,16 @@ msgstr "Коди FreePascal, %s" #: codetoolsstrconsts.ctsfunctiongetenumeratornotfoundinthisclass msgctxt "codetoolsstrconsts.ctsfunctiongetenumeratornotfoundinthisclass" msgid "function GetEnumerator not found in this class" -msgstr "" +msgstr "функція GetEnumerator не знайдена в цьому класі" #: codetoolsstrconsts.ctsfunctiongetenumeratornotfoundinthisclass2 msgctxt "codetoolsstrconsts.ctsfunctiongetenumeratornotfoundinthisclass2" msgid "function GetEnumerator not found in this class" -msgstr "" +msgstr "функція GetEnumerator не знайдена в цьому класі" #: codetoolsstrconsts.ctsgenericidentifier msgid "generic identifier" -msgstr "" +msgstr "універсальний ідентифікатор" #: codetoolsstrconsts.ctsgtk2intfdirectory msgid "gtk2 interface directory" @@ -410,7 +413,7 @@ msgstr "тека інтерфейсу gtk2" #: codetoolsstrconsts.ctshaserror msgid "HasError" -msgstr "" +msgstr "HasError" #: codetoolsstrconsts.ctsidedirectory msgid "IDE Directory" @@ -446,27 +449,27 @@ msgstr "не знайдений ідентифікатор: %s" #: codetoolsstrconsts.ctsifdeflinux msgid "IfDef Linux" -msgstr "" +msgstr "IfDef Linux" #: codetoolsstrconsts.ctsifdefwindows msgid "IfDef Windows" -msgstr "" +msgstr "IfDef Windows" #: codetoolsstrconsts.ctsiflclwidgettypeequalsgtk2 msgid "If LCLWidgetType=gtk2 then" -msgstr "" +msgstr "Якщо LCLWidgetType=gtk2 тоді" #: codetoolsstrconsts.ctsiftargetosisnotsrcos msgid "If TargetOS<>SrcOS" -msgstr "" +msgstr "Якщо TargetOS<>SrcOS" #: codetoolsstrconsts.ctsiftargetosisnotsrcos2 msgid "If TargetOS<>SrcOS2" -msgstr "" +msgstr "Якщо TargetOS<>SrcOS2" #: codetoolsstrconsts.ctsiftargetosisnotwin32 msgid "If TargetOS<>win32 then" -msgstr "" +msgstr "Якщо TargetOS<>win32 тоді" #: codetoolsstrconsts.ctsillegalcircleinusedunits msgid "illegal circle using unit: %s" @@ -486,7 +489,7 @@ msgstr "Знайдене циклічне включення" #: codetoolsstrconsts.ctsincludedirectoriesplusdirs msgid "include directories: %s" -msgstr "" +msgstr "включити каталоги: %s" #: codetoolsstrconsts.ctsincludefilenotfound msgid "include file not found \"%s\"" @@ -546,11 +549,11 @@ msgstr "неправильний режим \"%s\"" #: codetoolsstrconsts.ctsinvalidmodeswitch msgid "invalid mode switch \"%s\"" -msgstr "" +msgstr "невірний перемикач режиму \"%s\"" #: codetoolsstrconsts.ctsinvalidoperator msgid "invalid operator %s" -msgstr "" +msgstr "невірний оператор %s" #: codetoolsstrconsts.ctsinvalidsubrange msgid "invalid subrange" @@ -602,7 +605,7 @@ msgstr "не знайдений опис типу методу" #: codetoolsstrconsts.ctsmissing msgid "missing :=" -msgstr "" +msgstr "втрачено :=" #: codetoolsstrconsts.ctsmissingenumlist msgid "missing enum list" @@ -630,7 +633,7 @@ msgstr "Ввімкн. вкладені коментарі" #: codetoolsstrconsts.ctsnesteddefinitionsarenotallowed msgid "Nested %s definitions are not allowed" -msgstr "" +msgstr "Вкладені %s визначення не дозволені" #: codetoolsstrconsts.ctsnewprocbodynotfound msgid "new proc body not found" @@ -666,19 +669,19 @@ msgstr "не знайдений старий метод: %s" #: codetoolsstrconsts.ctsoperandexpectedbutfound msgid "operand expected but %s found" -msgstr "" +msgstr "очікується операнд але знайдено %s" #: codetoolsstrconsts.ctsoperandexpectedbutfound2 msgid "operand expected, but %s found" -msgstr "" +msgstr "очікується операнд, але знайдено %s" #: codetoolsstrconsts.ctsoperatorexpectedbutfound msgid "operator expected but %s found" -msgstr "" +msgstr "очікується оператор але знайдено %s" #: codetoolsstrconsts.ctsoperatorexpectedbutfound2 msgid "operator expected, but %s found" -msgstr "" +msgstr "очікується оператор, але знайдено %s" #: codetoolsstrconsts.ctsothercompilerdefines msgid "%s Compiler Defines" @@ -714,7 +717,7 @@ msgstr "Позиція не в прогрмному тексті" #: codetoolsstrconsts.ctsprocedureorfunctionorconstructorordestructor msgid "procedure or function or constructor or destructor" -msgstr "" +msgstr "процедура або функція або конструктор або деструктор" #: codetoolsstrconsts.ctsprocessorspecific msgid "processor specific" @@ -726,7 +729,7 @@ msgstr "очікується тип властивості, але знайде #: codetoolsstrconsts.ctspropertycurrentnotfound msgid "property Current not found" -msgstr "" +msgstr "властивість Current не знайдена" #: codetoolsstrconsts.ctspropertyspecifieralreadydefined msgid "property specifier already defined: %s" @@ -742,7 +745,7 @@ msgstr "Скинути всі визначення" #: codetoolsstrconsts.ctsresulttypeoffunctiongetenumeratornotfound msgid "result type of function GetEnumerator not found" -msgstr "" +msgstr "тип результату функції GetEnumerator не знайдений" #: codetoolsstrconsts.ctsruntimelibrary msgid "Runtime library" @@ -750,7 +753,7 @@ msgstr "Бібліотека часу виконання" #: codetoolsstrconsts.ctsscannedfiles msgid "Scanned files: %s" -msgstr "" +msgstr "Проскановані файли: %s" #: codetoolsstrconsts.ctssemicolonafterpropspecmissing msgid "; expected after \"%s\" property specifier, but %s found" @@ -782,7 +785,7 @@ msgstr "текст програми не знайдений: модуль %s" #: codetoolsstrconsts.ctssourceofunitnotfound msgid "source of unit not found: %s" -msgstr "" +msgstr "джерело або модуль не знайдені: %s" #: codetoolsstrconsts.ctssrcpathforcompiledunits msgid "src path for compiled units" @@ -806,7 +809,7 @@ msgstr "Помилка синтаксису в виразі \"%s\"" #: codetoolsstrconsts.ctstcodetoolmanagerconsistencycheck msgid "TCodeToolManager.ConsistencyCheck=%d" -msgstr "" +msgstr "TCodeToolManager.ConsistencyCheck=%d" #: codetoolsstrconsts.ctstermnotsimple msgid "Term has no simple type" @@ -814,7 +817,7 @@ msgstr "Визначення не має простого типу" #: codetoolsstrconsts.ctsthenexpectedbutfound msgid "then expected, but %s found" -msgstr "" +msgstr "очікується then, але знайдено %s" #: codetoolsstrconsts.ctstoolsdirectory msgid "Tools Directory" @@ -822,7 +825,7 @@ msgstr "Тека інструментів" #: codetoolsstrconsts.ctstype msgid "type" -msgstr "" +msgstr "тип" #: codetoolsstrconsts.ctstypeidentifier msgid "type identifier" @@ -830,7 +833,7 @@ msgstr "ідентифікатор типу" #: codetoolsstrconsts.ctstypeisonlyallowedingenericsendofclassnotfound msgid "type is only allowed in generics, end of class not found" -msgstr "" +msgstr "type дозволено лише в загальних, кінець класу не знайдено" #: codetoolsstrconsts.ctstypesectionofclassnotfound msgid "type section of class not found" @@ -846,7 +849,7 @@ msgstr "не можу завершити властивість" #: codetoolsstrconsts.ctsundefine msgid "Undefine " -msgstr "" +msgstr "Видалити визначення " #: codetoolsstrconsts.ctsunexpectedendofsource msgid "unexpected end of source" @@ -858,7 +861,7 @@ msgstr "неочікуване ключове слово \"%s\"" #: codetoolsstrconsts.ctsunexpectedkeyword2 msgid "unexpected keyword %s" -msgstr "" +msgstr "неочікуване ключове слово %s" #: codetoolsstrconsts.ctsunexpectedkeywordinasmblock msgid "unexpected keyword \"%s\" in asm block found" @@ -914,7 +917,7 @@ msgstr "Теки інструментів" #: codetoolsstrconsts.ctsvarisonlyallowedingenericsendofclassnotfound msgid "var is only allowed in generics, end of class not found" -msgstr "" +msgstr "var дозволено лише в загальних, кінець класу не знайдено" #: codetoolsstrconsts.ctswidgetdirectory msgid "Widget Directory" diff --git a/components/synedit/languages/syndesignstringconstants.uk.po b/components/synedit/languages/syndesignstringconstants.uk.po new file mode 100644 index 0000000000..9a2a03db19 --- /dev/null +++ b/components/synedit/languages/syndesignstringconstants.uk.po @@ -0,0 +1,35 @@ +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Transfer-Encoding: 8bit\n" + +#: syndesignstringconstants.syndsbookmarks +msgid "Bookmarks" +msgstr "Закладки" + +#: syndesignstringconstants.syndschangemarker +msgid "Change Marker" +msgstr "Маркер Зміни" + +#: syndesignstringconstants.syndscodefolding +msgid "Code Folding" +msgstr "Згортання Коду" + +#: syndesignstringconstants.syndslinenumbers +msgid "Line Numbers" +msgstr "Номери Рядків" + +#: syndesignstringconstants.syndslineoverview +msgid "Line Overview" +msgstr "Огляд Ліній" + +#: syndesignstringconstants.syndsseparator +msgid "Separator" +msgstr "Роздільник" + diff --git a/components/synedit/languages/syneditstrconst.uk.po b/components/synedit/languages/syneditstrconst.uk.po index 1aa877e52e..054b000bb7 100644 --- a/components/synedit/languages/syneditstrconst.uk.po +++ b/components/synedit/languages/syneditstrconst.uk.po @@ -1,24 +1,29 @@ msgid "" msgstr "" +"Last-Translator: Igor Paliychuk \n" +"Project-Id-Version: lazaruside\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-25 15:03+0200\n" +"Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: syneditstrconst.syns_attrasp msgid "Asp" -msgstr "" +msgstr "Asp" #: syneditstrconst.syns_attrassembler msgid "Assembler" -msgstr "" +msgstr "Асемблер" #: syneditstrconst.syns_attrattributename msgid "Attribute Name" -msgstr "" +msgstr "Назва Атрибуту" #: syneditstrconst.syns_attrattributevalue msgid "Attribute Value" -msgstr "" +msgstr "Значення Атрибуту" #: syneditstrconst.syns_attrblock msgid "Block" @@ -26,7 +31,7 @@ msgstr "" #: syneditstrconst.syns_attrbrackets msgid "Brackets" -msgstr "" +msgstr "Дужки" #: syneditstrconst.syns_attrcaselabel msgid "Case label" @@ -34,11 +39,11 @@ msgstr "" #: syneditstrconst.syns_attrcdatasection msgid "CDATA Section" -msgstr "" +msgstr "Секція CDATA" #: syneditstrconst.syns_attrcharacter msgid "Character" -msgstr "" +msgstr "Символ" #: syneditstrconst.syns_attrchunkmarker msgid "Diff Chunk Marker" @@ -58,51 +63,51 @@ msgstr "" #: syneditstrconst.syns_attrclass msgid "Class" -msgstr "" +msgstr "Клас" #: syneditstrconst.syns_attrcomment msgid "Comment" -msgstr "" +msgstr "Коментар" #: syneditstrconst.syns_attrcondition msgid "Condition" -msgstr "" +msgstr "Умова" #: syneditstrconst.syns_attrdatatype msgid "Data type" -msgstr "" +msgstr "Тип даних" #: syneditstrconst.syns_attrdefaultpackage msgid "Default packages" -msgstr "" +msgstr "Пакунки за замовчуванням" #: syneditstrconst.syns_attrdir msgid "Direction" -msgstr "" +msgstr "Напрямок" #: syneditstrconst.syns_attrdirective msgid "Directive" -msgstr "" +msgstr "Директива" #: syneditstrconst.syns_attrdoctypesection msgid "DOCTYPE Section" -msgstr "" +msgstr "Секція DOCTYPE" #: syneditstrconst.syns_attrdocumentation msgid "Documentation" -msgstr "" +msgstr "Документація" #: syneditstrconst.syns_attrelementname msgid "Element Name" -msgstr "" +msgstr "Назва Елемента" #: syneditstrconst.syns_attrembedsql msgid "Embedded SQL" -msgstr "" +msgstr "Вбудований SQL" #: syneditstrconst.syns_attrembedtext msgid "Embedded text" -msgstr "" +msgstr "Вбудований текст" #: syneditstrconst.syns_attrentityreference msgid "Entity Reference" @@ -114,27 +119,27 @@ msgstr "" #: syneditstrconst.syns_attrevent msgid "Event" -msgstr "" +msgstr "Подія" #: syneditstrconst.syns_attrexception msgid "Exception" -msgstr "" +msgstr "Виняток" #: syneditstrconst.syns_attrfloat msgid "Float" -msgstr "" +msgstr "Плаваюча Точка" #: syneditstrconst.syns_attrform msgid "Form" -msgstr "" +msgstr "Форма" #: syneditstrconst.syns_attrfunction msgid "Function" -msgstr "" +msgstr "Функція" #: syneditstrconst.syns_attrhexadecimal msgid "Hexadecimal" -msgstr "" +msgstr "Шістнадцятковий" #: syneditstrconst.syns_attricon msgid "Icon reference" @@ -142,47 +147,47 @@ msgstr "" #: syneditstrconst.syns_attridedirective msgid "IDE Directive" -msgstr "" +msgstr "Директива IDE" #: syneditstrconst.syns_attridentifier msgid "Identifier" -msgstr "" +msgstr "Ідентифікатор" #: syneditstrconst.syns_attrillegalchar msgid "Illegal char" -msgstr "" +msgstr "Недозволений символ" #: syneditstrconst.syns_attrinclude msgid "Include" -msgstr "" +msgstr "Включити" #: syneditstrconst.syns_attrindirect msgid "Indirect" -msgstr "" +msgstr "Непрямий" #: syneditstrconst.syns_attrinternalfunction msgid "Internal function" -msgstr "" +msgstr "Внутрішня функція" #: syneditstrconst.syns_attrinvalidsymbol msgid "Invalid symbol" -msgstr "" +msgstr "Невірний символ" #: syneditstrconst.syns_attrkey msgid "Key" -msgstr "" +msgstr "Клавіша" #: syneditstrconst.syns_attrlabel msgid "Label" -msgstr "" +msgstr "Мітка" #: syneditstrconst.syns_attrlineadded msgid "Diff Added line" -msgstr "" +msgstr "Порівняти Доданий рядок" #: syneditstrconst.syns_attrlinechanged msgid "Diff Changed Line" -msgstr "" +msgstr "Порівняти Змінений рядок" #: syneditstrconst.syns_attrlinecontext msgid "Diff Context Line" @@ -190,27 +195,27 @@ msgstr "" #: syneditstrconst.syns_attrlineremoved msgid "Diff Removed Line" -msgstr "" +msgstr "Порівняти Видалений рядок" #: syneditstrconst.syns_attrmacro msgid "Macro" -msgstr "" +msgstr "Макрос" #: syneditstrconst.syns_attrmarker msgid "Marker" -msgstr "" +msgstr "Маркер" #: syneditstrconst.syns_attrmathmode msgid "Math Mode" -msgstr "" +msgstr "Математичний Режим" #: syneditstrconst.syns_attrmessage msgid "Message" -msgstr "" +msgstr "Повідомлення" #: syneditstrconst.syns_attrmiscellaneous msgid "Miscellaneous" -msgstr "" +msgstr "Різне" #: syneditstrconst.syns_attrnamespaceattrname msgid "Namespace Attribute Name" @@ -222,7 +227,7 @@ msgstr "" #: syneditstrconst.syns_attrnewfile msgid "Diff New File" -msgstr "" +msgstr "Порівняти Новий Файл" #: syneditstrconst.syns_attrnonreservedkeyword msgid "Non-reserved keyword" @@ -238,19 +243,19 @@ msgstr "" #: syneditstrconst.syns_attroctal msgid "Octal" -msgstr "" +msgstr "Вісімковий" #: syneditstrconst.syns_attroperator msgid "Operator" -msgstr "" +msgstr "Оператор" #: syneditstrconst.syns_attrorigfile msgid "Diff Original File" -msgstr "" +msgstr "Порівняти Оригінальний Файл" #: syneditstrconst.syns_attrplsql msgid "Reserved word (PL/SQL)" -msgstr "" +msgstr "Зарезервоване слово (PL/SQL)" #: syneditstrconst.syns_attrpragma msgid "Pragma" @@ -258,7 +263,7 @@ msgstr "" #: syneditstrconst.syns_attrpreprocessor msgid "Preprocessor" -msgstr "" +msgstr "Препроцесор" #: syneditstrconst.syns_attrprocessinginstr msgid "Processing Instruction" @@ -266,7 +271,7 @@ msgstr "" #: syneditstrconst.syns_attrqualifier msgid "Qualifier" -msgstr "" +msgstr "Визначник" #: syneditstrconst.syns_attrregister msgid "Register" @@ -274,87 +279,87 @@ msgstr "" #: syneditstrconst.syns_attrreservedword msgid "Reserved word" -msgstr "" +msgstr "Зарезервоване слово" #: syneditstrconst.syns_attrroundbracket msgid "Round Bracket" -msgstr "" +msgstr "Кругла Дужка" #: syneditstrconst.syns_attrrpl msgid "Rpl" -msgstr "" +msgstr "Rpl" #: syneditstrconst.syns_attrrplcomment msgid "Rpl comment" -msgstr "" +msgstr "Коментар Rpl" #: syneditstrconst.syns_attrrplkey msgid "Rpl key" -msgstr "" +msgstr "Ключ Rpl" #: syneditstrconst.syns_attrsasm msgid "SASM" -msgstr "" +msgstr "SASM" #: syneditstrconst.syns_attrsasmcomment msgid "SASM Comment" -msgstr "" +msgstr "Коментар SASM" #: syneditstrconst.syns_attrsasmkey msgid "SASM Key" -msgstr "" +msgstr "Ключ SASM" #: syneditstrconst.syns_attrsecondreservedword msgid "Second reserved word" -msgstr "" +msgstr "Друге зарезервоване слово" #: syneditstrconst.syns_attrsection msgid "Section" -msgstr "" +msgstr "Секція" #: syneditstrconst.syns_attrspace msgid "Space" -msgstr "" +msgstr "Пробіл" #: syneditstrconst.syns_attrspecialvariable msgid "Special variable" -msgstr "" +msgstr "Спеціальна Змінна" #: syneditstrconst.syns_attrsqlkey msgid "SQL keyword" -msgstr "" +msgstr "Ключове слово SQL" #: syneditstrconst.syns_attrsqlplus msgid "SQL*Plus command" -msgstr "" +msgstr "Команда SQL*Plus" #: syneditstrconst.syns_attrsquarebracket msgid "Square Bracket" -msgstr "" +msgstr "Квадратна Дужка" #: syneditstrconst.syns_attrstring msgid "String" -msgstr "" +msgstr "Рядок" #: syneditstrconst.syns_attrsymbol msgid "Symbol" -msgstr "" +msgstr "Символ" #: syneditstrconst.syns_attrsyntaxerror msgid "SyntaxError" -msgstr "" +msgstr "СинтаксПомилка" #: syneditstrconst.syns_attrsystem msgid "System functions and variables" -msgstr "" +msgstr "Системні функції та змінні" #: syneditstrconst.syns_attrsystemvalue msgid "System value" -msgstr "" +msgstr "Системне значення" #: syneditstrconst.syns_attrtablename msgid "Table Name" -msgstr "" +msgstr "Назва Таблиці" #: syneditstrconst.syns_attrterminator msgid "Terminator" @@ -362,43 +367,41 @@ msgstr "" #: syneditstrconst.syns_attrtexcommand msgid "TeX Command" -msgstr "" +msgstr "Команда TeX" #: syneditstrconst.syns_attrtext msgid "Text" -msgstr "" +msgstr "Текст" #: syneditstrconst.syns_attrtextmathmode msgid "Text in Math Mode" -msgstr "" +msgstr "Текст в Математичному Режимі" #: syneditstrconst.syns_attrunknownword msgid "Unknown word" -msgstr "" +msgstr "Невідоме слово" #: syneditstrconst.syns_attruser msgid "User functions and variables" -msgstr "" +msgstr "Функції та змінні користувача" #: syneditstrconst.syns_attruserfunction msgid "User functions" -msgstr "" +msgstr "Функції користувача" #: syneditstrconst.syns_attrvalue msgid "Value" -msgstr "" +msgstr "Значення" #: syneditstrconst.syns_attrvariable msgid "Variable" -msgstr "" +msgstr "Змінна" #: syneditstrconst.syns_attrwhitespace msgid "Whitespace" -msgstr "" +msgstr "Пробіл" #: syneditstrconst.syns_duplicateshortcutmsg -#, fuzzy -#| msgid "Shortcut already exists" msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" msgstr "Комбінацію \"%s\" вже присвоєно іншій команді редактора. (%s)" @@ -408,11 +411,11 @@ msgstr "Комбінація вже існує" #: syneditstrconst.syns_emcbreakpointtoggle msgid "Toggle Breakpoint" -msgstr "" +msgstr "Поміняти Точку Зипинки" #: syneditstrconst.syns_emccodefoldcollaps msgid "Fold Code" -msgstr "" +msgstr "Згорнути Код" #: syneditstrconst.syns_emccodefoldcollaps_opt msgid "Nodes,One,All,\"At Caret\",\"Current Node\"" @@ -420,11 +423,11 @@ msgstr "" #: syneditstrconst.syns_emccodefoldcontextmenu msgid "Fold Menu" -msgstr "" +msgstr "Згорнути Меню" #: syneditstrconst.syns_emccodefoldexpand msgid "Unfold Code" -msgstr "" +msgstr "Розгорнути Код" #: syneditstrconst.syns_emccodefoldexpand_opt msgid "Nodes,One,All" @@ -432,7 +435,7 @@ msgstr "" #: syneditstrconst.syns_emccontextmenu msgid "Popup Menu" -msgstr "" +msgstr "Спливаюче Меню" #: syneditstrconst.syns_emccontextmenucaretmove_opt msgid "\"Move caret, when selection exists\", Never, \"Click outside\", Always" @@ -448,7 +451,7 @@ msgstr "" #: syneditstrconst.syns_emcnone msgid "No Action" -msgstr "" +msgstr "Без Дії" #: syneditstrconst.syns_emcpasteselection msgid "Quick Paste Selection" @@ -460,39 +463,39 @@ msgstr "" #: syneditstrconst.syns_emcselectline msgid "Select Line" -msgstr "" +msgstr "Вибрати Рядок" #: syneditstrconst.syns_emcselectline_opt msgid "\"Include spaces\",no,yes" -msgstr "" +msgstr "\"включити пробіли\",no,yes" #: syneditstrconst.syns_emcselectpara msgid "Select Paragraph" -msgstr "" +msgstr "Вибрати Параграф" #: syneditstrconst.syns_emcselectword msgid "Select Word" -msgstr "" +msgstr "Вибрати Слово" #: syneditstrconst.syns_emcstartcolumnselections msgid "Column Selection" -msgstr "" +msgstr "Вибір Стовпчика" #: syneditstrconst.syns_emcstartdragmove msgid "Drag Selection" -msgstr "" +msgstr "Вибір Перетягування" #: syneditstrconst.syns_emcstartlineselections msgid "Line Selection" -msgstr "" +msgstr "Вибір Рядка" #: syneditstrconst.syns_emcstartselection msgid "Selection" -msgstr "" +msgstr "Вибір" #: syneditstrconst.syns_emcsyneditcommand msgid "IDE Command" -msgstr "" +msgstr "Команда IDE" #: syneditstrconst.syns_exporterformathtml msgid "HTML" @@ -540,7 +543,7 @@ msgstr "Звіти CPM (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" #: syneditstrconst.syns_filtercpp msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" -msgstr "" +msgstr "Файли C++ (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" #: syneditstrconst.syns_filtercss msgid "Cascading Stylesheets (*.css)|*.css" @@ -696,5 +699,5 @@ msgstr "<ніякі>" #: syneditstrconst.syns_untitled msgid "Untitled" -msgstr "" +msgstr "Без_Заголовка" diff --git a/components/synedit/languages/synhighlighterunixshellscript.uk.po b/components/synedit/languages/synhighlighterunixshellscript.uk.po new file mode 100644 index 0000000000..4c87630a2a --- /dev/null +++ b/components/synedit/languages/synhighlighterunixshellscript.uk.po @@ -0,0 +1,15 @@ +msgid "" +msgstr "" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-24 23:54+0200\n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" + +#: synhighlighterunixshellscript.langname +msgid "UNIX Shell Script" +msgstr "Сценарій Оболонки UNIX" + diff --git a/components/synedit/languages/synmacrorecorder.uk.po b/components/synedit/languages/synmacrorecorder.uk.po index 701504e4c7..8f8429d870 100644 --- a/components/synedit/languages/synmacrorecorder.uk.po +++ b/components/synedit/languages/synmacrorecorder.uk.po @@ -1,5 +1,10 @@ msgid "" msgstr "" +"Last-Translator: Igor Paliychuk \n" +"Project-Id-Version: lazaruside\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-24 23:55+0200\n" +"Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" @@ -10,11 +15,11 @@ msgstr "Можу лише призупинитись, коли записую" #: synmacrorecorder.scannotplay msgid "Cannot playback macro when recording" -msgstr "Не можу скасувати макрос, під час запису" +msgstr "Не можу відтворити макрос під час запису" #: synmacrorecorder.scannotrecord msgid "Cannot record macro when recording" -msgstr "Не можу писати макрос, під час запису" +msgstr "Не можу писати макрос під час запису" #: synmacrorecorder.scannotresume msgid "Can only resume when paused" diff --git a/doceditor/languages/lazde.uk.po b/doceditor/languages/lazde.uk.po new file mode 100644 index 0000000000..cec7afbb72 --- /dev/null +++ b/doceditor/languages/lazde.uk.po @@ -0,0 +1,661 @@ +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Transfer-Encoding: 8bit\n" + +#: lazdemsg.saboutformcaption +msgid "About this application" +msgstr "Про цю програму" + +#: lazdemsg.sadd +msgid "&Add" +msgstr "&Додати" + +#: lazdemsg.saddall +msgid "Add All" +msgstr "Додати Всі" + +#: lazdemsg.sadddescriptionfile +msgid "Select a new description file" +msgstr "Виберіть новий файл опису" + +#: lazdemsg.sbuild +msgctxt "lazdemsg.sbuild" +msgid "&Build" +msgstr "По&будувати" + +#: lazdemsg.sbuilddocumentation +msgid "Build documentation" +msgstr "Збирання документації" + +#: lazdemsg.sbuildok +msgid "Documentation successfully built." +msgstr "Документація успішно зібрана." + +#: lazdemsg.sbuildoutput +msgid "Build output" +msgstr "Вивід збирання" + +#: lazdemsg.sclose +msgctxt "lazdemsg.sclose" +msgid "&Close" +msgstr "&Закрити" + +#: lazdemsg.scodeexample +msgid "Example code File" +msgstr "Файл прикладу коду" + +#: lazdemsg.scopyright1 +msgid "This application is (c) by Michael Van Canneyt and the Lazarus team" +msgstr "" + +#: lazdemsg.scopyright2 +msgid "It is released under the terms of the GENERAL PUBLIC LICENSE:" +msgstr "" + +#: lazdemsg.scpu +msgid "CPU" +msgstr "Процесор" + +#: lazdemsg.screatecontentfile +msgid "Create cont&ent file" +msgstr "" + +#: lazdemsg.sdataforelement +msgid "Documentation for element \"%s\":" +msgstr "Документація для елемента \"%s\":" + +#: lazdemsg.sdelete +msgid "&Delete" +msgstr "&Видалити" + +#: lazdemsg.sdeletemodule +msgid "Are you sure you want to delete module \"%s\" ?" +msgstr "Ви точно хочете видалити модуль \"%s\" ?" + +#: lazdemsg.sdeletepackage +msgid "Are you sure you want to delete package \"%s\" ?" +msgstr "Ви точно хочете видалити пакунок \"%s\" ?" + +#: lazdemsg.sdeletetopic +msgid "Are you sure you want to delete topic \"%s\" ?" +msgstr "Ви точно хочете видалити тему \"%s\" ?" + +#: lazdemsg.sdescription +msgid "Description" +msgstr "Опис" + +#: lazdemsg.sedit +msgid "&Edit" +msgstr "&Редагувати" + +#: lazdemsg.seditdescriptionfile +msgid "Change description file" +msgstr "Змінити файл опису" + +#: lazdemsg.serrfpdoc +msgid "Building failed with exit code %d. Please check log." +msgstr "" + +#: lazdemsg.serrnomoduleforelement +msgid "No module found to insert element \"%s\"" +msgstr "" + +#: lazdemsg.serrnonodeformodule +msgid "No node found for module \"%s\"" +msgstr "" + +#: lazdemsg.serrnonodeforpackage +msgid "No node found for package \"%s\"" +msgstr "" + +#: lazdemsg.serrnonodefortopic +msgid "No parent node found to insert topic \"%s\"" +msgstr "" + +#: lazdemsg.serrnopackageformodule +msgid "No package found to insert module \"%s\"" +msgstr "" + +#: lazdemsg.serrors +msgid "Errors" +msgstr "Помилки" + +#: lazdemsg.serrunknowndomelement +msgid "Unknwon DOM element as parent for selected element: \"%s\"" +msgstr "" + +#: lazdemsg.sfilemodified +msgid "Document \"%s\" was modified, would you like to save it?" +msgstr "" + +#: lazdemsg.sfilestructure +msgid "Documentation structure" +msgstr "Структура документації" + +#: lazdemsg.sfiletemplate +msgid "template.xml" +msgstr "template.xml" + +#: lazdemsg.sforfile +msgid " in file " +msgstr " в файлі " + +#: lazdemsg.sformat +msgid "&Format" +msgstr "&Формат" + +#: lazdemsg.sformodule +msgid " in module " +msgstr " в модулі " + +#: lazdemsg.sforpackage +msgid " in package " +msgstr " в пакунку " + +#: lazdemsg.sfortopic +msgid " in topic" +msgstr " в темі " + +#: lazdemsg.shideprotectedmethods +msgid "&Hide protected methods" +msgstr "При&ховати захищені методи" + +#: lazdemsg.shinteditelementlink +msgid "Edit element link" +msgstr "Редагувати посилання елемента" + +#: lazdemsg.shintfileclose +msgid "Close current file" +msgstr "Закрити поточний файл" + +#: lazdemsg.shintfileexit +msgid "Close doc editor" +msgstr "Закрити редактор doc" + +#: lazdemsg.shintfilenew +msgctxt "lazdemsg.shintfilenew" +msgid "New file" +msgstr "Новий файл" + +#: lazdemsg.shintfileopen +msgid "Open file" +msgstr "Відкрити файл" + +#: lazdemsg.shintfilesave +msgid "Save file" +msgstr "Зберегти файл" + +#: lazdemsg.shintfilesaveas +msgid "Save file as" +msgstr "Зберегти файл як" + +#: lazdemsg.shintformatbold +msgid "Bold" +msgstr "Жирний" + +#: lazdemsg.shintformatcode +msgid "Code" +msgstr "Код" + +#: lazdemsg.shintformatfile +msgid "File" +msgstr "Файл" + +#: lazdemsg.shintformatitalics +msgid "Italic" +msgstr "Курсив" + +#: lazdemsg.shintformatremark +msgid "Remark" +msgstr "Примітка" + +#: lazdemsg.shintformatunderline +msgid "Underline" +msgstr "Підкреслений" + +#: lazdemsg.shintformatvariable +msgid "Variable" +msgstr "Змінна" + +#: lazdemsg.shintinsertelement +msgctxt "lazdemsg.shintinsertelement" +msgid "New element" +msgstr "Новий елемент" + +#: lazdemsg.shintinsertlink +msgctxt "lazdemsg.shintinsertlink" +msgid "Insert link" +msgstr "Вставити посилання" + +#: lazdemsg.shintinsertmodule +msgctxt "lazdemsg.shintinsertmodule" +msgid "New module" +msgstr "Новий модуль" + +#: lazdemsg.shintinsertpackage +msgctxt "lazdemsg.shintinsertpackage" +msgid "New package" +msgstr "Новий пакунок" + +#: lazdemsg.shintinsertprintshortlink +msgid "Insert a short description link" +msgstr "" + +#: lazdemsg.shintinserttable +msgctxt "lazdemsg.shintinserttable" +msgid "Insert table" +msgstr "Вставити таблицю" + +#: lazdemsg.shintinserttopic +msgctxt "lazdemsg.shintinserttopic" +msgid "New topic" +msgstr "Нова тема" + +#: lazdemsg.shintmenunewfromfile +msgid "New from file..." +msgstr "Новий з файлу..." + +#: lazdemsg.shinttoolbaradd +msgid "Add" +msgstr "Додати" + +#: lazdemsg.shinttoolbardelete +msgctxt "lazdemsg.shinttoolbardelete" +msgid "Delete" +msgstr "Видалити" + +#: lazdemsg.shinttoolbaredit +msgid "Edit" +msgstr "Редагувати" + +#: lazdemsg.shmenuextraoptions +msgid "Show options dialog" +msgstr "Показати діалог параметрів" + +#: lazdemsg.shmenuhelpabout +msgid "About this program" +msgstr "Про цю програму" + +#: lazdemsg.simportcontentfile +msgid "Import content file" +msgstr "" + +#: lazdemsg.sinsertlink +msgctxt "lazdemsg.sinsertlink" +msgid "Insert link" +msgstr "Вставити посилання" + +#: lazdemsg.sinsertprintshortlink +msgid "Insert short description link" +msgstr "" + +#: lazdemsg.sinserttable +msgctxt "lazdemsg.sinserttable" +msgid "Insert table" +msgstr "Вставити таблицю" + +#: lazdemsg.slazdoceditor +msgid "Lazarus Documentation Editor" +msgstr "" + +#: lazdemsg.slinksto +msgid " links to " +msgstr " вказує на " + +#: lazdemsg.sload +msgid "&Load" +msgstr "&Завантажити" + +#: lazdemsg.smakeskelfromsource +msgid "Make new document from source file" +msgstr "" + +#: lazdemsg.smarkselection +msgid "Mark selection %s" +msgstr "" + +#: lazdemsg.smenucollapseall +msgid "Collapse All" +msgstr "Згорнути Все" + +#: lazdemsg.smenudelete +msgctxt "lazdemsg.smenudelete" +msgid "Delete" +msgstr "Видалити" + +#: lazdemsg.smenuexpandall +msgid "Expand All" +msgstr "Розгорнути Все" + +#: lazdemsg.smenuextra +msgid "&Extra" +msgstr "&Екстра" + +#: lazdemsg.smenuextrabuild +msgctxt "lazdemsg.smenuextrabuild" +msgid "&Build" +msgstr "&Побудувати" + +#: lazdemsg.smenuextraoptions +msgid "&Options" +msgstr "&Параметри" + +#: lazdemsg.smenufile +msgctxt "lazdemsg.smenufile" +msgid "&File" +msgstr "&Файл" + +#: lazdemsg.smenufileclose +msgctxt "lazdemsg.smenufileclose" +msgid "&Close" +msgstr "&Закрити" + +#: lazdemsg.smenufilenew +msgid "&New" +msgstr "&Новий" + +#: lazdemsg.smenufilenewfromfile +msgid "New from fi&le" +msgstr "Новий з ф&айлу" + +#: lazdemsg.smenufileopen +msgid "&Open" +msgstr "&Відкрити" + +#: lazdemsg.smenufilequit +msgid "&Quit" +msgstr "Ви&хід" + +#: lazdemsg.smenufilerecent +msgid "&Recent" +msgstr "&Нещодавні" + +#: lazdemsg.smenufilesave +msgctxt "lazdemsg.smenufilesave" +msgid "&Save" +msgstr "З&берегти" + +#: lazdemsg.smenufilesaveas +msgid "Save &as" +msgstr "Зберегти &як" + +#: lazdemsg.smenuformat +msgid "Format" +msgstr "Формат" + +#: lazdemsg.smenuformatbold +msgid "&Bold" +msgstr "&Жирний" + +#: lazdemsg.smenuformatcode +msgid "&Code" +msgstr "&Код" + +#: lazdemsg.smenuformatfile +msgctxt "lazdemsg.smenuformatfile" +msgid "&File" +msgstr "&Файл" + +#: lazdemsg.smenuformatitalics +msgid "&Italic" +msgstr "&Курсив" + +#: lazdemsg.smenuformatparagraph +msgid "&Paragraph" +msgstr "&Параграф" + +#: lazdemsg.smenuformatremark +msgid "&Remark" +msgstr "П&римітка" + +#: lazdemsg.smenuformatunderline +msgid "&Underline" +msgstr "Пі&дкреслений" + +#: lazdemsg.smenuformatvariable +msgid "&Variable" +msgstr "&Змінна" + +#: lazdemsg.smenuhelp +msgid "&Help" +msgstr "&Довідка" + +#: lazdemsg.smenuhelpabout +msgid "&About..." +msgstr "&Про..." + +#: lazdemsg.smenuinsert +msgid "&Insert" +msgstr "Вс&тавити" + +#: lazdemsg.smenuinsertelement +msgid "&Element" +msgstr "&Елемент" + +#: lazdemsg.smenuinsertlink +msgid "&Link" +msgstr "&Посилання" + +#: lazdemsg.smenuinsertmodule +msgid "&Module" +msgstr "&Модуль" + +#: lazdemsg.smenuinsertpackage +msgctxt "lazdemsg.smenuinsertpackage" +msgid "&Package" +msgstr "&Пакунок" + +#: lazdemsg.smenuinsertprintshort +msgid "Insert short desc link" +msgstr "" + +#: lazdemsg.smenuinsertquicklink +msgid "&Quick Link" +msgstr "&Швидке посилання" + +#: lazdemsg.smenuinsertshortdesclink +msgid "&Short description link" +msgstr "" + +#: lazdemsg.smenuinserttable +msgid "&Table" +msgstr "&Таблиця" + +#: lazdemsg.smenuinserttopic +msgid "T&opic" +msgstr "Те&ма" + +#: lazdemsg.smenurename +msgid "Rename" +msgstr "Перейменувати" + +#: lazdemsg.smoduleelements +msgid "Elements for selected node" +msgstr "" + +#: lazdemsg.snew +msgid "New" +msgstr "Новий" + +#: lazdemsg.snewdocument +msgid "New document" +msgstr "Новий документ" + +#: lazdemsg.snewelement +msgctxt "lazdemsg.snewelement" +msgid "New element" +msgstr "Новий елемент" + +#: lazdemsg.snewfile +msgctxt "lazdemsg.snewfile" +msgid "New file" +msgstr "Новий файл" + +#: lazdemsg.snewmodule +msgctxt "lazdemsg.snewmodule" +msgid "New module" +msgstr "Новий модуль" + +#: lazdemsg.snewpackage +msgctxt "lazdemsg.snewpackage" +msgid "New package" +msgstr "Новий пакунок" + +#: lazdemsg.snewtopic +msgctxt "lazdemsg.snewtopic" +msgid "New topic" +msgstr "Нова тема" + +#: lazdemsg.snoelement +msgid "No element selected" +msgstr "" + +#: lazdemsg.soptdlgbackupextension +msgid "Backup extension" +msgstr "" + +#: lazdemsg.soptdlgconfirmdeletes +msgid "C&onfirm deletes" +msgstr "" + +#: lazdemsg.soptdlgcreatebackups +msgid "Create &backups" +msgstr "" + +#: lazdemsg.soptdlgdefaultextension +msgid "Default extension" +msgstr "Розширення за замовчуванням" + +#: lazdemsg.soptdlgdesktop +msgid "Desktop" +msgstr "Робочий Стіл" + +#: lazdemsg.soptdlgfpdocprogram +msgid "fpdoc program" +msgstr "Програма fpdoc" + +#: lazdemsg.soptdlggeneral +msgid "General" +msgstr "Загальні" + +#: lazdemsg.soptdlgmakeskelprogram +msgid "makeskel program" +msgstr "" + +#: lazdemsg.soptdlgmaxrecentused +msgid "Max. recent used" +msgstr "" + +#: lazdemsg.soptdlgoptions +msgid "Options" +msgstr "Параметри" + +#: lazdemsg.soptdlgreopenlastfile +msgid "Reopen last file on startup" +msgstr "" + +#: lazdemsg.soptdlgshowhints +msgid "Show hints" +msgstr "Показати підказку" + +#: lazdemsg.soptdlgskipemptynodes +msgid "&Skip empty nodes when saving" +msgstr "" + +#: lazdemsg.soptdlgstartmaximized +msgid "Start maximized" +msgstr "Запускати на весь екран" + +#: lazdemsg.sotheroptions +msgid "Other options" +msgstr "Інші параметри" + +#: lazdemsg.soutput +msgid "&Output" +msgstr "&Вивід" + +#: lazdemsg.spackage +msgctxt "lazdemsg.spackage" +msgid "&Package" +msgstr "&Пакунок" + +#: lazdemsg.spackages +msgid "Packages" +msgstr "Пакунки" + +#: lazdemsg.srenameelement +msgid "Rename element" +msgstr "Перейменувати елемент" + +#: lazdemsg.srenamemodule +msgid "Rename module" +msgstr "Перейменувати модуль" + +#: lazdemsg.srenamepackage +msgid "Rename package" +msgstr "Перейменувати пакунок" + +#: lazdemsg.srenametopic +msgid "Rename topic" +msgstr "Перейменувати тему" + +#: lazdemsg.ssave +msgctxt "lazdemsg.ssave" +msgid "&Save" +msgstr "&Зберегти" + +#: lazdemsg.sseealso +msgid "See Also" +msgstr "Див Також" + +#: lazdemsg.sselectoutputdirectory +msgid "Select output directory" +msgstr "Вибрати директорію на виході" + +#: lazdemsg.sselectoutputfile +msgid "Select output file name" +msgstr "Вибрати ім'я файлу на виході" + +#: lazdemsg.sselectsometext +msgid "Select some text" +msgstr "Вибрати певний текст" + +#: lazdemsg.sshortdescription +msgid "Short" +msgstr "Коротко" + +#: lazdemsg.sshowprivatemethods +msgid "Show p&rivate methods" +msgstr "" + +#: lazdemsg.sskelerrorwithfile +msgid "makeskel reported an error (%d). Try to load produced file anyway ?" +msgstr "" + +#: lazdemsg.sskelerrorwithoutfile +msgid "makeskel reported an error (%d) and produced no file." +msgstr "" + +#: lazdemsg.ssourcescapt +msgid "Sources" +msgstr "Вихідний код" + +#: lazdemsg.stargetos +msgid "Target OS" +msgstr "Цільова ОС" + +#: lazdemsg.susingcommand +msgid "Building docs using command: " +msgstr "" + +#: lazdemsg.swarnifnodocumentationnodefound +msgid "Warn if no documentation node found" +msgstr "" + diff --git a/ideintf/languages/objinspstrconsts.uk.po b/ideintf/languages/objinspstrconsts.uk.po index 40686604b6..c1cfd81bb2 100644 --- a/ideintf/languages/objinspstrconsts.uk.po +++ b/ideintf/languages/objinspstrconsts.uk.po @@ -3,6 +3,11 @@ msgstr "" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-25 15:41+0200\n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" #: objinspstrconsts.cactionlisteditorallcategory msgid "(All)" @@ -68,7 +73,7 @@ msgstr "Панель інструментів" #: objinspstrconsts.cactionlisteditorsearchcategory msgid "Search" -msgstr "" +msgstr "Пошук" #: objinspstrconsts.cactionlisteditorunknowncategory msgid "(Unknown)" @@ -104,7 +109,7 @@ msgstr "Редактор CheckListBox" #: objinspstrconsts.clbdeletehint msgid "Delete the Item" -msgstr "" +msgstr "Видалити Елемент" #: objinspstrconsts.clbdeletequest msgid "Delete the Item %d \"%s\"?" @@ -113,7 +118,7 @@ msgstr "Видалити елемент %d \"%s\"?" #: objinspstrconsts.clbdown msgctxt "objinspstrconsts.clbdown" msgid "Down" -msgstr "" +msgstr "Вниз" #: objinspstrconsts.clbmodify msgid "Modify the Item" @@ -122,7 +127,7 @@ msgstr "Змінити пункт" #: objinspstrconsts.clbup msgctxt "objinspstrconsts.clbup" msgid "Up" -msgstr "" +msgstr "Вверх" #: objinspstrconsts.fescalculated msgid "&Calculated" @@ -166,11 +171,9 @@ msgid "FieldDefs" msgstr "" #: objinspstrconsts.fesformcaption -#, fuzzy -#| msgid "New fileld" msgctxt "objinspstrconsts.fesformcaption" msgid "New field" -msgstr "Діалог" +msgstr "Нове поле" #: objinspstrconsts.feskeyfield msgid "&Key fields:" @@ -203,7 +206,7 @@ msgstr "" #: objinspstrconsts.fesokbtn msgctxt "objinspstrconsts.fesokbtn" msgid "OK" -msgstr "" +msgstr "Гаразд" #: objinspstrconsts.fespersistentcompname msgid "Co&mponent Name:" @@ -215,16 +218,16 @@ msgstr "" #: objinspstrconsts.fessize msgid "&Size:" -msgstr "" +msgstr "&Розмір:" #: objinspstrconsts.festype msgid "&Type:" -msgstr "" +msgstr "&Тип:" #: objinspstrconsts.ilesadd msgctxt "objinspstrconsts.ilesadd" msgid "Add" -msgstr "" +msgstr "Додати" #: objinspstrconsts.liisaddvalue msgid "Add value" @@ -256,43 +259,43 @@ msgstr "" #: objinspstrconsts.lisoem1 msgid "OEM 1" -msgstr "" +msgstr "OEM 1" #: objinspstrconsts.lisoem2 msgid "OEM 2" -msgstr "" +msgstr "OEM 2" #: objinspstrconsts.lisoem3 msgid "OEM 3" -msgstr "" +msgstr "OEM 3" #: objinspstrconsts.lisoem4 msgid "OEM 4" -msgstr "" +msgstr "OEM 4" #: objinspstrconsts.lisoem5 msgid "OEM 5" -msgstr "" +msgstr "OEM 5" #: objinspstrconsts.lisoem6 msgid "OEM 6" -msgstr "" +msgstr "OEM 6" #: objinspstrconsts.lisoem7 msgid "OEM 7" -msgstr "" +msgstr "OEM 7" #: objinspstrconsts.lisoem8 msgid "OEM 8" -msgstr "" +msgstr "OEM 8" #: objinspstrconsts.lisoemcomma msgid "OEM comma" -msgstr "" +msgstr "OEM кома" #: objinspstrconsts.lisoemminus msgid "OEM minus" -msgstr "" +msgstr "OEM мінус" #: objinspstrconsts.lisoemperiod msgid "OEM period" @@ -300,7 +303,7 @@ msgstr "" #: objinspstrconsts.lisoemplus msgid "OEM plus" -msgstr "" +msgstr "OEM плюс" #: objinspstrconsts.nbcesaddpage msgid "Add page" @@ -334,12 +337,12 @@ msgstr "Додати" #: objinspstrconsts.oicoleditdelete msgctxt "objinspstrconsts.oicoleditdelete" msgid "Delete" -msgstr "" +msgstr "Видалити" #: objinspstrconsts.oicoleditdown msgctxt "objinspstrconsts.oicoleditdown" msgid "Down" -msgstr "" +msgstr "Вниз" #: objinspstrconsts.oicoleditediting msgid "Editing" @@ -348,7 +351,7 @@ msgstr "" #: objinspstrconsts.oicoleditup msgctxt "objinspstrconsts.oicoleditup" msgid "Up" -msgstr "" +msgstr "Вверх" #: objinspstrconsts.ois0lines0chars msgid "0 lines, 0 chars" @@ -367,8 +370,6 @@ msgid "Action&List Editor..." msgstr "" #: objinspstrconsts.oisactionlisteditor -#, fuzzy -#| msgid "Action List Editor" msgid "ActionList Editor" msgstr "Редактор списку дій" @@ -394,7 +395,7 @@ msgstr "Все" #: objinspstrconsts.oisallfiles msgid "All files" -msgstr "" +msgstr "Всі файли" #: objinspstrconsts.oisarray msgid "Array" @@ -461,7 +462,7 @@ msgstr "Підтвердити видалення" #: objinspstrconsts.oiscopycomponents msgctxt "objinspstrconsts.oiscopycomponents" msgid "&Copy" -msgstr "" +msgstr "&Копіювати" #: objinspstrconsts.oiscreateanewpascalunit msgid "Create a new pascal unit." @@ -478,7 +479,7 @@ msgstr "" #: objinspstrconsts.oiscutcomponents msgctxt "objinspstrconsts.oiscutcomponents" msgid "Cu&t" -msgstr "" +msgstr "Ви&різати" #: objinspstrconsts.oisdelete msgctxt "objinspstrconsts.oisdelete" @@ -544,7 +545,7 @@ msgstr "Дійсний" #: objinspstrconsts.oishelp msgid "&Help" -msgstr "" +msgstr "&Довідка" #: objinspstrconsts.oisimagelistcomponenteditor msgid "I&mageList Editor..." @@ -632,7 +633,7 @@ msgstr "" #: objinspstrconsts.oisnew msgid "&New" -msgstr "" +msgstr "&Новий" #: objinspstrconsts.oisnone msgid "(none)" @@ -980,7 +981,7 @@ msgstr "&Відкрити..." #: objinspstrconsts.oistdactfileopenhint msgctxt "objinspstrconsts.oistdactfileopenhint" msgid "Open" -msgstr "" +msgstr "Відкрити" #: objinspstrconsts.oistdactfileopenshortcut msgid "Ctrl+O" @@ -1048,31 +1049,31 @@ msgstr "" #: objinspstrconsts.oistdactsearchfindhint msgid "Find" -msgstr "" +msgstr "Знайти" #: objinspstrconsts.oistdactsearchfindnextheadline msgid "Find &Next" -msgstr "" +msgstr "Знайти &Далі" #: objinspstrconsts.oistdactsearchfindnexthint msgid "Find next" -msgstr "" +msgstr "Знайти далі" #: objinspstrconsts.oistdactsearchfindnextshortcut msgid "F3" -msgstr "" +msgstr "F3" #: objinspstrconsts.oistdactsearchfindshortcut msgid "Ctrl+F" -msgstr "" +msgstr "Ctrl+F" #: objinspstrconsts.oistdactsearchreplaceheadline msgid "&Replace" -msgstr "" +msgstr "За&мінити" #: objinspstrconsts.oistdactsearchreplacehint msgid "Replace" -msgstr "" +msgstr "Замінити" #: objinspstrconsts.oistestdialog msgid "Test dialog..." @@ -1142,7 +1143,7 @@ msgstr "" #: objinspstrconsts.pefilter msgid "Filter" -msgstr "" +msgstr "Фільтр" #: objinspstrconsts.pefiltereditor msgid "Filter editor" @@ -1179,7 +1180,7 @@ msgstr "" #: objinspstrconsts.rscdleft msgctxt "objinspstrconsts.rscdleft" msgid "Left" -msgstr "" +msgstr "Вліво" #: objinspstrconsts.rscdmovedown msgid "Move down" @@ -1192,12 +1193,12 @@ msgstr "" #: objinspstrconsts.rscdok msgctxt "objinspstrconsts.rscdok" msgid "OK" -msgstr "" +msgstr "Гаразд" #: objinspstrconsts.rscdright msgctxt "objinspstrconsts.rscdright" msgid "Right" -msgstr "" +msgstr "Вправо" #: objinspstrconsts.rscdvisible msgid "Visible" @@ -1205,7 +1206,7 @@ msgstr "" #: objinspstrconsts.rscdwidth msgid "Width" -msgstr "" +msgstr "Ширина" #: objinspstrconsts.sccshceditsections msgid "Sections Editor ..." @@ -1222,7 +1223,7 @@ msgstr "" #: objinspstrconsts.sccsiledtapply msgctxt "objinspstrconsts.sccsiledtapply" msgid "Apply" -msgstr "" +msgstr "Застосувати" #: objinspstrconsts.sccsiledtcaption msgid "ImageList Editor" @@ -1305,7 +1306,7 @@ msgstr "" #: objinspstrconsts.sccslvedtapply msgctxt "objinspstrconsts.sccslvedtapply" msgid "Apply" -msgstr "" +msgstr "Застосувати" #: objinspstrconsts.sccslvedtcaption msgid "ListView Items Editor" @@ -1348,12 +1349,12 @@ msgstr "" #: objinspstrconsts.sccslvedtnewitem msgctxt "objinspstrconsts.sccslvedtnewitem" msgid "New Item" -msgstr "" +msgstr "Новий Елемент" #: objinspstrconsts.sccslvedtnewsubitem msgctxt "objinspstrconsts.sccslvedtnewsubitem" msgid "New SubItem" -msgstr "" +msgstr "Новий Піделемент" #: objinspstrconsts.sccsmaskeditor msgid "Edit Mask Editor..." @@ -1370,7 +1371,7 @@ msgstr "" #: objinspstrconsts.sccssgedtapply msgctxt "objinspstrconsts.sccssgedtapply" msgid "Apply" -msgstr "" +msgstr "Застосувати" #: objinspstrconsts.sccssgedtcaption msgid "StringGrid Editor" @@ -1395,7 +1396,7 @@ msgstr "" #: objinspstrconsts.sccssgedtopendialog msgctxt "objinspstrconsts.sccssgedtopendialog" msgid "Open" -msgstr "" +msgstr "Відкрити" #: objinspstrconsts.sccssgedtsave msgctxt "objinspstrconsts.sccssgedtsave" @@ -1415,7 +1416,7 @@ msgstr "" #: objinspstrconsts.sccstredtapply msgctxt "objinspstrconsts.sccstredtapply" msgid "Apply" -msgstr "" +msgstr "Застосувати" #: objinspstrconsts.sccstredtcaption msgid "TreeView Items Editor" @@ -1429,7 +1430,7 @@ msgstr "Видалити" #: objinspstrconsts.sccstredtgrplcaption msgctxt "objinspstrconsts.sccstredtgrplcaption" msgid "Items" -msgstr "" +msgstr "Елементи" #: objinspstrconsts.sccstredtgrprcaption msgctxt "objinspstrconsts.sccstredtgrprcaption" @@ -1439,7 +1440,7 @@ msgstr "" #: objinspstrconsts.sccstredtitem msgctxt "objinspstrconsts.sccstredtitem" msgid "Item" -msgstr "" +msgstr "Елемент" #: objinspstrconsts.sccstredtlabelimageindex msgctxt "objinspstrconsts.sccstredtlabelimageindex" @@ -1457,21 +1458,21 @@ msgstr "" #: objinspstrconsts.sccstredtlabeltext msgid "Text:" -msgstr "" +msgstr "Текст:" #: objinspstrconsts.sccstredtload msgid "Load" -msgstr "" +msgstr "Завантажити" #: objinspstrconsts.sccstredtnewitem msgctxt "objinspstrconsts.sccstredtnewitem" msgid "New Item" -msgstr "" +msgstr "Новий Елемент" #: objinspstrconsts.sccstredtnewsubitem msgctxt "objinspstrconsts.sccstredtnewsubitem" msgid "New SubItem" -msgstr "" +msgstr "Новий Піделемент" #: objinspstrconsts.sccstredtopendialog msgctxt "objinspstrconsts.sccstredtopendialog" @@ -1481,24 +1482,24 @@ msgstr "Відкрити" #: objinspstrconsts.sccstredtsave msgctxt "objinspstrconsts.sccstredtsave" msgid "Save" -msgstr "" +msgstr "Зберегти" #: objinspstrconsts.sccstredtsavedialog msgctxt "objinspstrconsts.sccstredtsavedialog" msgid "Save" -msgstr "" +msgstr "Зберегти" #: objinspstrconsts.srgrabkey msgid "Grab key" -msgstr "" +msgstr "Кнопка захоплення" #: objinspstrconsts.srkm_alt msgid "Alt" -msgstr "" +msgstr "Alt" #: objinspstrconsts.srkm_ctrl msgid "Ctrl" -msgstr "" +msgstr "Ctrl" #: objinspstrconsts.srvk_accept msgid "Accept" @@ -1510,7 +1511,7 @@ msgstr "" #: objinspstrconsts.srvk_back msgid "Backspace" -msgstr "" +msgstr "Backspace" #: objinspstrconsts.srvk_cancel msgctxt "objinspstrconsts.srvk_cancel" @@ -1546,19 +1547,19 @@ msgstr "Видалити" #: objinspstrconsts.srvk_down msgctxt "objinspstrconsts.srvk_down" msgid "Down" -msgstr "" +msgstr "Вниз" #: objinspstrconsts.srvk_end msgid "End" -msgstr "" +msgstr "End" #: objinspstrconsts.srvk_escape msgid "Escape" -msgstr "" +msgstr "Escape" #: objinspstrconsts.srvk_execute msgid "Execute" -msgstr "" +msgstr "Виконати" #: objinspstrconsts.srvk_final msgid "Final" @@ -1566,7 +1567,7 @@ msgstr "" #: objinspstrconsts.srvk_hanja msgid "Hanja" -msgstr "" +msgstr "Китайська" #: objinspstrconsts.srvk_help msgctxt "objinspstrconsts.srvk_help" @@ -1575,7 +1576,7 @@ msgstr "Допомога" #: objinspstrconsts.srvk_home msgid "Home" -msgstr "" +msgstr "Home" #: objinspstrconsts.srvk_insert msgctxt "objinspstrconsts.srvk_insert" @@ -1588,28 +1589,28 @@ msgstr "" #: objinspstrconsts.srvk_junja msgid "Junja" -msgstr "" +msgstr "Кенійська" #: objinspstrconsts.srvk_kana msgid "Kana" -msgstr "" +msgstr "Японська" #: objinspstrconsts.srvk_lbutton msgid "Mouse Button Left" -msgstr "" +msgstr "Ліва кнопка миші" #: objinspstrconsts.srvk_left msgctxt "objinspstrconsts.srvk_left" msgid "Left" -msgstr "" +msgstr "Вліво" #: objinspstrconsts.srvk_lwin msgid "Left Windows Key" -msgstr "" +msgstr "Ліва кнопка Win" #: objinspstrconsts.srvk_mbutton msgid "Mouse Button Middle" -msgstr "" +msgstr "Середня кнопка миші" #: objinspstrconsts.srvk_menu msgid "Menu" @@ -1638,7 +1639,7 @@ msgstr "" #: objinspstrconsts.srvk_numlock msgid "Numlock" -msgstr "" +msgstr "Numlock" #: objinspstrconsts.srvk_numpad msgid "Numpad %d" @@ -1646,7 +1647,7 @@ msgstr "" #: objinspstrconsts.srvk_pause msgid "Pause key" -msgstr "" +msgstr "Кнопка Pause" #: objinspstrconsts.srvk_print msgid "Print" @@ -1659,20 +1660,20 @@ msgstr "Попередній" #: objinspstrconsts.srvk_rbutton msgid "Mouse Button Right" -msgstr "" +msgstr "Права кнопка миші" #: objinspstrconsts.srvk_return msgid "Return" -msgstr "" +msgstr "Enter" #: objinspstrconsts.srvk_right msgctxt "objinspstrconsts.srvk_right" msgid "Right" -msgstr "" +msgstr "Вправо" #: objinspstrconsts.srvk_rwin msgid "Right Windows Key" -msgstr "" +msgstr "Права кнопка Win" #: objinspstrconsts.srvk_scroll msgid "Scroll" @@ -1684,7 +1685,7 @@ msgstr "" #: objinspstrconsts.srvk_shift msgid "Shift" -msgstr "" +msgstr "Shift" #: objinspstrconsts.srvk_snapshot msgid "Snapshot" @@ -1700,7 +1701,7 @@ msgstr "" #: objinspstrconsts.srvk_tab msgid "Tab" -msgstr "" +msgstr "Tab" #: objinspstrconsts.srvk_unknown msgctxt "objinspstrconsts.srvk_unknown" @@ -1710,7 +1711,7 @@ msgstr "Невідомий" #: objinspstrconsts.srvk_up msgctxt "objinspstrconsts.srvk_up" msgid "Up" -msgstr "" +msgstr "Вверх" #: objinspstrconsts.s_addassingle msgid "Add as single" @@ -1726,7 +1727,7 @@ msgstr "" #: objinspstrconsts.tbcenewbutton msgid "New Button" -msgstr "" +msgstr "Нова Кнопка" #: objinspstrconsts.tbcenewcheckbutton msgid "New CheckButton" @@ -1738,25 +1739,25 @@ msgstr "" #: objinspstrconsts.tbcenewseparator msgid "New Separator" -msgstr "" +msgstr "Новий Роздільник" #: objinspstrconsts.tccesaddtab msgid "Add tab" -msgstr "" +msgstr "Додати вкладку" #: objinspstrconsts.tccesdeletetab msgid "Delete tab" -msgstr "" +msgstr "Видалити вкладку" #: objinspstrconsts.tccesinserttab msgid "Insert tab" -msgstr "" +msgstr "Вставити вкладку" #: objinspstrconsts.tccesmovetableft msgid "Move tab left" -msgstr "" +msgstr "Перемістити вкладку вліво" #: objinspstrconsts.tccesmovetabright msgid "Move tab right" -msgstr "" +msgstr "Перемістити вкладку вправо" diff --git a/languages/installerstrconsts.uk.po b/languages/installerstrconsts.uk.po new file mode 100644 index 0000000000..2b0ce9f5a7 --- /dev/null +++ b/languages/installerstrconsts.uk.po @@ -0,0 +1,27 @@ +msgid "" +msgstr "" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-24 23:49+0200\n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" + +#: installerstrconsts.wiseditform +msgid "&Edit form" +msgstr "&Редагувати форму" + +#: installerstrconsts.wiseditsource +msgid "&Edit source" +msgstr "&Редагувати вихідний код" + +#: installerstrconsts.wisopenpackage +msgid "&Open package" +msgstr "&Відкрити пакунок" + +#: installerstrconsts.wisopenproject +msgid "&Open project" +msgstr "&Відкрити проект" + diff --git a/languages/lazaruside.uk.po b/languages/lazaruside.uk.po index bf6802b957..0251d9d9b0 100644 --- a/languages/lazaruside.uk.po +++ b/languages/lazaruside.uk.po @@ -1,16 +1,21 @@ msgid "" msgstr "" +"Project-Id-Version: lazaruside\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-26 18:07+0200\n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts.dlfmousepredefinedscheme msgid "Use predefined scheme" -msgstr "" +msgstr "Попередньо визначена користувачем схема" #: lazarusidestrconsts.dlfmouseresetall msgid "Reset all settings" -msgstr "" +msgstr "Скинути всі налашування" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" @@ -18,7 +23,7 @@ msgstr "" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" -msgstr "" +msgstr "Скинути всі текстові налашування" #: lazarusidestrconsts.dlfmousesimplediff msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" @@ -53,7 +58,7 @@ msgstr "Текст" #: lazarusidestrconsts.dlfmousesimpletextsectalt msgid "Alt-Key sets column mode" -msgstr "" +msgstr "Alt-Кнопка задає режим колонок" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel msgid "Ctrl Left Button" @@ -71,7 +76,7 @@ msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone" msgid "nothing" -msgstr "" +msgstr "нічого" #: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline msgid "Double Click selects line" @@ -88,12 +93,12 @@ msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidlabel msgid "Middle Button" -msgstr "" +msgstr "Середня Кнопка" #: lazarusidestrconsts.dlfmousesimpletextsectmidnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone" msgid "nothing" -msgstr "" +msgstr "нічого" #: lazarusidestrconsts.dlfmousesimpletextsectmidpaste msgid "paste selection" @@ -105,7 +110,7 @@ msgstr "" #: lazarusidestrconsts.dlfnopredefinedscheme msgid "< None >" -msgstr "" +msgstr "< Немає >" #: lazarusidestrconsts.dlfreadonlycolor msgctxt "lazarusidestrconsts.dlfreadonlycolor" @@ -130,7 +135,7 @@ msgstr "" #: lazarusidestrconsts.dlgaddhiattrdefault msgid "Default Text" -msgstr "" +msgstr "Текст за замовчуванням" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" @@ -142,11 +147,11 @@ msgstr "" #: lazarusidestrconsts.dlgaddhiattrerrorline msgid "Error line" -msgstr "" +msgstr "Рядок з помилкою" #: lazarusidestrconsts.dlgaddhiattrexecutionpoint msgid "Execution point" -msgstr "" +msgstr "Точка виконання" #: lazarusidestrconsts.dlgaddhiattrfoldedcode msgid "Folded code marker" @@ -206,11 +211,11 @@ msgstr "" #: lazarusidestrconsts.dlgaddhiattrlinenumber msgid "Line number" -msgstr "" +msgstr "Номер рядка" #: lazarusidestrconsts.dlgaddhiattrmodifiedline msgid "Modified line" -msgstr "" +msgstr "Змінений рядок" #: lazarusidestrconsts.dlgaddhiattrmouselink msgid "Mouse link" @@ -223,36 +228,36 @@ msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" msgid "Active Cell" -msgstr "" +msgstr "Активна Клітинка" #: lazarusidestrconsts.dlgaddhiattrsyncroeditother msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" msgid "Other Cells" -msgstr "" +msgstr "Інші Клітинки" #: lazarusidestrconsts.dlgaddhiattrsyncroeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" msgid "Syncronized Cells" -msgstr "" +msgstr "Синхронізовані Клітинки" #: lazarusidestrconsts.dlgaddhiattrtemplateeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" msgid "Active Cell" -msgstr "" +msgstr "Активна Клітинка" #: lazarusidestrconsts.dlgaddhiattrtemplateeditother msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" msgid "Other Cells" -msgstr "" +msgstr "Інші Клітинки" #: lazarusidestrconsts.dlgaddhiattrtemplateeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" msgid "Syncronized Cells" -msgstr "" +msgstr "Синхронізовані Клітинки" #: lazarusidestrconsts.dlgaddhiattrtextblock msgid "Text block" -msgstr "" +msgstr "Текстовий блок" #: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint msgid "Unknown breakpoint" @@ -288,7 +293,7 @@ msgstr "" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always visible cursor" -msgstr "" +msgstr "Завжди видимий курсор" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" @@ -325,7 +330,7 @@ msgstr "Автовидалення файлу" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse when typing" -msgstr "" +msgstr "Сховати мишку при наборі тексту" #: lazarusidestrconsts.dlgautoindent msgid "Auto indent" @@ -369,7 +374,7 @@ msgstr "Після методів" #: lazarusidestrconsts.dlgblockgroupoptions msgid "Selection:" -msgstr "" +msgstr "Виділення:" #: lazarusidestrconsts.dlgblockindent msgid "Block indent" @@ -385,11 +390,11 @@ msgstr "" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" -msgstr "" +msgstr "Лише позиція" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" -msgstr "" +msgstr "Пробіли" #: lazarusidestrconsts.dlgbp7cptb msgid "TP/BP 7.0 Compatible" @@ -419,7 +424,7 @@ msgstr "Скасувати" #: lazarusidestrconsts.dlgcasesensitive msgctxt "lazarusidestrconsts.dlgcasesensitive" msgid "&Case Sensitive" -msgstr "" +msgstr "&Чутливий до Регістру" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" @@ -427,7 +432,7 @@ msgstr "" #: lazarusidestrconsts.dlgccoresults msgid "Results" -msgstr "" +msgstr "Результати" #: lazarusidestrconsts.dlgccotest msgctxt "lazarusidestrconsts.dlgccotest" @@ -436,23 +441,23 @@ msgstr "Тест" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." -msgstr "" +msgstr "Тест: Перевіряю компілятор ..." #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." -msgstr "" +msgstr "Тест: Перевіряю конфігурацію компілятора ..." #: lazarusidestrconsts.dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." -msgstr "" +msgstr "Тест: Перевіряю конфігурації fpc ..." #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." -msgstr "" +msgstr "Тест: Перевіряю дату компілятора ..." #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." -msgstr "" +msgstr "Тест: Компілюю порожній файл ..." #: lazarusidestrconsts.dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." @@ -464,7 +469,7 @@ msgstr "" #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" -msgstr "" +msgstr "Тест: Компілюю порожній файл" #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" @@ -548,12 +553,12 @@ msgstr "Як є" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style:" -msgstr "" +msgstr "Стиль Асемблера:" #: lazarusidestrconsts.dlgcocfgcmpmessages msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" msgid "Messages" -msgstr "" +msgstr "Повідомлення" #: lazarusidestrconsts.dlgcochecks msgid "Checks:" @@ -573,7 +578,7 @@ msgstr "Оператори стилю C (*=, +=, /= and -=)" #: lazarusidestrconsts.dlgcocreatechildnode msgid "Create child node" -msgstr "" +msgstr "Створити дочірній вузол" #: lazarusidestrconsts.dlgcocreatemakefile msgctxt "lazarusidestrconsts.dlgcocreatemakefile" @@ -582,11 +587,11 @@ msgstr "Створити Makefile" #: lazarusidestrconsts.dlgcocreatenodeabove msgid "Create node above" -msgstr "" +msgstr "Створити вузол вище" #: lazarusidestrconsts.dlgcocreatenodebelow msgid "Create node below" -msgstr "" +msgstr "Створити вузол нижче" #: lazarusidestrconsts.dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" @@ -606,30 +611,28 @@ msgstr "Створення коду" #: lazarusidestrconsts.dlgcodefoldenableboth msgid "Both" -msgstr "" +msgstr "Обидва" #: lazarusidestrconsts.dlgcodefoldenablefold msgid "Fold" -msgstr "" +msgstr "Згорнути" #: lazarusidestrconsts.dlgcodefoldenablehide msgid "Hide" -msgstr "" +msgstr "Сховати" #: lazarusidestrconsts.dlgcodefoldingmouse msgctxt "lazarusidestrconsts.dlgcodefoldingmouse" msgid "Mouse" -msgstr "" +msgstr "Мишка" #: lazarusidestrconsts.dlgcodefoldpopuporder msgid "Reverse fold-order in Popup" msgstr "" #: lazarusidestrconsts.dlgcodegeneration -#, fuzzy -#| msgid "Code" msgid "Code generation" -msgstr "Код" +msgstr "Генерування коду" #: lazarusidestrconsts.dlgcodetoolsopts msgid "CodeTools Options" @@ -678,20 +681,20 @@ msgstr "Завант./Зберегти" #: lazarusidestrconsts.dlgcolor msgid "Color" -msgstr "" +msgstr "Колір" #: lazarusidestrconsts.dlgcolorexportbutton msgctxt "lazarusidestrconsts.dlgcolorexportbutton" msgid "Export" -msgstr "" +msgstr "Експорт" #: lazarusidestrconsts.dlgcolorlink msgid "(Edit Color)" -msgstr "" +msgstr "(Змінити Колір)" #: lazarusidestrconsts.dlgcolornotmodified msgid "Not modified" -msgstr "" +msgstr "Не змінено" #: lazarusidestrconsts.dlgcolors msgctxt "lazarusidestrconsts.dlgcolors" @@ -708,23 +711,23 @@ msgstr "Параметри командного рядка (без назви п #: lazarusidestrconsts.dlgcomovedown msgid "Move down" -msgstr "" +msgstr "Перемістити вниз" #: lazarusidestrconsts.dlgcomoveleveldown msgid "Move level down" -msgstr "" +msgstr "Перемістити на рівень вниз" #: lazarusidestrconsts.dlgcomovelevelup msgid "Move level up" -msgstr "" +msgstr "Перемістити на рівень вверх" #: lazarusidestrconsts.dlgcomoveup msgid "Move up" -msgstr "" +msgstr "Перемістити вверх" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler Messages" -msgstr "" +msgstr "Повідомлення компілятора" #: lazarusidestrconsts.dlgcompilermessages msgid "Compiler messages language file" @@ -781,10 +784,8 @@ msgid "Show Errors" msgstr "Показувати помилки" #: lazarusidestrconsts.dlgcoshowoptions -#, fuzzy -#| msgid "Show Options" msgid "&Show Options" -msgstr "Показувати Параметри" +msgstr "По&казувати Параметри" #: lazarusidestrconsts.dlgcosmaller msgid "Smaller Code" @@ -836,7 +837,7 @@ msgstr "Курсор за межею рядка" #: lazarusidestrconsts.dlgcursorgroupoptions msgid "Cursor:" -msgstr "" +msgstr "Курсор:" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Cursor skips selection" @@ -852,7 +853,7 @@ msgstr "Розширення користувача (.pp.xxx)" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" -msgstr "" +msgstr "Редактор Шляху" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" @@ -880,7 +881,7 @@ msgstr "Стільниця" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " -msgstr "" +msgstr "Кнопки - " #: lazarusidestrconsts.dlgdesktopfiles msgid "Desktop files" @@ -888,15 +889,15 @@ msgstr "Файли стільниці" #: lazarusidestrconsts.dlgdesktophints msgid "Hints" -msgstr "" +msgstr "Підказки" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " -msgstr "" +msgstr "Меню - " #: lazarusidestrconsts.dlgdesktopmisc msgid "Misc Options" -msgstr "" +msgstr "Різні Параметри" #: lazarusidestrconsts.dlgdirection msgid "Direction" @@ -928,11 +929,11 @@ msgstr "" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" -msgstr "" +msgstr "Колір лінії" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" -msgstr "" +msgstr "Початок/Кінець" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" @@ -973,8 +974,6 @@ msgid "Down" msgstr "Вниз" #: lazarusidestrconsts.dlgedadd -#, fuzzy -#| msgid "Add..." msgid "Add ..." msgstr "Додати..." @@ -1008,7 +1007,7 @@ msgstr "Затримка" #: lazarusidestrconsts.dlgeddelayinsec msgid "(%s sec delay)" -msgstr "" +msgstr "(%s сек затримка)" #: lazarusidestrconsts.dlgeddelete msgctxt "lazarusidestrconsts.dlgeddelete" @@ -1020,10 +1019,8 @@ msgid "Display" msgstr "Показувати" #: lazarusidestrconsts.dlgededit -#, fuzzy -#| msgid "Edit..." msgid "Edit ..." -msgstr "Редагувати..." +msgstr "Редагувати ..." #: lazarusidestrconsts.dlgedfiles msgid "Editor files" @@ -1036,7 +1033,7 @@ msgstr "Завершення ідентифікаторів" #: lazarusidestrconsts.dlgedinvert msgid "Invert" -msgstr "" +msgstr "Інвертувати" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit msgid "Ignore Locks, use longest unused editor" @@ -1056,7 +1053,7 @@ msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlocked msgid "Unlocked" -msgstr "" +msgstr "Розблоковано" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview msgid "Unlocked, if text in centered view" @@ -1133,7 +1130,7 @@ msgstr "" #: lazarusidestrconsts.dlgedmisc msgid "Misc" -msgstr "" +msgstr "Різне" #: lazarusidestrconsts.dlgednoerr msgid "No errors in key mapping found." @@ -1141,11 +1138,11 @@ msgstr "Помилок в схемі розташування клавіш не #: lazarusidestrconsts.dlgedoff msgid "Off" -msgstr "" +msgstr "Викл" #: lazarusidestrconsts.dlgedon msgid "On" -msgstr "" +msgstr "Вкл" #: lazarusidestrconsts.dlgedunder msgid "Underline" @@ -1254,25 +1251,25 @@ msgstr "Файл" #: lazarusidestrconsts.dlgfoldhtmlasp msgid "ASP" -msgstr "" +msgstr "ASP" #: lazarusidestrconsts.dlgfoldhtmlcomment msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" msgid "Comment" -msgstr "" +msgstr "Коментар" #: lazarusidestrconsts.dlgfoldhtmlnode msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" msgid "Node" -msgstr "" +msgstr "Вузол" #: lazarusidestrconsts.dlgfoldlfmitem msgid "Item" -msgstr "" +msgstr "Елемент" #: lazarusidestrconsts.dlgfoldlfmlist msgid "List <>" -msgstr "" +msgstr "Список <>" #: lazarusidestrconsts.dlgfoldlfmobject msgid "Object (inherited, inline)" @@ -1285,11 +1282,11 @@ msgstr "" #: lazarusidestrconsts.dlgfoldpasansicomment msgid "Comment (* *)" -msgstr "" +msgstr "Коментар (* *)" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" -msgstr "" +msgstr "Asm" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" @@ -1347,7 +1344,7 @@ msgstr "" #: lazarusidestrconsts.dlgfoldpasslashcomment msgid "Comment //" -msgstr "" +msgstr "Коментар //" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" @@ -1382,7 +1379,7 @@ msgstr "" #: lazarusidestrconsts.dlgfoldxmlcomment msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" msgid "Comment" -msgstr "" +msgstr "Коментар" #: lazarusidestrconsts.dlgfoldxmldoctype msgid "DocType" @@ -1391,7 +1388,7 @@ msgstr "" #: lazarusidestrconsts.dlgfoldxmlnode msgctxt "lazarusidestrconsts.dlgfoldxmlnode" msgid "Node" -msgstr "" +msgstr "Вузол" #: lazarusidestrconsts.dlgfoldxmlprocess msgid "Processing Instruction" @@ -1490,11 +1487,11 @@ msgstr "" #: lazarusidestrconsts.dlggroupdebugger msgctxt "lazarusidestrconsts.dlggroupdebugger" msgid "Debugger" -msgstr "" +msgstr "Налагоджувач" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" -msgstr "" +msgstr "Редактор" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" @@ -1606,7 +1603,7 @@ msgstr "Політика ідентифікаторів" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" -msgstr "" +msgstr "Параметри IDE" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" @@ -1638,7 +1635,7 @@ msgstr "" #: lazarusidestrconsts.dlginsertinterface msgid "Interface" -msgstr "" +msgstr "Інтерфейс" #: lazarusidestrconsts.dlginsertsection msgid "Insert into Uses section of" @@ -1702,10 +1699,8 @@ msgid "Left:" msgstr "Ліворуч:" #: lazarusidestrconsts.dlglefttopclr -#, fuzzy -#| msgid "color for left, top" msgid "Guid lines Left,Top" -msgstr "колір зліва зверху" +msgstr "Орієнтирні лінії Ліва,Верхня" #: lazarusidestrconsts.dlglevel1opt msgid "Level 1 (quick and debugger friendly)" @@ -1781,7 +1776,7 @@ msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore Keywords" -msgstr "" +msgstr "Ігнорувати ключові слова" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable Timer for Markup Current Word" @@ -1818,7 +1813,7 @@ msgstr "Змішування методів і властивостей" #: lazarusidestrconsts.dlgmousefoldbutton msgctxt "lazarusidestrconsts.dlgmousefoldbutton" msgid "Button" -msgstr "" +msgstr "Кнопка" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft" @@ -1866,11 +1861,11 @@ msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" -msgstr "" +msgstr "Налаштування 1" #: lazarusidestrconsts.dlgmousefoldgroup2 msgid "Setting 2" -msgstr "" +msgstr "Налаштування 2" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt" @@ -1889,23 +1884,23 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" -msgstr "" +msgstr "Мишка:" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" -msgstr "" +msgstr "Одинарний" #: lazarusidestrconsts.dlgmouseoptbtn2 msgid "Double" -msgstr "" +msgstr "Подвійний" #: lazarusidestrconsts.dlgmouseoptbtn3 msgid "Triple" -msgstr "" +msgstr "Потрійний" #: lazarusidestrconsts.dlgmouseoptbtn4 msgid "Quad" -msgstr "" +msgstr "Почетвірний" #: lazarusidestrconsts.dlgmouseoptbtnadd msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd" @@ -1914,7 +1909,7 @@ msgstr "Додати" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" -msgstr "" +msgstr "Будь-який" #: lazarusidestrconsts.dlgmouseoptbtncancel msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel" @@ -1934,19 +1929,19 @@ msgstr "Вниз" #: lazarusidestrconsts.dlgmouseoptbtnexport msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport" msgid "Export" -msgstr "" +msgstr "Експорт" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgid "Extra 1" -msgstr "" +msgstr "Екстра 1" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgid "Extra 2" -msgstr "" +msgstr "Екстра 2" #: lazarusidestrconsts.dlgmouseoptbtnimport msgid "Import" -msgstr "" +msgstr "Імпорт" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" @@ -1963,8 +1958,6 @@ msgid "Make Fallback" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnok -#, fuzzy -#| msgid "Ok" msgctxt "lazarusidestrconsts.dlgmouseoptbtnok" msgid "OK" msgstr "Гаразд" @@ -1999,7 +1992,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" msgid "Action" -msgstr "" +msgstr "Дія" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" @@ -2012,7 +2005,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" -msgstr "" +msgstr "Дублювати Запис" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" @@ -2026,7 +2019,7 @@ msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" -msgstr "" +msgstr "Кнопка" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" @@ -2049,15 +2042,15 @@ msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptheaddesc msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" msgid "Action" -msgstr "" +msgstr "Дія" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" -msgstr "" +msgstr "Вверх/Вниз" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" -msgstr "" +msgstr "Параметр" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" @@ -2067,7 +2060,7 @@ msgstr "Порядок" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" -msgstr "" +msgstr "Пріоритет" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" @@ -2077,7 +2070,7 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" -msgstr "" +msgstr "Мишка" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" @@ -2099,16 +2092,16 @@ msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" -msgstr "" +msgstr "n" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" -msgstr "" +msgstr "-" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" -msgstr "" +msgstr "Y" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" @@ -2118,7 +2111,7 @@ msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" -msgstr "" +msgstr "Y" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" @@ -2127,19 +2120,19 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" -msgstr "" +msgstr "Згорнути Дерево" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" -msgstr "" +msgstr "Згорнуто [+]" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" -msgstr "" +msgstr "Розгорнуто [-]" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" -msgstr "" +msgstr "Номери Рядів" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" @@ -2166,12 +2159,12 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" msgid "Priority" -msgstr "" +msgstr "Пріоритет" #: lazarusidestrconsts.dlgmsgs msgctxt "lazarusidestrconsts.dlgmsgs" msgid "Messages" -msgstr "" +msgstr "Повідомлення" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" @@ -2210,14 +2203,12 @@ msgid "Naming" msgstr "Надання назви" #: lazarusidestrconsts.dlgnoautomaticrenaming -#, fuzzy -#| msgid "no automatic renaming" msgid "No automatic renaming" -msgstr "без автоперейменування" +msgstr "Без автоперейменування" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" -msgstr "" +msgstr "Без Підсвічування" #: lazarusidestrconsts.dlgnotebooktabpos msgid "Source notebook tabs position" @@ -2226,7 +2217,7 @@ msgstr "" #: lazarusidestrconsts.dlgnotebooktabposbottom msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom" msgid "Bottom" -msgstr "" +msgstr "Нижній" #: lazarusidestrconsts.dlgnotebooktabposleft msgctxt "lazarusidestrconsts.dlgnotebooktabposleft" @@ -2241,7 +2232,7 @@ msgstr "Справа" #: lazarusidestrconsts.dlgnotebooktabpostop msgctxt "lazarusidestrconsts.dlgnotebooktabpostop" msgid "Top" -msgstr "" +msgstr "Верхній" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" @@ -2272,7 +2263,7 @@ msgstr "Параметри" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" -msgstr "" +msgstr "Параметри Швидкості" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" @@ -2342,7 +2333,7 @@ msgstr "" #: lazarusidestrconsts.dlgpldpackagegroup msgid "Package group" -msgstr "" +msgstr "Група пакунку" #: lazarusidestrconsts.dlgpoapplication msgid "Application" @@ -2366,11 +2357,11 @@ msgstr "Форми" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" -msgstr "" +msgstr "i18n" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" -msgstr "" +msgstr "Значок:" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" @@ -2379,11 +2370,11 @@ msgstr "" #: lazarusidestrconsts.dlgpoicondescnone msgctxt "lazarusidestrconsts.dlgpoicondescnone" msgid "(none)" -msgstr "" +msgstr "(немає)" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" -msgstr "" +msgstr "Завантажити Значок" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" @@ -2396,7 +2387,7 @@ msgstr "Вихідні налаштування" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" -msgstr "" +msgstr "Зберегти Значок" #: lazarusidestrconsts.dlgposavesession msgid "Session" @@ -2424,7 +2415,7 @@ msgstr "Параметри проекту" #: lazarusidestrconsts.dlgprojectoptionsfor msgid "Options for Project: %s" -msgstr "" +msgstr "Параметри для Проекту: %s" #: lazarusidestrconsts.dlgprojfiles msgid "Project files" @@ -2487,10 +2478,8 @@ msgid "Report" msgstr "Звіт" #: lazarusidestrconsts.dlgrightbottomclr -#, fuzzy -#| msgid "color for right, bottom" msgid "Guide lines Right,Bottom" -msgstr "колір справа знизу" +msgstr "Орієнтирні лінії Права,Нижня" #: lazarusidestrconsts.dlgrightclickselects msgid "Right Click selects" @@ -2509,17 +2498,13 @@ msgid "Select grandchildren" msgstr "" #: lazarusidestrconsts.dlgruberbandcreationcolor -#, fuzzy -#| msgid "Creation" msgid "Rubberband Creation" -msgstr "Створення" +msgstr "Створення Гумки" #: lazarusidestrconsts.dlgruberbandselectioncolor -#, fuzzy -#| msgid "Selection" msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" msgid "Rubberband Selection" -msgstr "Виділення" +msgstr "Вибір Гумки" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" @@ -2549,7 +2534,7 @@ msgstr "Overrides користувача" #: lazarusidestrconsts.dlgrunovalue msgctxt "lazarusidestrconsts.dlgrunovalue" msgid "Value" -msgstr "" +msgstr "Значення" #: lazarusidestrconsts.dlgrunovariable msgid "Variable" @@ -2565,7 +2550,7 @@ msgstr "Збер. робочий стіл у файл" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" -msgstr "" +msgstr "Збережений рядок" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" @@ -2597,10 +2582,8 @@ msgid "Scroll past end of file" msgstr "Прокрутити до кінця файлу" #: lazarusidestrconsts.dlgscrollpastendline -#, fuzzy -#| msgid "Scroll past end of line" msgid "Caret past end of line" -msgstr "Прокрутити до кінця рядка" +msgstr "Каретку в кінець рядка" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." @@ -2611,10 +2594,8 @@ msgid "Search terminated by user." msgstr "Пошук перервано користувачем." #: lazarusidestrconsts.dlgsearchcaption -#, fuzzy -#| msgid "Searching..." msgid "Searching ..." -msgstr "Пошук..." +msgstr "Пошук ..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" @@ -2622,7 +2603,7 @@ msgstr "Шляхи" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected Text" -msgstr "" +msgstr "&Виділений Текст" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" @@ -2651,7 +2632,7 @@ msgstr "Параметри компілятора" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" -msgstr "" +msgstr "Показувати номери рядків" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" @@ -2767,7 +2748,7 @@ msgstr "Довідки до командних кнопок (відкрити, #: lazarusidestrconsts.dlgsrcedit msgctxt "lazarusidestrconsts.dlgsrcedit" msgid "Source Editor" -msgstr "" +msgstr "Редактор Коду" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" @@ -2808,12 +2789,12 @@ msgstr "" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" -msgstr "" +msgstr "Сімейство цільового процеса" #: lazarusidestrconsts.dlgtargetos msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" -msgstr "" +msgstr "Цільова ОС" #: lazarusidestrconsts.dlgtargetplatform msgid "Target Platform:" @@ -2821,7 +2802,7 @@ msgstr "Платформа" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" -msgstr "" +msgstr "Цільовий процесор" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" @@ -2898,7 +2879,7 @@ msgstr "Межа скасувань:" #: lazarusidestrconsts.dlgunitdepbrowse msgctxt "lazarusidestrconsts.dlgunitdepbrowse" msgid "Open" -msgstr "" +msgstr "Відкрити" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" @@ -3031,22 +3012,16 @@ msgid "Align ..." msgstr "" #: lazarusidestrconsts.fdmdeleteselection -#, fuzzy -#| msgid "Delete selection" msgid "Delete Selection" -msgstr "Стерти виділення" +msgstr "Стерти Виділення" #: lazarusidestrconsts.fdmmirrorhorizontal -#, fuzzy -#| msgid "Mirror horizontal" msgid "Mirror Horizontal" -msgstr "Горизонтальне дзеркало" +msgstr "Горизонтальне Дзеркало" #: lazarusidestrconsts.fdmmirrorvertical -#, fuzzy -#| msgid "Mirror vertical" msgid "Mirror Vertical" -msgstr "Вертикальне дзеркало" +msgstr "Вертикальне Дзеркало" #: lazarusidestrconsts.fdmorder msgctxt "lazarusidestrconsts.fdmorder" @@ -3054,34 +3029,24 @@ msgid "Order" msgstr "Порядок" #: lazarusidestrconsts.fdmorderbackone -#, fuzzy -#| msgid "Back one" msgid "Back One" -msgstr "Назад на один" +msgstr "На один назад" #: lazarusidestrconsts.fdmorderforwardone -#, fuzzy -#| msgid "Forward one" msgid "Forward One" -msgstr "Вперед на одну" +msgstr "На один Вперед" #: lazarusidestrconsts.fdmordermovetoback -#, fuzzy -#| msgid "Move to back" msgid "Move to Back" msgstr "До попереднього" #: lazarusidestrconsts.fdmordermovetofront -#, fuzzy -#| msgid "Move to front" msgid "Move to Front" -msgstr "Пересунути наперед" +msgstr "Перемістити наперед" #: lazarusidestrconsts.fdmsaveformasxml -#, fuzzy -#| msgid "Save form as xml" msgid "Save form as XML" -msgstr "Зберегти файл як xml" +msgstr "Зберегти форму як XML" #: lazarusidestrconsts.fdmscalemenu msgid "Scale ..." @@ -3098,7 +3063,7 @@ msgstr "Виділити всі" #: lazarusidestrconsts.fdmsizemenu msgid "Size ..." -msgstr "" +msgstr "Розмір ..." #: lazarusidestrconsts.fdmsizeword msgid "Size" @@ -3114,11 +3079,11 @@ msgstr "Параметр:Прикріпити до лінійок" #: lazarusidestrconsts.fdmzorder msgid "Z-order" -msgstr "" +msgstr "Z-порядок" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" -msgstr "" +msgstr "На Обидвох Сторонах" #: lazarusidestrconsts.histdlgbtnclearhint msgid "Clear all snapshots" @@ -3134,16 +3099,16 @@ msgstr "" #: lazarusidestrconsts.histdlgcolumnloc msgid "Location" -msgstr "" +msgstr "Розміщення" #: lazarusidestrconsts.histdlgcolumntime msgid "Time" -msgstr "" +msgstr "Час" #: lazarusidestrconsts.histdlgformname msgctxt "lazarusidestrconsts.histdlgformname" msgid "History" -msgstr "" +msgstr "Історія" #: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." @@ -3455,7 +3420,7 @@ msgstr "" #: lazarusidestrconsts.lisaboutide msgid "About IDE" -msgstr "" +msgstr "Про IDE" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" @@ -3483,11 +3448,11 @@ msgstr "" #: lazarusidestrconsts.lisaction msgid "Action:" -msgstr "" +msgstr "Дія:" #: lazarusidestrconsts.lisactions msgid "Actions:" -msgstr "" +msgstr "Дії:" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" @@ -3495,19 +3460,19 @@ msgstr "Активувати синтаксис регулярних вираз #: lazarusidestrconsts.lisactive msgid "Active" -msgstr "" +msgstr "Активний" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" -msgstr "" +msgstr "Активний Фільтр" #: lazarusidestrconsts.lisadddirectory msgid "Add directory" -msgstr "" +msgstr "Додати теку" #: lazarusidestrconsts.lisaddfilesofdirectory msgid "Add files of directory" -msgstr "" +msgstr "Додати файл або теку" #: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" @@ -3515,15 +3480,15 @@ msgstr "Додаткові параметри компілятора, наслі #: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom msgid "Add new build mode, copying settings from \"%s\"" -msgstr "" +msgstr "Додати новий режим побудови, копіюю налаштування з \"%s\"" #: lazarusidestrconsts.lisaddnewmacro msgid "Add new macro" -msgstr "" +msgstr "Додати новий макрос" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" -msgstr "" +msgstr "Додати новий набір" #: lazarusidestrconsts.lisaddpackagerequirement msgid "Add package requirement?" @@ -3531,19 +3496,19 @@ msgstr "" #: lazarusidestrconsts.lisaddpackagetoproject msgid "Add package %s to project?" -msgstr "" +msgstr "Додати пакунок %s до проекту?" #: lazarusidestrconsts.lisaddpackagetoproject2 msgid "Add package to project" -msgstr "" +msgstr "Додати пакунок до проекту" #: lazarusidestrconsts.lisaddparameterbrackets msgid "Add parameter brackets" -msgstr "" +msgstr "Додати параметричні дужки" #: lazarusidestrconsts.lisaddress msgid "Address:" -msgstr "" +msgstr "Адреса:" #: lazarusidestrconsts.lisaddressbreakpoint msgctxt "lazarusidestrconsts.lisaddressbreakpoint" @@ -3572,7 +3537,7 @@ msgstr "" #: lazarusidestrconsts.lisaddvalue msgid "Add value:" -msgstr "" +msgstr "Додати значення:" #: lazarusidestrconsts.lisaddvaluetomacro msgid "Add value to macro %s" @@ -3640,10 +3605,8 @@ msgid "Alignment" msgstr "Вирівнювання" #: lazarusidestrconsts.lisallblockslooksok -#, fuzzy -#| msgid "All blocks looks ok." msgid "All blocks look ok." -msgstr "Додати блоки, що виглядають правильними" +msgstr "Всі блоки виглядають вірно." #: lazarusidestrconsts.lisallfiles msgid "All Files" @@ -3655,7 +3618,7 @@ msgstr "" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" -msgstr "" +msgstr "Дозволити Виклики Функцій" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" @@ -3671,7 +3634,7 @@ msgstr "" #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" -msgstr "" +msgstr "Альтернативна кнопка" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" @@ -3679,11 +3642,11 @@ msgstr "" #: lazarusidestrconsts.lisalways msgid "Always" -msgstr "" +msgstr "Завжди" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" -msgstr "" +msgstr "Завжди ігнорувати" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" @@ -3742,10 +3705,8 @@ msgid "Append short description to long description" msgstr "" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra -#, fuzzy -#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus." -msgstr "Програма%sГрафічна програма на lcl/freepascal. Програмний файл автоматично підтримується lazarus." +msgstr "Програма%sГрафічна програма на LCL/Free Pascal. Джерело програми автоматично підтримується Lazarus." #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" @@ -3809,7 +3770,7 @@ msgstr "" #: lazarusidestrconsts.lisautomatic msgid "Automatic" -msgstr "" +msgstr "Автоматично" #: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles msgid "Automatically convert .lfm files to .lrs include files" @@ -3821,25 +3782,23 @@ msgstr "" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" -msgstr "" +msgstr "розрив рядка" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" -msgstr "" +msgstr "пробіл" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" -msgstr "" +msgstr "кінець слова" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" -msgstr "" +msgstr "не додавати символ" #: lazarusidestrconsts.lisautomaticfeatures -#, fuzzy -#| msgid "Automatic features" msgid "Completion and Hints" -msgstr "Автоматичні ознаки" +msgstr "Завершення і Підказки" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" @@ -3926,7 +3885,7 @@ msgstr "Ширина бордюру" #: lazarusidestrconsts.lisbottom msgctxt "lazarusidestrconsts.lisbottom" msgid "Bottom" -msgstr "" +msgstr "Нижній" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." @@ -3973,11 +3932,11 @@ msgstr "Продовжити" #: lazarusidestrconsts.lisbtnfind msgid "&Find" -msgstr "" +msgstr "&Знайти" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" -msgstr "" +msgstr "За&мінити" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "build all files of project/package/IDE" @@ -4001,7 +3960,7 @@ msgstr "" #: lazarusidestrconsts.lisbuildmode msgid "Build mode" -msgstr "" +msgstr "Режим побудови" #: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes msgid "Differences between build modes" @@ -4013,11 +3972,11 @@ msgstr "" #: lazarusidestrconsts.lisbuildmodediffmode msgid "Mode:" -msgstr "" +msgstr "Режим:" #: lazarusidestrconsts.lisbuildmodes msgid "Build modes" -msgstr "" +msgstr "Режими побудови" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" @@ -4083,7 +4042,7 @@ msgstr "" #: lazarusidestrconsts.lisccdnoclass msgid "no class" -msgstr "" +msgstr "немає класу" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" @@ -4132,23 +4091,23 @@ msgstr "" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " -msgstr "" +msgstr "ПІДКАЗКА:" #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" -msgstr "" +msgstr "Невірний компілятор" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" -msgstr "" +msgstr "Невірний шлях пошуку" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" -msgstr "" +msgstr "Невірна Тестова Тека" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" -msgstr "" +msgstr "Втрачений модуль" #: lazarusidestrconsts.lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" @@ -4160,11 +4119,11 @@ msgstr "" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" -msgstr "" +msgstr "Не знайдено fpc.cfg" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" -msgstr "" +msgstr "не ASCII" #: lazarusidestrconsts.lisccoppuexiststwice msgid "ppu exists twice: %s, %s" @@ -4188,11 +4147,11 @@ msgstr "" #: lazarusidestrconsts.lisccoskip msgid "Skip" -msgstr "" +msgstr "Пропустити" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" -msgstr "" +msgstr "спеціальні символи" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." @@ -4228,7 +4187,7 @@ msgstr "" #: lazarusidestrconsts.liscecategories msgid "Categories" -msgstr "" +msgstr "Категорії" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" @@ -4236,23 +4195,23 @@ msgstr "" #: lazarusidestrconsts.lisceconstants msgid "Constants" -msgstr "" +msgstr "Константи" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" -msgstr "" +msgstr "Порожні блоки" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" -msgstr "" +msgstr "Порожні класові секції" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" -msgstr "" +msgstr "Порожні конструктори" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" -msgstr "" +msgstr "Порожні процедури" #: lazarusidestrconsts.liscefilter msgid "(Filter)" @@ -4265,7 +4224,7 @@ msgstr "Слідувати за курсором" #: lazarusidestrconsts.liscein msgctxt "lazarusidestrconsts.liscein" msgid "%s in %s" -msgstr "" +msgstr "%s в %s" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" @@ -4293,7 +4252,7 @@ msgstr "" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" -msgstr "" +msgstr "Показувати Категорії" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" @@ -4330,12 +4289,12 @@ msgstr "" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" -msgstr "" +msgstr "Категорія" #: lazarusidestrconsts.lisceomodesource msgctxt "lazarusidestrconsts.lisceomodesource" msgid "Source" -msgstr "" +msgstr "Джерело" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" @@ -4386,7 +4345,7 @@ msgstr "" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" -msgstr "" +msgstr "Стиль" #: lazarusidestrconsts.liscesurrounding msgid "Surrounding" @@ -4398,7 +4357,7 @@ msgstr "" #: lazarusidestrconsts.liscetypes msgid "Types" -msgstr "" +msgstr "Типи" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" @@ -4406,7 +4365,7 @@ msgstr "" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" -msgstr "" +msgstr "Несортовані члени" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" @@ -4419,7 +4378,7 @@ msgstr "" #: lazarusidestrconsts.liscevariables msgid "Variables" -msgstr "" +msgstr "Змінні" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" @@ -4447,7 +4406,7 @@ msgstr "" #: lazarusidestrconsts.liscfecontinueloading msgid "Continue loading" -msgstr "" +msgstr "Продовжити завантаження" #: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection msgid "Do not know how to copy this form editing selection" @@ -4487,7 +4446,7 @@ msgstr "" #: lazarusidestrconsts.liscfeerrorreading msgid "Error reading %s" -msgstr "" +msgstr "Помилка читання %s" #: lazarusidestrconsts.liscfeinfile msgid "%sIn file %s%s" @@ -4551,29 +4510,27 @@ msgstr "Змінити клас" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" -msgstr "" +msgstr "Змінити Кодування" #: lazarusidestrconsts.lischangefile msgid "Change file" -msgstr "" +msgstr "Змінити файл" #: lazarusidestrconsts.lischangeparent -#, fuzzy -#| msgid "Change Parent..." msgid "Change Parent" -msgstr "Змінити предка ..." +msgstr "Змінити предка" #: lazarusidestrconsts.lischangetounix msgid "Change to Unix /" -msgstr "" +msgstr "Змінити на Unix /" #: lazarusidestrconsts.lischangetowindows msgid "Change to Windows \\" -msgstr "" +msgstr "Змінити на Windows \\" #: lazarusidestrconsts.lischaracter msgid "Character" -msgstr "" +msgstr "Символ" #: lazarusidestrconsts.lischaractermap msgid "Character Map" @@ -4773,11 +4730,11 @@ msgstr "&Закрити" #: lazarusidestrconsts.lisclosealltabsclose msgid "Close files" -msgstr "" +msgstr "Закрити файли" #: lazarusidestrconsts.lisclosealltabshide msgid "Hide window" -msgstr "" +msgstr "Сховати вікно" #: lazarusidestrconsts.lisclosealltabsquestion msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" @@ -4806,11 +4763,11 @@ msgstr "" #: lazarusidestrconsts.liscmplstlist msgid "List" -msgstr "" +msgstr "Список" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" -msgstr "" +msgstr "Палітра" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" @@ -4828,7 +4785,7 @@ msgstr "Побудувати" #: lazarusidestrconsts.liscocalloncompile msgctxt "lazarusidestrconsts.liscocalloncompile" msgid "Compile" -msgstr "Компіл." +msgstr "Компілювати" #: lazarusidestrconsts.liscocallonrun msgctxt "lazarusidestrconsts.liscocallonrun" @@ -4846,7 +4803,7 @@ msgstr "Команда:" #: lazarusidestrconsts.liscode msgid "Code" -msgstr "" +msgstr "Код" #: lazarusidestrconsts.liscodebrowser msgid "Code browser" @@ -4855,7 +4812,7 @@ msgstr "Браузер коду" #: lazarusidestrconsts.liscodeexplorer msgctxt "lazarusidestrconsts.liscodeexplorer" msgid "Code Explorer" -msgstr "" +msgstr "Провідник Коду" #: lazarusidestrconsts.liscodefault msgid "default (%s)" @@ -4876,7 +4833,7 @@ msgstr "Додати шлях" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" -msgstr "" +msgstr "Огляд" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" @@ -4897,12 +4854,12 @@ msgstr "Видалити шлях" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" -msgstr "" +msgstr "Опис" #: lazarusidestrconsts.liscodehelperrorstag msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" -msgstr "" +msgstr "Помилки" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" @@ -4952,7 +4909,7 @@ msgstr "" #: lazarusidestrconsts.liscodehelpnodocumentation msgctxt "lazarusidestrconsts.liscodehelpnodocumentation" msgid "(none)" -msgstr "" +msgstr "(немає)" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" @@ -4970,12 +4927,12 @@ msgstr "" #: lazarusidestrconsts.liscodehelpreplacebutton msgctxt "lazarusidestrconsts.liscodehelpreplacebutton" msgid "Replace" -msgstr "" +msgstr "Замінити" #: lazarusidestrconsts.liscodehelpsavebutton msgctxt "lazarusidestrconsts.liscodehelpsavebutton" msgid "Save" -msgstr "" +msgstr "Зберегти" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" @@ -5343,7 +5300,7 @@ msgstr "Попередній елемент не може вміщувати д #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" -msgstr "" +msgstr "Тека проекту" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 msgid "%s project directory" @@ -5439,7 +5396,7 @@ msgstr "Біля" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" -msgstr "" +msgstr "Дужка" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" @@ -5558,10 +5515,8 @@ msgid "Compiler filename" msgstr "Назва файлу компілятора" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath -#, fuzzy -#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" -msgstr "Довідка: Ви можете задати шлях до компілятора в Оточенні->Параметри оточення->Файли->Шлях до компілятора" +msgstr "Довідка: Ви можете задати шлях до компілятора в Інструменти->Параметри->Файли->Шлях до компілятора" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" @@ -5594,7 +5549,7 @@ msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttypenone msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" msgid "Never" -msgstr "" +msgstr "Ніколи" #: lazarusidestrconsts.liscompletionlonglinehinttyperightonly msgid "Extend right only" @@ -5625,15 +5580,13 @@ msgid "Open unit" msgstr "Відкрити модуль" #: lazarusidestrconsts.liscomptest -#, fuzzy -#| msgid "Test" msgctxt "lazarusidestrconsts.liscomptest" msgid "&Test" -msgstr "Тест" +msgstr "&Тест" #: lazarusidestrconsts.liscondition msgid "Condition" -msgstr "" +msgstr "Умова" #: lazarusidestrconsts.lisconditionals msgid "Conditionals:" @@ -5668,10 +5621,8 @@ msgid "Confirm delete" msgstr "" #: lazarusidestrconsts.lisconfirmlazarusrebuild -#, fuzzy -#| msgid "Do you want to rebuild Lazarus?" msgid "Do you want to rebuild Lazarus with profile: %s ?" -msgstr "Перебудувати Lazarus?" +msgstr "Перебудувати Lazarus з профілем: %s ?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" @@ -5680,7 +5631,7 @@ msgstr "" #: lazarusidestrconsts.lisconfirmpackageaction msgctxt "lazarusidestrconsts.lisconfirmpackageaction" msgid "Action" -msgstr "" +msgstr "Дія" #: lazarusidestrconsts.lisconfirmpackagenewpackageset msgid "New package set" @@ -5750,7 +5701,7 @@ msgstr "" #: lazarusidestrconsts.lisconvdelphicategories msgid "Categories:" -msgstr "" +msgstr "Категорії:" #: lazarusidestrconsts.lisconvdelphiconversionaborted msgid "Conversion Aborted." @@ -5786,7 +5737,7 @@ msgstr "" #: lazarusidestrconsts.lisconvdelphierror msgid "Error=\"%s\"" -msgstr "" +msgstr "Помилка=\"%s\"" #: lazarusidestrconsts.lisconvdelphierrorcantfindunit msgid "%s(%s,%s) Error: Can't find unit %s" @@ -5866,7 +5817,6 @@ msgid "Some units of the Delphi package are missing:%s%s" msgstr "" #: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname -msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname" msgid "There are two units with the same unitname:%s%s%s%s%s" msgstr "" @@ -5892,11 +5842,11 @@ msgstr "Помилка перетворення" #: lazarusidestrconsts.lisconvert msgid "Convert" -msgstr "" +msgstr "Конвертувати" #: lazarusidestrconsts.lisconvertencoding msgid "Convert encoding" -msgstr "" +msgstr "Конвертувати кодування" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" @@ -5953,7 +5903,7 @@ msgstr "" #: lazarusidestrconsts.lisconvnewname msgid "New Name" -msgstr "" +msgstr "Нове Ім'я" #: lazarusidestrconsts.lisconvparentcontainer msgid "Parent Container" @@ -5993,11 +5943,11 @@ msgstr "" #: lazarusidestrconsts.liscopyall msgid "Copy All" -msgstr "" +msgstr "Копіювати Все" #: lazarusidestrconsts.liscopyallitemstoclipboard msgid "Copy all items to clipboard" -msgstr "" +msgstr "Копіювати всі елементи в буфер" #: lazarusidestrconsts.liscopyalloutputclipboard msgid "Copy all output to clipboard" @@ -6033,7 +5983,7 @@ msgstr "Копіювання всієї форми не реалізоване." #: lazarusidestrconsts.liscopyitemtoclipboard msgid "Copy item to clipboard" -msgstr "" +msgstr "Копіювати елемент в буфер" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy selected items to clipboard" @@ -6115,11 +6065,11 @@ msgstr "Спочатку створіть проект!" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" -msgstr "" +msgstr "Створити теку?" #: lazarusidestrconsts.liscreatefunction msgid "Create function" -msgstr "" +msgstr "Створити функцію" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" @@ -6192,7 +6142,7 @@ msgstr "Вибрати Код Макросу" #: lazarusidestrconsts.liscurrent msgctxt "lazarusidestrconsts.liscurrent" msgid "Current" -msgstr "" +msgstr "Поточний" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" @@ -6219,10 +6169,8 @@ msgid "Custom Program" msgstr "Спеціальна програма" #: lazarusidestrconsts.liscustomprogramafreepascalprogram -#, fuzzy -#| msgid "Custom Program%sA freepascal program." msgid "Custom Program%sA Free Pascal program." -msgstr "Спеціальна програма%sПрограма мовою FreePascal" +msgstr "Спеціальна програма%sПрограма мовою FreePascal." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" @@ -6235,36 +6183,36 @@ msgstr "Дата" #: lazarusidestrconsts.lisdbgallitemdelete msgctxt "lazarusidestrconsts.lisdbgallitemdelete" msgid "Delete all" -msgstr "" +msgstr "Видалити все" #: lazarusidestrconsts.lisdbgallitemdeletehint msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint" msgid "Delete all" -msgstr "" +msgstr "Видалити все" #: lazarusidestrconsts.lisdbgallitemdisable msgctxt "lazarusidestrconsts.lisdbgallitemdisable" msgid "Disable all" -msgstr "" +msgstr "Вимкнути все" #: lazarusidestrconsts.lisdbgallitemdisablehint msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" msgid "Disable all" -msgstr "" +msgstr "Вимкнути все" #: lazarusidestrconsts.lisdbgallitemenable msgctxt "lazarusidestrconsts.lisdbgallitemenable" msgid "Enable all" -msgstr "" +msgstr "Ввімкнути все" #: lazarusidestrconsts.lisdbgallitemenablehint msgctxt "lazarusidestrconsts.lisdbgallitemenablehint" msgid "Enable all" -msgstr "" +msgstr "Ввімкнути все" #: lazarusidestrconsts.lisdbgasmcopytoclipboard msgid "Copy to clipboard" -msgstr "" +msgstr "Копіювати в буфер" #: lazarusidestrconsts.lisdbgbreakpointpropertieshint msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint" @@ -6273,7 +6221,7 @@ msgstr "" #: lazarusidestrconsts.lisdbgemexpression msgid "&Expression:" -msgstr "" +msgstr "&Вираз:" #: lazarusidestrconsts.lisdbgemnewvalue msgid "&New value:" @@ -6281,7 +6229,7 @@ msgstr "" #: lazarusidestrconsts.lisdbgemresult msgid "&Result:" -msgstr "" +msgstr "&Результат:" #: lazarusidestrconsts.lisdbgenbreakpointevaluation msgid "Breakpoint Evaluation" @@ -6356,22 +6304,22 @@ msgstr "Вилучити" #: lazarusidestrconsts.lisdbgitemdisable msgctxt "lazarusidestrconsts.lisdbgitemdisable" msgid "Disable" -msgstr "" +msgstr "Вимкнути" #: lazarusidestrconsts.lisdbgitemdisablehint msgctxt "lazarusidestrconsts.lisdbgitemdisablehint" msgid "Disable" -msgstr "" +msgstr "Вимкнути" #: lazarusidestrconsts.lisdbgitemenable msgctxt "lazarusidestrconsts.lisdbgitemenable" msgid "Enable" -msgstr "" +msgstr "Ввімкнути" #: lazarusidestrconsts.lisdbgitemenablehint msgctxt "lazarusidestrconsts.lisdbgitemenablehint" msgid "Enable" -msgstr "" +msgstr "Ввімкнути" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" @@ -6387,7 +6335,7 @@ msgstr "Не вказаний Debugger.%sВстановлені точки зу #: lazarusidestrconsts.lisdbgwinpower msgid "On/Off" -msgstr "" +msgstr "Вкл/Викл" #: lazarusidestrconsts.lisdbgwinpowerhint msgid "Disable/Enable updates for the entire window" @@ -6403,20 +6351,18 @@ msgstr "Помилка налагоджувача%sОпа! Налагоджув #: lazarusidestrconsts.lisdebuggerfeedbackerror msgid "Debugger Error" -msgstr "" +msgstr "Помилка Налагоджувача" #: lazarusidestrconsts.lisdebuggerfeedbackless msgid "Less" -msgstr "" +msgstr "Менше" #: lazarusidestrconsts.lisdebuggerfeedbackmore msgctxt "lazarusidestrconsts.lisdebuggerfeedbackmore" msgid "More" -msgstr "" +msgstr "Більше" #: lazarusidestrconsts.lisdebuggerfeedbackok -#, fuzzy -#| msgid "Ok" msgctxt "lazarusidestrconsts.lisdebuggerfeedbackok" msgid "OK" msgstr "Гаразд" @@ -6428,7 +6374,7 @@ msgstr "Завершити" #: lazarusidestrconsts.lisdebuggerfeedbackwarning msgid "Debugger Warning" -msgstr "" +msgstr "Попередження Налагоджувача" #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" @@ -6440,7 +6386,7 @@ msgstr "%s (йде налагодження ...)" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" -msgstr "" +msgstr "Додати Виняток" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" @@ -6457,7 +6403,7 @@ msgstr "Очищувати log при виконанні" #: lazarusidestrconsts.lisdebugoptionsfrmdebugger msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" msgid "Debugger" -msgstr "" +msgstr "Налагоджувач" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" @@ -6494,7 +6440,7 @@ msgstr "Належить Програмі" #: lazarusidestrconsts.lisdebugoptionsfrmid msgid "ID" -msgstr "" +msgstr "ID" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" @@ -6505,15 +6451,13 @@ msgid "Language Exceptions" msgstr "Мовні розширення" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto -#, fuzzy -#| msgid "Limit linecount to" msgid "Limit line count to" -msgstr "Обмеження лічильнику рядків до" +msgstr "Обмежити к-сть рядків до" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" -msgstr "" +msgstr "Модуль" #: lazarusidestrconsts.lisdebugoptionsfrmname msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" @@ -6566,7 +6510,7 @@ msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmwindows msgid "Windows" -msgstr "" +msgstr "Вікна" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" @@ -6595,15 +6539,15 @@ msgstr "" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" -msgstr "" +msgstr "&Видалити Все" #: lazarusidestrconsts.lisdeleteallbreakpoints msgid "Delete all breakpoints?" -msgstr "" +msgstr "Видалити всі точки зупинки?" #: lazarusidestrconsts.lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" -msgstr "" +msgstr "Видалити всі точки зупинки в файлі %s%s%s?" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" @@ -6623,7 +6567,7 @@ msgstr "Видалити файл з неоднозначною назвою?" #: lazarusidestrconsts.lisdeletebreakpoint msgid "Delete Breakpoint" -msgstr "" +msgstr "Видалити Точку Зупинки" #: lazarusidestrconsts.lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" @@ -6639,11 +6583,11 @@ msgstr "" #: lazarusidestrconsts.lisdeletebuildmode msgid "Delete build mode" -msgstr "" +msgstr "Видалити режим побудови" #: lazarusidestrconsts.lisdeletebuildmode2 msgid "Delete build mode?" -msgstr "" +msgstr "Видалити режим побудови?" #: lazarusidestrconsts.lisdeletebuildmode3 msgid "Delete build mode %s%s%s?" @@ -6655,11 +6599,11 @@ msgstr "Видалення файлу не вдалося" #: lazarusidestrconsts.lisdeletemacro msgid "Delete macro %s" -msgstr "" +msgstr "Видалити макрос %s" #: lazarusidestrconsts.lisdeletemode msgid "Delete mode \"%s\"" -msgstr "" +msgstr "Видалити режим \"%s\"" #: lazarusidestrconsts.lisdeleteoldfile msgid "Delete old file %s%s%s?" @@ -6667,7 +6611,7 @@ msgstr "Видалити старий файл %s%s%s?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" -msgstr "" +msgstr "Видалити старий файл?" #: lazarusidestrconsts.lisdeleterow msgid "Delete row" @@ -6828,7 +6772,7 @@ msgstr "" #: lazarusidestrconsts.lisdisassassembler msgctxt "lazarusidestrconsts.lisdisassassembler" msgid "Assembler" -msgstr "" +msgstr "Асемблер" #: lazarusidestrconsts.lisdisassgotoaddress msgctxt "lazarusidestrconsts.lisdisassgotoaddress" @@ -7132,11 +7076,11 @@ msgstr "Робоча тека:" #: lazarusidestrconsts.lisemdall msgid "All" -msgstr "" +msgstr "Всі" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" -msgstr "" +msgstr "Порожні Методи" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" @@ -7176,7 +7120,7 @@ msgstr "" #: lazarusidestrconsts.lisempty msgid "Empty" -msgstr "" +msgstr "Порожньо" #: lazarusidestrconsts.lisenableall msgid "&Enable All" @@ -7197,7 +7141,7 @@ msgstr "Доступний" #: lazarusidestrconsts.lisenablegroups msgid "Enable Groups" -msgstr "" +msgstr "Ввімкнути Групи" #: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport msgid "Enable internationalization and translation support" @@ -7372,11 +7316,11 @@ msgstr "" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" -msgstr "" +msgstr "Помилка завантаження файлу" #: lazarusidestrconsts.liserrorloadingfile2 msgid "Error loading file \"%s\":%s%s" -msgstr "" +msgstr "Помилка завантаження файлу \"%s\":%s%s" #: lazarusidestrconsts.liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" @@ -7396,7 +7340,7 @@ msgstr "" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" -msgstr "" +msgstr "Помилка відкриття компоненту" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." @@ -7485,7 +7429,7 @@ msgstr "" #: lazarusidestrconsts.lisexamples msgid "Examples" -msgstr "" +msgstr "Приклади" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" @@ -7525,7 +7469,7 @@ msgstr "Виконання завершене" #: lazarusidestrconsts.lisexeprograms msgid "Programs" -msgstr "" +msgstr "Програми" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" @@ -7553,7 +7497,7 @@ msgstr "Список експорту" #: lazarusidestrconsts.lisexpression msgid "Expression:" -msgstr "" +msgstr "Вираз:" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" @@ -7727,11 +7671,11 @@ msgstr "" #: lazarusidestrconsts.lisfilter3 msgid "Filter: %s" -msgstr "" +msgstr "Фільтр: %s" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" -msgstr "" +msgstr "Набори Фільтрів" #: lazarusidestrconsts.lisfindfilecasesensitive msgid "&Case sensitive" @@ -7795,7 +7739,7 @@ msgstr "" #: lazarusidestrconsts.lisfirst msgid "First" -msgstr "" +msgstr "Перший" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" @@ -7811,7 +7755,7 @@ msgstr "Розпочати зміну назв" #: lazarusidestrconsts.lisform msgid "Form" -msgstr "" +msgstr "Форма" #: lazarusidestrconsts.lisformaterror msgid "Format error" @@ -7852,20 +7796,20 @@ msgstr "" #: lazarusidestrconsts.lisfpctooold msgid "FPC too old" -msgstr "" +msgstr "FPC надто старий" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " -msgstr "" +msgstr "Версія FPC: " #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" -msgstr "" +msgstr "Версія FPC (напр. 2.2.2)" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" msgid "FPDoc Editor" -msgstr "" +msgstr "Редактор FPDoc" #: lazarusidestrconsts.lisfpdocerrorwriting msgid "Error writing \"%s\"%s%s" @@ -7893,7 +7837,7 @@ msgstr "" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" -msgstr "" +msgstr "Free Pascal" #: lazarusidestrconsts.lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" @@ -7983,7 +7927,7 @@ msgstr "Шукати де" #: lazarusidestrconsts.lisfunction msgctxt "lazarusidestrconsts.lisfunction" msgid "Function" -msgstr "" +msgstr "Функція" #: lazarusidestrconsts.lisgeneral msgctxt "lazarusidestrconsts.lisgeneral" @@ -8009,7 +7953,7 @@ msgstr "" #: lazarusidestrconsts.lisgroup msgid "Group" -msgstr "" +msgstr "Група" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" @@ -8079,7 +8023,7 @@ msgstr "Виконати" #: lazarusidestrconsts.lishintsave msgctxt "lazarusidestrconsts.lishintsave" msgid "Save" -msgstr "" +msgstr "Зберегти" #: lazarusidestrconsts.lishintsaveall msgid "Save all" @@ -8152,7 +8096,7 @@ msgstr "Горизонтальний" #: lazarusidestrconsts.liside msgid "IDE" -msgstr "" +msgstr "IDE" #: lazarusidestrconsts.lisidebuildoptions msgid "IDE build options" @@ -8253,7 +8197,7 @@ msgstr "Гаразд" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" -msgstr "" +msgstr "Ігнорувати все" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" @@ -8337,15 +8281,15 @@ msgstr "" #: lazarusidestrconsts.lisinfobuilderror msgid "Error ..." -msgstr "" +msgstr "Помилка ..." #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" -msgstr "" +msgstr "Помилки:" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" -msgstr "" +msgstr "Підказки:" #: lazarusidestrconsts.lisinfobuildlines msgctxt "lazarusidestrconsts.lisinfobuildlines" @@ -8363,7 +8307,7 @@ msgstr "" #: lazarusidestrconsts.lisinfobuildproject msgid "Project:" -msgstr "" +msgstr "Проект:" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success ..." @@ -8472,20 +8416,20 @@ msgstr "" #: lazarusidestrconsts.lisinspectdata msgid "Data" -msgstr "" +msgstr "Дані" #: lazarusidestrconsts.lisinspectdialog msgid "Debug Inspector" -msgstr "" +msgstr "Інспектор Налагодження" #: lazarusidestrconsts.lisinspectmethods msgid "Methods" -msgstr "" +msgstr "Методи" #: lazarusidestrconsts.lisinspectproperties msgctxt "lazarusidestrconsts.lisinspectproperties" msgid "Properties" -msgstr "" +msgstr "Властивості" #: lazarusidestrconsts.lisinstallationfailed msgid "Installation failed" @@ -8928,7 +8872,7 @@ msgstr "" #: lazarusidestrconsts.liskmnewpackage msgid "New package" -msgstr "" +msgstr "Новий пакунок" #: lazarusidestrconsts.liskmnewproject msgid "New project" @@ -9069,43 +9013,43 @@ msgstr "Перемкнути між модулем і формою" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle marker 0" -msgstr "" +msgstr "Перемкнути маркер 0" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle marker 1" -msgstr "" +msgstr "Перемкнути маркер 1" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle marker 2" -msgstr "" +msgstr "Перемкнути маркер 2" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle marker 3" -msgstr "" +msgstr "Перемкнути маркер 3" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle marker 4" -msgstr "" +msgstr "Перемкнути маркер 4" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle marker 5" -msgstr "" +msgstr "Перемкнути маркер 5" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle marker 6" -msgstr "" +msgstr "Перемкнути маркер 6" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle marker 7" -msgstr "" +msgstr "Перемкнути маркер 7" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle marker 8" -msgstr "" +msgstr "Перемкнути маркер 8" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle marker 9" -msgstr "" +msgstr "Перемкнути маркер 9" #: lazarusidestrconsts.liskmtoggleviewassembler msgid "Toggle view Assembler" @@ -9225,11 +9169,9 @@ msgstr "" #: lazarusidestrconsts.lislazaruseditorv msgid "Lazarus IDE v%s" -msgstr "" +msgstr "Lazarus IDE v%s" #: lazarusidestrconsts.lislazarusfile -#, fuzzy -#| msgid "Lazarus File" msgid "Lazarus file" msgstr "Файл Lazarus" @@ -9280,7 +9222,7 @@ msgstr "Модуль Lazarus" #: lazarusidestrconsts.lislazbuildaboaction msgctxt "lazarusidestrconsts.lislazbuildaboaction" msgid "Action" -msgstr "" +msgstr "Дія" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " @@ -9435,8 +9377,6 @@ msgid "None" msgstr "Відсутнє" #: lazarusidestrconsts.lislazbuildok -#, fuzzy -#| msgid "Ok" msgctxt "lazarusidestrconsts.lislazbuildok" msgid "OK" msgstr "Гаразд" @@ -9474,7 +9414,7 @@ msgstr "Перейменувати" #: lazarusidestrconsts.lislazbuildrenameprof msgid "Rename Profile" -msgstr "" +msgstr "Перейменувати Профіль" #: lazarusidestrconsts.lislazbuildrenameprofinfo msgid "New name for profile:" @@ -9506,7 +9446,7 @@ msgstr "Для ЦП" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" -msgstr "" +msgstr "Цільова тека:" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" @@ -9527,7 +9467,7 @@ msgstr "" #: lazarusidestrconsts.lislazbuildwithstaticpackages msgid "With packages" -msgstr "" +msgstr "З пакунками" #: lazarusidestrconsts.lislazcleanupbuildall msgctxt "lazarusidestrconsts.lislazcleanupbuildall" @@ -9621,7 +9561,7 @@ msgstr "шлях до бібліотек" #: lazarusidestrconsts.lisline msgid "Line:" -msgstr "" +msgstr "Рядок:" #: lazarusidestrconsts.lislinelength msgid "Line/Length" @@ -9629,7 +9569,7 @@ msgstr "" #: lazarusidestrconsts.lislink msgid "Link:" -msgstr "" +msgstr "Посилання:" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" @@ -9703,11 +9643,11 @@ msgstr "" #: lazarusidestrconsts.lismacpascal msgid "Mac Pascal" -msgstr "" +msgstr "Mac Pascal" #: lazarusidestrconsts.lismacro msgid "Macro %s" -msgstr "" +msgstr "Макрос %s" #: lazarusidestrconsts.lismacroname msgid "Macro name" @@ -9820,7 +9760,7 @@ msgstr "Рядки з тим же значенням:" #: lazarusidestrconsts.lismaxs msgid "Max %d" -msgstr "" +msgstr "Макс %d" #: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage msgid "%s Maybe you have to recompile the package." @@ -9836,19 +9776,15 @@ msgstr "Перервати збирання" #: lazarusidestrconsts.lismenuaboutfpc msgid "About FPC" -msgstr "" +msgstr "Про FPC" #: lazarusidestrconsts.lismenuaddbreakpoint -#, fuzzy -#| msgid "Add breakpoint" msgid "Add &Breakpoint" -msgstr "Додати точку зупину" +msgstr "Додати &точку зупинки" #: lazarusidestrconsts.lismenuaddcurunittopkg -#, fuzzy -#| msgid "Add active unit to a package" msgid "Add active unit to a package ..." -msgstr "Додати активний модуль до проекту" +msgstr "Додати активний модуль до пакету ..." #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add jump point to history" @@ -9859,14 +9795,12 @@ msgid "Add editor file to Project" msgstr "Додати файл редактора до проекту" #: lazarusidestrconsts.lismenuaddwatch -#, fuzzy -#| msgid "Add watch ..." msgid "Add &Watch ..." -msgstr "Додати спостереження..." +msgstr "Додати &спостереження..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in selection" -msgstr "" +msgstr "Розбивати Рядки в виділенні" #: lazarusidestrconsts.lismenubuild msgctxt "lazarusidestrconsts.lismenubuild" @@ -9878,14 +9812,12 @@ msgid "Build File" msgstr "Побудувати файл" #: lazarusidestrconsts.lismenubuildlazarus -#, fuzzy -#| msgid "Build Lazarus" msgid "Build Lazarus with current profile" -msgstr "Побудувати Lazarus" +msgstr "Побудувати Lazarus з поточним профілем" #: lazarusidestrconsts.lismenubuildlazarusprof msgid "Build Lazarus with profile: %s" -msgstr "" +msgstr "Побудувати Lazarus з профілем: %s" #: lazarusidestrconsts.lismenuchecklfm msgid "Check LFM file in editor" @@ -9901,10 +9833,8 @@ msgid "Close" msgstr "Закрити" #: lazarusidestrconsts.lismenucloseall -#, fuzzy -#| msgid "Close all editor files" msgid "Close a&ll editor files" -msgstr "Закрити всі файли редактора" +msgstr "Закрити в&сі файли редактора" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" @@ -9925,7 +9855,7 @@ msgstr "Перевести в коментар" #: lazarusidestrconsts.lismenucompile msgctxt "lazarusidestrconsts.lismenucompile" msgid "Compile" -msgstr "Компіл." +msgstr "Компілювати" #: lazarusidestrconsts.lismenucompileroptions msgid "Compiler Options ..." @@ -9946,7 +9876,7 @@ msgstr "Налаштувати компоненти користувача ..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." -msgstr "" +msgstr "Налаштувати зовнішні інструменти ..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." @@ -9973,14 +9903,12 @@ msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Перетворення модуля Delphi в модуль Lazarus ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm -#, fuzzy -#| msgid "Convert binary DFM file to text LFM and check syntax ..." msgid "Convert binary DFM to text LFM + check syntax ..." -msgstr "Перетворення DFM в LFM ..." +msgstr "Перетворити двійковий DFM в текстовий LFM + перевірка синтаксису ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." -msgstr "" +msgstr "Конвертувати кодування проектів/пакунків ..." #: lazarusidestrconsts.lismenucopy msgctxt "lazarusidestrconsts.lismenucopy" @@ -9989,7 +9917,7 @@ msgstr "Копіювати" #: lazarusidestrconsts.lismenucreatefpdocfiles msgid "Create FPDoc files" -msgstr "" +msgstr "Створити файли FPDoc" #: lazarusidestrconsts.lismenucreatepofile msgid "Create .po files" @@ -10002,14 +9930,12 @@ msgstr "Вирізати" #: lazarusidestrconsts.lismenudebugwindows msgid "Debug windows" -msgstr "Вікно налагоджувача..." +msgstr "Вікна налагодження" #: lazarusidestrconsts.lismenudiff -#, fuzzy -#| msgid "Diff" msgctxt "lazarusidestrconsts.lismenudiff" msgid "Diff ..." -msgstr "Порівнянти" +msgstr "Порівняти ..." #: lazarusidestrconsts.lismenuedit msgid "&Edit" @@ -10024,14 +9950,12 @@ msgid "Edit context sensitive Help" msgstr "Редагувати контекстно-чутливої Допомоги" #: lazarusidestrconsts.lismenueditinstallpkgs -#, fuzzy -#| msgid "Configure installed packages ..." msgid "Install/Uninstall packages ..." -msgstr "Налаштувати встановлені пакунки ..." +msgstr "Встановити/Видалити пакунки ..." #: lazarusidestrconsts.lismenueditor msgid "Menu Editor ..." -msgstr "" +msgstr "Редактор Меню ..." #: lazarusidestrconsts.lismenueditorcancel msgctxt "lazarusidestrconsts.lismenueditorcancel" @@ -10043,10 +9967,8 @@ msgid "Create Submenu" msgstr "Створити підменю" #: lazarusidestrconsts.lismenueditordeletefromtemplate -#, fuzzy -#| msgid "Delete From Template..." msgid "Delete From Template ..." -msgstr "Видалити шаблон форми" +msgstr "Видалити з шаблону ..." #: lazarusidestrconsts.lismenueditordeleteitem msgid "Delete Item" @@ -10057,10 +9979,8 @@ msgid "Handle OnClick Event" msgstr "" #: lazarusidestrconsts.lismenueditorinsertfromtemplate -#, fuzzy -#| msgid "Insert From Template..." msgid "Insert From Template ..." -msgstr "Вставити шаблон форми..." +msgstr "Вставити з шаблону ..." #: lazarusidestrconsts.lismenueditorinsertnewitemafter msgid "Insert New Item (after)" @@ -10083,16 +10003,12 @@ msgid "Move Up (or left)" msgstr "Пересунути вгору (або вліво)" #: lazarusidestrconsts.lismenueditornewtemplatedescription -#, fuzzy -#| msgid "New Template Description..." msgid "New Template Description ..." -msgstr "Новий опис шаблону " +msgstr "Новий опис шаблону ..." #: lazarusidestrconsts.lismenueditorsaveastemplate -#, fuzzy -#| msgid "Save As Template..." msgid "Save As Template ..." -msgstr "Зберегти як шаблон..." +msgstr "Зберегти як шаблон ..." #: lazarusidestrconsts.lismenueditorselectmenu msgid "Select Menu:" @@ -10115,10 +10031,8 @@ msgid "Enclose selection ..." msgstr "Задужкувати виділення в ..." #: lazarusidestrconsts.lismenuevaluate -#, fuzzy -#| msgid "Evaluate/Modify ..." msgid "E&valuate/Modify ..." -msgstr "Обчислити/Змінити..." +msgstr "Об&числити/Змінити..." #: lazarusidestrconsts.lismenuextractproc msgid "Extract procedure ..." @@ -10135,7 +10049,7 @@ msgstr "Знайти" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." -msgstr "" +msgstr "&Знайти ..." #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find other end of code block" @@ -10168,11 +10082,11 @@ msgstr "Знайти &попередній" #: lazarusidestrconsts.lismenufpdoceditor msgctxt "lazarusidestrconsts.lismenufpdoceditor" msgid "FPDoc Editor" -msgstr "" +msgstr "Редактор FPDoc" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." -msgstr "" +msgstr "Параметри ..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" @@ -10196,7 +10110,7 @@ msgstr "&Довідка" #: lazarusidestrconsts.lismenuideinternals msgid "IDE internals" -msgstr "" +msgstr "Нутрощі IDE" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" @@ -10215,21 +10129,17 @@ msgid "Insert from Character Map" msgstr "Вставити з таблиці символів" #: lazarusidestrconsts.lismenuinsertcvskeyword -#, fuzzy -#| msgid "CVS keyword" msgid "Insert CVS keyword" -msgstr "Ключ CVS" +msgstr "Вставити Ключ CVS" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current date and time" msgstr "Поточні дата і час" #: lazarusidestrconsts.lismenuinsertgeneral -#, fuzzy -#| msgid "General" msgctxt "lazarusidestrconsts.lismenuinsertgeneral" msgid "Insert General" -msgstr "Загальне" +msgstr "Вставити Загальні" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL notice" @@ -10248,11 +10158,9 @@ msgid "Current username" msgstr "Поточне ім'я користувача" #: lazarusidestrconsts.lismenuinspect -#, fuzzy -#| msgid "Inspect ..." msgctxt "lazarusidestrconsts.lismenuinspect" msgid "&Inspect ..." -msgstr "Слідкувати за ..." +msgstr "&Слідкувати за ..." #: lazarusidestrconsts.lismenujumpback msgid "Jump back" @@ -10304,7 +10212,7 @@ msgstr "Новий..." #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." -msgstr "" +msgstr "Новий пакунок ..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." @@ -10324,10 +10232,8 @@ msgid "Online Help" msgstr "Мережева довідка" #: lazarusidestrconsts.lismenuopen -#, fuzzy -#| msgid "Open ..." msgid "&Open ..." -msgstr "Відкрити ..." +msgstr "&Відкрити ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open filename at cursor" @@ -10335,11 +10241,11 @@ msgstr "Відкрити назву файлу над курсором" #: lazarusidestrconsts.lismenuopenpackage msgid "Open loaded package ..." -msgstr "Відкриваю завантажений пакунок ..." +msgstr "Відкрити завантажений пакунок ..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open package file (.lpk) ..." -msgstr "Відкриття файлу пакунку (.lpk) ..." +msgstr "Відкрити файл пакунку (.lpk) ..." #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open package of current unit" @@ -10350,37 +10256,29 @@ msgid "Open Project ..." msgstr "Відкрити проект ..." #: lazarusidestrconsts.lismenuopenrecent -#, fuzzy -#| msgid "Open &Recent ..." msgid "Open &Recent" -msgstr "Відкрити нещодавні ..." +msgstr "Відкрити Не&щодавні" #: lazarusidestrconsts.lismenuopenrecentpkg -#, fuzzy -#| msgid "Open recent package ..." msgid "Open recent package" -msgstr "Відкрити попередній пакунок ..." +msgstr "Відкрити попередній пакунок" #: lazarusidestrconsts.lismenuopenrecentproject -#, fuzzy -#| msgid "Open Recent Project ..." msgctxt "lazarusidestrconsts.lismenuopenrecentproject" msgid "Open Recent Project" -msgstr "Відкрити останній проект ..." +msgstr "Відкрити Останній Проект" #: lazarusidestrconsts.lismenupackage msgid "Pa&ckage" -msgstr "" +msgstr "Па&кунок" #: lazarusidestrconsts.lismenupackagegraph -#, fuzzy -#| msgid "Package Graph ..." msgid "Package Graph" -msgstr "Пакунок Graph ..." +msgstr "Графік Пакунків" #: lazarusidestrconsts.lismenupackagelinks msgid "Package links ..." -msgstr "" +msgstr "Зв'язки пакунку ..." #: lazarusidestrconsts.lismenupaste msgctxt "lazarusidestrconsts.lismenupaste" @@ -10410,11 +10308,9 @@ msgid "Project Options ..." msgstr "Параметри проекту ..." #: lazarusidestrconsts.lismenuprojectrun -#, fuzzy -#| msgid "Run" msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "&Run" -msgstr "Виконати" +msgstr "Вико&нати" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." @@ -10433,10 +10329,8 @@ msgid "Quick syntax check OK" msgstr "" #: lazarusidestrconsts.lismenuquit -#, fuzzy -#| msgid "Quit" msgid "&Quit" -msgstr "Вихід" +msgstr "Ви&хід" #: lazarusidestrconsts.lismenuredo msgctxt "lazarusidestrconsts.lismenuredo" @@ -10458,12 +10352,14 @@ msgstr "Заміна" #: lazarusidestrconsts.lismenureplace2 msgid "&Replace ..." -msgstr "" +msgstr "За&мінити ..." #: lazarusidestrconsts.lismenureportingbug +#, fuzzy +#| msgid "Reporting a bug ..." msgctxt "lazarusidestrconsts.lismenureportingbug" msgid "Reporting a bug" -msgstr "" +msgstr "Повідомити про баг ..." #: lazarusidestrconsts.lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" @@ -10491,33 +10387,25 @@ msgid "Run File" msgstr "Виконати файл" #: lazarusidestrconsts.lismenurunparameters -#, fuzzy -#| msgid "Run Parameters ..." msgid "Run &Parameters ..." -msgstr "Параметри виконання ..." +msgstr "Пара&метри виконання ..." #: lazarusidestrconsts.lismenuruntocursor -#, fuzzy -#| msgid "Run to cursor" msgid "Run to &cursor" -msgstr "Виконати до курсора" +msgstr "Виконати до &курсора" #: lazarusidestrconsts.lismenusave -#, fuzzy -#| msgid "Save" msgctxt "lazarusidestrconsts.lismenusave" msgid "&Save" -msgstr "Зберегти" +msgstr "&Зберегти" #: lazarusidestrconsts.lismenusaveall msgid "Save All" msgstr "Зберегти всі" #: lazarusidestrconsts.lismenusaveas -#, fuzzy -#| msgid "Save As ..." msgid "Save &As ..." -msgstr "Зберегти як ..." +msgstr "Зберегти &Як ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" @@ -10573,13 +10461,11 @@ msgstr "Сортування вибраного ..." #: lazarusidestrconsts.lismenusource msgid "S&ource" -msgstr "" +msgstr "По&чатковий Код" #: lazarusidestrconsts.lismenustepinto -#, fuzzy -#| msgid "Step into" msgid "Step in&to" -msgstr "На крок із входом" +msgstr "Вс&тупити" #: lazarusidestrconsts.lismenustepintocontext msgid "Step into (Context)" @@ -10597,13 +10483,11 @@ msgstr "" #: lazarusidestrconsts.lismenustepout msgid "Step o&ut" -msgstr "" +msgstr "Пове&рнутись" #: lazarusidestrconsts.lismenustepover -#, fuzzy -#| msgid "Step over" msgid "&Step over" -msgstr "На крок в обхід" +msgstr "&Переступити" #: lazarusidestrconsts.lismenustepovercontext msgid "Step over (Context)" @@ -10626,11 +10510,11 @@ msgstr "Завершити" #: lazarusidestrconsts.lismenuswapcaseselection msgid "Swap case in selection" -msgstr "" +msgstr "Перемкнути регістр в виділенні" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to spaces in selection" -msgstr "ТАБ зробити пробілами в виділеному" +msgstr "Табуляція в пробіли в виділенні" #: lazarusidestrconsts.lismenutemplateabout msgid "About" @@ -10736,11 +10620,11 @@ msgstr "Посібник" #: lazarusidestrconsts.lismenutemplateundo msgctxt "lazarusidestrconsts.lismenutemplateundo" msgid "Undo" -msgstr "" +msgstr "Повернути" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle comment" -msgstr "" +msgstr "Перемкнути коментар" #: lazarusidestrconsts.lismenutools msgid "&Tools" @@ -10772,15 +10656,13 @@ msgid "&View" msgstr "&Вигляд" #: lazarusidestrconsts.lismenuviewanchoreditor -#, fuzzy -#| msgid "View Anchor Editor" msgid "Anchor Editor" -msgstr "Показувати редактор прив'язок" +msgstr "Редактор прив'язок" #: lazarusidestrconsts.lismenuviewassembler msgctxt "lazarusidestrconsts.lismenuviewassembler" msgid "Assembler" -msgstr "" +msgstr "Асемблер" #: lazarusidestrconsts.lismenuviewbreakpoints msgid "BreakPoints" @@ -10800,10 +10682,8 @@ msgid "Code Explorer" msgstr "Оглядач коду" #: lazarusidestrconsts.lismenuviewcomponentpalette -#, fuzzy -#| msgid "View Component Palette" msgid "Component Palette" -msgstr "Переглянути Палітру Компонетів" +msgstr "Палітра Компонентів" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" @@ -10819,29 +10699,23 @@ msgid "Debug output" msgstr "Повідомлення налагоджувача" #: lazarusidestrconsts.lismenuviewforms -#, fuzzy -#| msgid "Forms..." msgid "Forms ..." -msgstr "Форми..." +msgstr "Форми ..." #: lazarusidestrconsts.lismenuviewhistory msgctxt "lazarusidestrconsts.lismenuviewhistory" msgid "History" -msgstr "" +msgstr "Історія" #: lazarusidestrconsts.lismenuviewidespeedbuttons -#, fuzzy -#| msgid "View IDE speed buttons" msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons" msgid "IDE speed buttons" -msgstr "Переглянути швидкі клавіші графічної оболонки" +msgstr "Швидкі клавіші IDE" #: lazarusidestrconsts.lismenuviewjumphistory -#, fuzzy -#| msgid "Jump History ..." msgctxt "lazarusidestrconsts.lismenuviewjumphistory" msgid "Jump History" -msgstr "Переглядання історії переходів ..." +msgstr "Історії переходів" #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" @@ -10876,7 +10750,7 @@ msgstr "Результати пошуку" #: lazarusidestrconsts.lismenuviewsource msgid "&View Source" -msgstr "" +msgstr "&Переглянути Початковий Код" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" @@ -10885,7 +10759,7 @@ msgstr "Редактор тексту" #: lazarusidestrconsts.lismenuviewtaborder msgid "Tab Order" -msgstr "" +msgstr "Порядок Вкладок" #: lazarusidestrconsts.lismenuviewthreads msgctxt "lazarusidestrconsts.lismenuviewthreads" @@ -10902,20 +10776,14 @@ msgid "Toggle form/unit view" msgstr "Перемкнути форму/модуль" #: lazarusidestrconsts.lismenuviewunitdependencies -#, fuzzy -#| msgid "View Unit Dependencies" msgid "Unit Dependencies" -msgstr "Показувати залежності модулів" +msgstr "Залежності модулів" #: lazarusidestrconsts.lismenuviewunitinfo -#, fuzzy -#| msgid "Unit Information" msgid "Unit Information ..." -msgstr "Продивитись відомості про модулі" +msgstr "Інформація про модуль..." #: lazarusidestrconsts.lismenuviewunits -#, fuzzy -#| msgid "Units..." msgid "Units ..." msgstr "Модулі..." @@ -10925,7 +10793,7 @@ msgstr "Вікно спостережень" #: lazarusidestrconsts.lismenuwindow msgid "&Window" -msgstr "" +msgstr "&Вікно" #: lazarusidestrconsts.lismessagecontainsnofilepositioninformation msgid "Message contains no file position information:%s%s" @@ -10998,7 +10866,7 @@ msgstr "" #: lazarusidestrconsts.lismore msgctxt "lazarusidestrconsts.lismore" msgid "More" -msgstr "" +msgstr "Більше" #: lazarusidestrconsts.lismoveonepositiondown msgid "Move \"%s\" one position down" @@ -11014,7 +10882,7 @@ msgstr "" #: lazarusidestrconsts.lisms msgid "(ms)" -msgstr "" +msgstr "(мс)" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" @@ -11031,11 +10899,11 @@ msgstr "Назва нової процедури" #: lazarusidestrconsts.lisnever msgctxt "lazarusidestrconsts.lisnever" msgid "Never" -msgstr "" +msgstr "Ніколи" #: lazarusidestrconsts.lisnew msgid "new" -msgstr "" +msgstr "новий" #: lazarusidestrconsts.lisnewancestors msgid "New Ancestors" @@ -11070,20 +10938,16 @@ msgid "Create a new empty text file." msgstr "Створити новий порожній текстовий файл." #: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication -#, fuzzy -#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." msgid "Create a new graphical application.%sThe application source is maintained by Lazarus." -msgstr "Створити нову графічну програму.%sЦя програма підтримується Lazarus." +msgstr "Створити нову графічну програму.%sДжерело програми підтримується Lazarus." #: lazarusidestrconsts.lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Створити новий модуль паскаля." #: lazarusidestrconsts.lisnewdlgcreateanewprogram -#, fuzzy -#| msgid "Create a new program.%sThe program file is maintained by Lazarus." msgid "Create a new program.%sThe program source is maintained by Lazarus." -msgstr "Створити нову програму.%sФайл програми підтримується Lazarus." +msgstr "Створити нову програму.%sДжерело програми підтримується Lazarus." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." @@ -11126,10 +10990,8 @@ msgid "New group - a set of modes" msgstr "" #: lazarusidestrconsts.lisnewproject -#, fuzzy -#| msgid "%s - (new project)" msgid "(new project)" -msgstr "%s - (новий проект)" +msgstr "(новий проект)" #: lazarusidestrconsts.lisnewsetting msgid "New setting" @@ -11141,7 +11003,7 @@ msgstr "" #: lazarusidestrconsts.lisno msgid "No" -msgstr "" +msgstr "Ні" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" @@ -11353,7 +11215,7 @@ msgstr "Відкрити завантажений пакунок" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" -msgstr "Пакунок Name" +msgstr "Назва Пакунку" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" @@ -11381,14 +11243,12 @@ msgid "%sThis package was automatically created" msgstr "%sЦей пакунок створений автоматично" #: lazarusidestrconsts.lisok -#, fuzzy -#| msgid "&Ok" msgid "&OK" msgstr "&Гаразд" #: lazarusidestrconsts.lisold msgid "old" -msgstr "" +msgstr "старий" #: lazarusidestrconsts.lisoldancestors msgid "Old Ancestors" @@ -11536,11 +11396,11 @@ msgstr "Пакунок" #: lazarusidestrconsts.lispackage2 msgid "package %s" -msgstr "" +msgstr "пакунок %s" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" -msgstr "Пакунок Info" +msgstr "Інфо про Пакунок" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." @@ -11588,7 +11448,7 @@ msgstr "" #: lazarusidestrconsts.lispath msgid "Path" -msgstr "" +msgstr "Шлях" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" @@ -11729,10 +11589,8 @@ msgid "Modified: %s" msgstr "Змінено: %s" #: lazarusidestrconsts.lispckeditmore -#, fuzzy -#| msgid "More ..." msgid "More >>" -msgstr "Докладніше ..." +msgstr "Більше >>" #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" @@ -11744,7 +11602,7 @@ msgstr "Пересунути залежність вверх" #: lazarusidestrconsts.lispckeditpackage msgid "Package %s" -msgstr "Пакунок%s" +msgstr "Пакунок %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" @@ -11885,7 +11743,7 @@ msgstr "Завантажені пакунки" #: lazarusidestrconsts.lispckexplpackagenotfound msgid "Package %s not found" -msgstr "Пакунк%sне знайдений" +msgstr "Пакунок %s не знайдено" #: lazarusidestrconsts.lispckexplstate msgid "%sState: " @@ -12188,10 +12046,8 @@ msgid "Revert package?" msgstr "Повернути пакунок?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage -#, fuzzy -#| msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?" -msgstr "Файл %s%s%s%sзараз не знаходиться в списку шляхів модулів пакунку.%s%sДодати його туди?" +msgstr "Файл %s%s%s%sзараз не знаходиться в списку шляхів модулів пакунку.%s%sДодати %s%s%s в шлях?" #: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" @@ -12228,7 +12084,7 @@ msgstr "Ресурс LRS - Lazarus" #: lazarusidestrconsts.lispkgfiletypemainunit msgid "Main Unit" -msgstr "" +msgstr "Основний Модуль" #: lazarusidestrconsts.lispkgfiletypetext msgctxt "lazarusidestrconsts.lispkgfiletypetext" @@ -12416,7 +12272,7 @@ msgstr "Новий пакунок" #: lazarusidestrconsts.lispkgmangpackage msgid "Package: %s" -msgstr "Пакунок:%s" +msgstr "Пакунок: %s" #: lazarusidestrconsts.lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" @@ -12799,32 +12655,32 @@ msgstr "Неможливо прочитати файл пакунку %s%s%s.%s #: lazarusidestrconsts.lispldexists msgid "Exists" -msgstr "" +msgstr "Існує" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" msgid "Global" -msgstr "" +msgstr "Глобальна" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" -msgstr "" +msgstr "Лише існуючі файли" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" -msgstr "" +msgstr "Зв'язки Пакунку" #: lazarusidestrconsts.lispldshowgloballinks msgid "Show global links" -msgstr "" +msgstr "Показувати глобальні зв'язки" #: lazarusidestrconsts.lispldshowuserlinks msgid "Show user links" -msgstr "" +msgstr "Показувати користувацькі зв'язки" #: lazarusidestrconsts.lisplduser msgid "User" -msgstr "" +msgstr "Користувацька" #: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow msgid "Please fix the error shown in the message window, which is normally below the source editor." @@ -12876,7 +12732,7 @@ msgstr "&Об'єкти" #: lazarusidestrconsts.lisplistprocedurelist msgid "Procedure List" -msgstr "" +msgstr "Список Процедур" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" @@ -12893,7 +12749,7 @@ msgstr "Не зберігати ніякої сесії" #: lazarusidestrconsts.lispointer msgid "Pointer" -msgstr "" +msgstr "Вказівник" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" @@ -12936,10 +12792,8 @@ msgid "Private Method" msgstr "Приватний метод" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti -#, fuzzy -#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s" -msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%s%sЗауважте:%sПроект залежить від деяких пакунків, які містять модулі з процедурою Register. Процедура Register зазвичай використовується для встановлення компонентів в IDE. Але наступні модулі залежать від пакунків, які ще не встановлено в IDE. Якщо Ви спробуєте відкрити форму в IDE, яка використовує таку компоненту, отримаєте повідомлення про відсутність компонентів і результати завантаження форми не дадуть очікуваного результату.%s%sЦе жодним чином не відіб'ється на проекті, який відкривається чи на його файлах.%s%sЦе тільки означає: Недобре відкривати форми для роботи перед встановленням відсутніх пакунків.%s%s" +msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%s%sПопередження:%sПроект використовує наступні пакунки, які можуть знадобитись для відкриття форми в дизайнері. Якщо Ви продовжите, ви можете отримати помилки про відсутність компонентів і завантаження форми швидше за все призведе до неприємних результатів.%s%sРекомендується скасувати та спочатку встановити ці пакунки.%s%s" #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" @@ -12956,10 +12810,8 @@ msgid "Program" msgstr "Програма" #: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic -#, fuzzy -#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus." -msgstr "Програма%sПрограма freepascal. Файл програми автоматично підтримується lazarus." +msgstr "Програма%sПрограма freepascal. Джерело програми автоматично підтримується Lazarus." #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" @@ -13023,7 +12875,7 @@ msgstr "Нова вимога" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" -msgstr "Пакунок Name:" +msgstr "Назва Пакунку:" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" @@ -13147,10 +12999,8 @@ msgid "Project Src Path" msgstr "Шлях до кодів проекту" #: lazarusidestrconsts.lisprojectsuccessfullybuilt -#, fuzzy -#| msgid "Project %s%s%s successfully built. :)" msgid "Project %s%s%s successfully built" -msgstr "Проект %s%s%s успішно зібрано. :)" +msgstr "Проект %s%s%s успішно зібрано" #: lazarusidestrconsts.lisprojectunit msgid "project unit" @@ -13292,18 +13142,16 @@ msgstr "" #: lazarusidestrconsts.lispwnewproject msgid "New Project" -msgstr "" +msgstr "Новий Проект" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" -msgstr "" +msgstr "Відкрити Проект" #: lazarusidestrconsts.lispwopenrecentproject -#, fuzzy -#| msgid "Open Recent" msgctxt "lazarusidestrconsts.lispwopenrecentproject" msgid "Open Recent Project" -msgstr "Відкрити нещодавні" +msgstr "Відкрити Нещодавній Проект" #: lazarusidestrconsts.lisquickfixcreatelocalvariable msgid "Create local variable" @@ -13614,10 +13462,8 @@ msgid "Save all messages to file" msgstr "Зберегти всі повідомлення в файл" #: lazarusidestrconsts.lissaveallmodified -#, fuzzy -#| msgid "save all modified files" msgid "Save all modified files" -msgstr "зберегти всі змінені файли" +msgstr "Зберегти всі змінені файли" #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" @@ -13636,10 +13482,8 @@ msgid "Save changes to project %s?" msgstr "Зберегти зміни в проект %s?" #: lazarusidestrconsts.lissavecurrenteditorfile -#, fuzzy -#| msgid "save current editor file" msgid "Save current editor file" -msgstr "зберегти поточний файл редактора" +msgstr "Зберегти поточний файл редактора" #: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" @@ -13776,7 +13620,7 @@ msgstr "" #: lazarusidestrconsts.lissetvalue msgid "Set value" -msgstr "" +msgstr "Вказати значення" #: lazarusidestrconsts.lisshort msgid "Short:" @@ -13898,7 +13742,7 @@ msgstr "Скасувати" #: lazarusidestrconsts.lissortselcasesensitive msgctxt "lazarusidestrconsts.lissortselcasesensitive" msgid "&Case Sensitive" -msgstr "" +msgstr "&Чутливий до Регістру" #: lazarusidestrconsts.lissortseldescending msgid "Descending" @@ -14041,12 +13885,12 @@ msgstr "Помилка потоків" #: lazarusidestrconsts.lisstring msgid "String" -msgstr "" +msgstr "Рядок" #: lazarusidestrconsts.lisstyle msgctxt "lazarusidestrconsts.lisstyle" msgid "Style" -msgstr "" +msgstr "Стиль" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" @@ -14201,50 +14045,36 @@ msgid "The %s contains a star * character.%sLazarus uses this as normal characte msgstr "" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho -#, fuzzy -#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" -msgstr "%s%s%s.%sІнакше перевірте Оточення->Параметри оточення->Файли" +msgstr "Поточний файл компілятора %s%s%s%sне є виконуваним файлом.%sВибіреть Ok щоб вибрати типовий %s%s%s.%sІнакше перевірте Інструменти->Параметри->Файли" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease -#, fuzzy -#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Tools -> Options -> Files" -msgstr "Поточна назва компілятора %s%s%s%s не є виконуваним файлом.%sПеревірте Environment -> Environment Options -> Files" +msgstr "Поточний файл компілятора %s%s%s%sне є виконуваним файлом.%sПеревірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." msgstr "" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr -#, fuzzy -#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" -msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sВиберіть Гаразд щоб повернути використаний за замовчуванням %s%s%s,%s або перевірте Оточення -> Параметри Оточення -> Файли" +msgstr "Поточна тека вихідних кодів Free Pascal %s%s%s%sвиглядає неправильною.%sВиберіть Гаразд щоб вибрати типову %s%s%s.%sІнакше перевірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 -#, fuzzy -#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Tools -> Options -> Files" -msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sПеревірте Оточення -> Параметри Оточення -> Файли" +msgstr "Поточна тека вихідних кодів Free Pascal %s%s%s%sвиглядає неправильною.%sПеревірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou -#, fuzzy -#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" -msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sВиберіть ОК для використовування теки за замовчуванням %s%s%s,%s або перевірте Оточення -> Параматри Оточення -> Files" +msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез неї Ви не зможете створювати додатки LCL.%sВиберіть ОК для використання теки за замовчуванням %s%s%s.%sІнакше перевірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 -#, fuzzy -#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Tools -> Options -> Files" -msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sПеревірте Оточення -> Параметри Оточення -> Файли" +msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез неї Ви не зможете створювати додатки LCL.%sПеревірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro -#, fuzzy -#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options" -msgstr "Налагоджувач %s%s%s%sdoes не існує або не є виконуваним.%s%sДив. Оточення -> Параметри Налагоджувача" +msgstr "Налагоджувач %s%s%s%sне існує або не є виконуваним.%s%sДив. Інструменти -> Параметри -> Параметри Налагоджувача" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." @@ -14341,10 +14171,8 @@ msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended msgstr "Компілятор FreePascal (назва файлу: %s) не знайдено.%sВам рекомендується встановити fpc" #: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun -#, fuzzy -#| msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sTools -> Options -> Files" -msgstr "Теки кодів FPC не знайдено.%sОкремі дії з кодом не будуть працювати.%sРекомендується встановити її і встановити шлях%sОточення -> Оточення Параматри -> Файли" +msgstr "Теку вихідних кодів Free Pascal не знайдено.%sОкремі дії з кодом не будуть працювати.%sРекомендується встановити її і встановити шлях%sІнструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s" @@ -14371,10 +14199,8 @@ msgid "The Lazarus directory contains the sources of the IDE and the package fil msgstr "" #: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr -#, fuzzy -#| msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files" msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Tools -> Options -> Files" -msgstr "Теки Lazarus не знайдено.%sВи не зможете створювати додатки LCL.Перевірте Оточення -> Параметри Оточення -> Файли" +msgstr "Теку Lazarus не знайдено.%sВи не зможете створювати додатки LCL.%sПеревірте Інструменти -> Параметри -> Файли" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." @@ -14473,10 +14299,8 @@ msgid "The project information file %s%s%s%shas changed on disk." msgstr "" #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest -#, fuzzy -#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" -msgstr "Проект треба зберегти для компіляції%sЯкщо Ви встановите теку проб в параметри оточення,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?" +msgstr "Проект треба зберегти перед компіляцією%sЯкщо Ви встановите Тестову Теку в параметрах IDE,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." @@ -14630,20 +14454,20 @@ msgstr "" #: lazarusidestrconsts.listhreadscurrent msgctxt "lazarusidestrconsts.listhreadscurrent" msgid "Current" -msgstr "" +msgstr "Поточний" #: lazarusidestrconsts.listhreadsfunc msgctxt "lazarusidestrconsts.listhreadsfunc" msgid "Function" -msgstr "" +msgstr "Функція" #: lazarusidestrconsts.listhreadsgoto msgid "Goto" -msgstr "" +msgstr "ЙтиДо" #: lazarusidestrconsts.listhreadsid msgid "Id" -msgstr "" +msgstr "Id" #: lazarusidestrconsts.listhreadsline msgctxt "lazarusidestrconsts.listhreadsline" @@ -14662,7 +14486,7 @@ msgstr "" #: lazarusidestrconsts.listhreadssrc msgctxt "lazarusidestrconsts.listhreadssrc" msgid "Source" -msgstr "" +msgstr "Джерело" #: lazarusidestrconsts.listhreadsstate msgctxt "lazarusidestrconsts.listhreadsstate" @@ -14732,7 +14556,7 @@ msgstr "" #: lazarusidestrconsts.listop msgctxt "lazarusidestrconsts.listop" msgid "Top" -msgstr "" +msgstr "Верхній" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" @@ -14779,14 +14603,12 @@ msgid "Font without UTF-8" msgstr "Шрифт без UTF-8" #: lazarusidestrconsts.lisuegotoline -#, fuzzy -#| msgid "Goto line :" msgid "Goto line:" msgstr "Перейти до рядка:" #: lazarusidestrconsts.lisuemodeseparator msgid "/" -msgstr "" +msgstr "/" #: lazarusidestrconsts.lisuenotfound msgid "Not found" @@ -14990,7 +14812,7 @@ msgstr "Не можу створити тимчасовий lfm буфер" #: lazarusidestrconsts.lisunabletodelete msgid "Unable to delete" -msgstr "" +msgstr "Не можу видалити" #: lazarusidestrconsts.lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" @@ -15132,7 +14954,7 @@ msgstr "Неможливо змінити назву змінної в коді. #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" -msgstr "" +msgstr "Не можу запустити" #: lazarusidestrconsts.lisunabletosavefile msgid "Unable to save file %s%s%s" @@ -15195,10 +15017,8 @@ msgid "Unable to write the project session file%s\"%s\".%sError: %s" msgstr "" #: lazarusidestrconsts.lisunabletowritetofile -#, fuzzy -#| msgid "Unable to write to file %s%s%s!" msgid "Unable to write to file %s%s%s." -msgstr "Не можу записати в файл %s%s%s!" +msgstr "Не можу записати в файл %s%s%s." #: lazarusidestrconsts.lisunabletowritetofile2 msgid "Unable to write to file \"%s\"." @@ -15359,19 +15179,19 @@ msgstr "" #: lazarusidestrconsts.lisvalue msgid "Value:" -msgstr "" +msgstr "Змінна:" #: lazarusidestrconsts.lisvalue2 msgid "Value%s" -msgstr "" +msgstr "Змінна%s" #: lazarusidestrconsts.lisvalue3 msgid "Value: " -msgstr "" +msgstr "Змінна: " #: lazarusidestrconsts.lisvalues msgid "Values" -msgstr "" +msgstr "Змінні" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" @@ -15412,7 +15232,7 @@ msgstr "" #: lazarusidestrconsts.liswarning msgid "Warning: " -msgstr "" +msgstr "Попередження: " #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" @@ -15659,7 +15479,7 @@ msgstr "" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" -msgstr "" +msgstr "Параметри i18n" #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include Version Info in executable" @@ -15697,7 +15517,7 @@ msgstr "Ключ" #: lazarusidestrconsts.rslanguageafrikaans msgid "Afrikaans" -msgstr "Африканський" +msgstr "Африкаанс" #: lazarusidestrconsts.rslanguagearabic msgid "Arabic" @@ -15717,11 +15537,11 @@ msgstr "Китайська" #: lazarusidestrconsts.rslanguageczech msgid "Czech" -msgstr "" +msgstr "Чеська" #: lazarusidestrconsts.rslanguagedutch msgid "Dutch" -msgstr "Датський" +msgstr "Голландська" #: lazarusidestrconsts.rslanguageenglish msgid "English" @@ -15741,7 +15561,7 @@ msgstr "Німецька" #: lazarusidestrconsts.rslanguagehebrew msgid "Hebrew" -msgstr "Єврейська" +msgstr "Іврит" #: lazarusidestrconsts.rslanguageindonesian msgid "Indonesian" @@ -15757,11 +15577,11 @@ msgstr "Японська" #: lazarusidestrconsts.rslanguagelithuanian msgid "Lithuanian" -msgstr "" +msgstr "Литовська" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" -msgstr "" +msgstr "Параметри Мови" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" @@ -15769,11 +15589,11 @@ msgstr "Польська" #: lazarusidestrconsts.rslanguageportuguese msgid "Portuguese" -msgstr "" +msgstr "Португальська" #: lazarusidestrconsts.rslanguageportuguesebr msgid "Brazilian Portuguese" -msgstr "" +msgstr "Бразильська португальська" #: lazarusidestrconsts.rslanguagerussian msgid "Russian" @@ -15781,11 +15601,11 @@ msgstr "Російська" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" -msgstr "" +msgstr "Вибір мови:" #: lazarusidestrconsts.rslanguageslovak msgid "Slovak" -msgstr "" +msgstr "Словацька" #: lazarusidestrconsts.rslanguagespanish msgid "Spanish" @@ -15793,7 +15613,7 @@ msgstr "Іспанська" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" -msgstr "" +msgstr "Турецька" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" @@ -15814,7 +15634,7 @@ msgstr "Гаразд" #: lazarusidestrconsts.rsotherinfo msgid "Other info" -msgstr "" +msgstr "Інша Інформація" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" @@ -16004,11 +15824,11 @@ msgstr "Завершення шаблонів коду" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" -msgstr "" +msgstr "Копіювати Блок" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" -msgstr "" +msgstr "Видалити Блок" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" @@ -16020,7 +15840,7 @@ msgstr "" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" -msgstr "" +msgstr "Сховати Блок" #: lazarusidestrconsts.srkmecblockindent msgid "Indent block" @@ -16028,7 +15848,7 @@ msgstr "Зсунути блок вправо" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" -msgstr "" +msgstr "Перемістити Блок" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" @@ -16040,11 +15860,11 @@ msgstr "" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" -msgstr "" +msgstr "Показати Блок" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" -msgstr "" +msgstr "Перемкнути блок" #: lazarusidestrconsts.srkmecblockunindent msgid "Unindent block" @@ -16229,7 +16049,7 @@ msgstr "" #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" -msgstr "" +msgstr "Параметри IDE" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" @@ -16561,7 +16381,7 @@ msgstr "швидка компіляція без збирання" #: lazarusidestrconsts.srkmecquit msgid "Quit" -msgstr "" +msgstr "Вийти" #: lazarusidestrconsts.srkmecremovebreakpoint msgid "remove break point" @@ -16586,7 +16406,7 @@ msgstr "Замінити текст" #: lazarusidestrconsts.srkmecreportingbug msgctxt "lazarusidestrconsts.srkmecreportingbug" msgid "Reporting a bug" -msgstr "" +msgstr "Повідомити про баг ..." #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" @@ -16636,7 +16456,7 @@ msgstr "Виділити всі" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" -msgstr "Перетворення ТАБ в пробіли в виділеному" +msgstr "Перетворити табуляцію в пробіли в виділеному" #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" @@ -16804,7 +16624,7 @@ msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" -msgstr "" +msgstr "Наступна Клітинка" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" @@ -16822,7 +16642,7 @@ msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" -msgstr "" +msgstr "Попередня Клітинка" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" @@ -16835,7 +16655,7 @@ msgstr "Перевірка синтаксису" #: lazarusidestrconsts.srkmectoggleassembler msgid "View assembler" -msgstr "" +msgstr "Переглянути асемблер" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle break point" @@ -16904,7 +16724,7 @@ msgstr "Показувати Інспектор Об'єктів" #: lazarusidestrconsts.srkmectoggleregisters msgid "View registers" -msgstr "" +msgstr "Переглянути регістри" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" @@ -16924,7 +16744,7 @@ msgstr "Показувати спостереження" #: lazarusidestrconsts.srkmecunfoldall msgid "Unfold all" -msgstr "" +msgstr "Розгорунти все" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" @@ -17048,7 +16868,7 @@ msgstr "\" не для запису." #: lazarusidestrconsts.uelocked msgid "Locked" -msgstr "" +msgstr "Заблоковано" #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" @@ -17072,8 +16892,6 @@ msgid "Copy" msgstr "Копіювати" #: lazarusidestrconsts.uemcopyfilename -#, fuzzy -#| msgid "Copy filename" msgid "Copy Filename" msgstr "Копіювати назву файлу" @@ -17088,7 +16906,7 @@ msgstr "" #: lazarusidestrconsts.uemcopytootherwindownew msgctxt "lazarusidestrconsts.uemcopytootherwindownew" msgid "New Window" -msgstr "" +msgstr "Нове Вікно" #: lazarusidestrconsts.uemcut msgctxt "lazarusidestrconsts.uemcut" @@ -17105,7 +16923,7 @@ msgstr "Властивості редактора" #: lazarusidestrconsts.uemencoding msgid "Encoding" -msgstr "" +msgstr "Кодування" #: lazarusidestrconsts.uemevaluatemodify msgid "&Evaluate/Modify ..." @@ -17134,7 +16952,7 @@ msgstr "Інвертувати присвоєння" #: lazarusidestrconsts.uemlineending msgid "Line ending" -msgstr "" +msgstr "Кінець рядка" #: lazarusidestrconsts.uemlockpage msgid "&Lock Page" @@ -17167,7 +16985,7 @@ msgstr "" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" msgid "New Window" -msgstr "" +msgstr "Нове Вікно" #: lazarusidestrconsts.uemnextbookmark msgid "Goto next Bookmark" @@ -17223,7 +17041,7 @@ msgstr "Показувати нумерацію рядків" #: lazarusidestrconsts.uemsource msgctxt "lazarusidestrconsts.uemsource" msgid "Source" -msgstr "" +msgstr "Джерело" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" diff --git a/lcl/languages/lclstrconsts.uk.po b/lcl/languages/lclstrconsts.uk.po index 6066ec5842..c2a89a3989 100644 --- a/lcl/languages/lclstrconsts.uk.po +++ b/lcl/languages/lclstrconsts.uk.po @@ -1,44 +1,49 @@ msgid "" msgstr "" +"Last-Translator: Igor Paliychuk \n" +"Project-Id-Version: lazaruside\n" +"POT-Creation-Date: \n" +"PO-Revision-Date: 2011-05-24 23:49+0200\n" +"Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: lclstrconsts.hhshelpbrowsernotexecutable msgid "Browser %s%s%s not executable." -msgstr "" +msgstr "Браузер %s%s%s не є виконуваним." #: lclstrconsts.hhshelpbrowsernotfound msgid "Browser %s%s%s not found." -msgstr "" +msgstr "Браузер %s%s%s не знайдено." #: lclstrconsts.hhshelperrorwhileexecuting msgid "Error while executing %s%s%s:%s%s" -msgstr "" +msgstr "Помилка при виконанні %s%s%s:%s%s" #: lclstrconsts.hhshelpnohtmlbrowserfound msgid "Unable to find a HTML browser." -msgstr "" +msgstr "Не вдається знайти браузер HTML." #: lclstrconsts.hhshelpnohtmlbrowserfoundpleasedefineone msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help -> Help Options" -msgstr "" +msgstr "Браузер HTML не знайдено.%sЗадайте його в меню Оточення -> Параметри -> Допомога -> Параметри допомоги" #: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile msgid "The help database %s%s%s was unable to find file %s%s%s." -msgstr "" +msgstr "База даних довідки %s%s%s не змогла знайти файл %s%s%s." #: lclstrconsts.hhshelpthemacrosinbrowserparamswillbereplacedbytheurl msgid "The macro %s in BrowserParams will be replaced by the URL." -msgstr "" +msgstr "Макрос %s в BrowserParams буде замінений на URL." #: lclstrconsts.ifsalt msgid "Alt" -msgstr "" +msgstr "Alt" #: lclstrconsts.ifsctrl msgid "Ctrl" -msgstr "" +msgstr "Ctrl" #: lclstrconsts.ifsvk_accept msgid "Accept" @@ -50,16 +55,16 @@ msgstr "кнопка програми" #: lclstrconsts.ifsvk_back msgid "Backspace" -msgstr "Забій" +msgstr "Backspace" #: lclstrconsts.ifsvk_cancel msgctxt "lclstrconsts.ifsvk_cancel" msgid "Cancel" -msgstr "" +msgstr "Скасувати" #: lclstrconsts.ifsvk_capital msgid "Capital" -msgstr "Заголовний" +msgstr "Великі літери" #: lclstrconsts.ifsvk_clear msgid "Clear" @@ -67,7 +72,7 @@ msgstr "Очистити" #: lclstrconsts.ifsvk_control msgid "Control" -msgstr "Контрол" +msgstr "Керування" #: lclstrconsts.ifsvk_convert msgid "Convert" @@ -76,7 +81,7 @@ msgstr "Перетворити" #: lclstrconsts.ifsvk_delete msgctxt "lclstrconsts.ifsvk_delete" msgid "Delete" -msgstr "" +msgstr "Видалити" #: lclstrconsts.ifsvk_down msgctxt "lclstrconsts.ifsvk_down" @@ -90,11 +95,11 @@ msgstr "Кінець" #: lclstrconsts.ifsvk_escape msgid "Escape" -msgstr "" +msgstr "Вихід" #: lclstrconsts.ifsvk_execute msgid "Execute" -msgstr "Виконувати" +msgstr "Виконати" #: lclstrconsts.ifsvk_final msgid "Final" @@ -102,7 +107,7 @@ msgstr "Кінцевий" #: lclstrconsts.ifsvk_hanja msgid "Hanja" -msgstr "Корейська" +msgstr "Китайська" #: lclstrconsts.ifsvk_help msgid "Help" @@ -111,12 +116,12 @@ msgstr "Допомога" #: lclstrconsts.ifsvk_home msgctxt "lclstrconsts.ifsvk_home" msgid "Home" -msgstr "" +msgstr "Дім" #: lclstrconsts.ifsvk_insert msgctxt "lclstrconsts.ifsvk_insert" msgid "Insert" -msgstr "" +msgstr "Вставити" #: lclstrconsts.ifsvk_junja msgid "Junja" @@ -128,7 +133,7 @@ msgstr "Японська" #: lclstrconsts.ifsvk_lbutton msgid "Mouse Button Left" -msgstr "Ліва кнопка мишки" +msgstr "Ліва клавіша миші" #: lclstrconsts.ifsvk_left msgctxt "lclstrconsts.ifsvk_left" @@ -137,11 +142,11 @@ msgstr "Вліво" #: lclstrconsts.ifsvk_lwin msgid "left windows key" -msgstr "ліва кнопка Win" +msgstr "ліва клавіша Win" #: lclstrconsts.ifsvk_mbutton msgid "Mouse Button Middle" -msgstr "Середня кнопка мишки" +msgstr "Середня клавіша миші" #: lclstrconsts.ifsvk_menu msgctxt "lclstrconsts.ifsvk_menu" @@ -155,7 +160,7 @@ msgstr "Зміна режиму" #: lclstrconsts.ifsvk_next msgctxt "lclstrconsts.ifsvk_next" msgid "Next" -msgstr "" +msgstr "Наступний" #: lclstrconsts.ifsvk_nonconvert msgid "Nonconvert" @@ -163,7 +168,7 @@ msgstr "Неконвертоване" #: lclstrconsts.ifsvk_numlock msgid "Numlock" -msgstr "" +msgstr "Numlock" #: lclstrconsts.ifsvk_numpad msgid "Numpad %d" @@ -171,7 +176,7 @@ msgstr "Numpad %d" #: lclstrconsts.ifsvk_pause msgid "Pause key" -msgstr "Кнопка Pause" +msgstr "Клавіша Pause" #: lclstrconsts.ifsvk_print msgid "Print" @@ -180,28 +185,28 @@ msgstr "Друкувати" #: lclstrconsts.ifsvk_prior msgctxt "lclstrconsts.ifsvk_prior" msgid "Prior" -msgstr "" +msgstr "Попередній" #: lclstrconsts.ifsvk_rbutton msgid "Mouse Button Right" -msgstr "Права кнопка мишки" +msgstr "Права клавіша миші" #: lclstrconsts.ifsvk_return msgid "Return" -msgstr "" +msgstr "Enter" #: lclstrconsts.ifsvk_right msgctxt "lclstrconsts.ifsvk_right" msgid "Right" -msgstr "" +msgstr "Вправо" #: lclstrconsts.ifsvk_rwin msgid "right windows key" -msgstr "права кнопка Win" +msgstr "права клавіша Win" #: lclstrconsts.ifsvk_scroll msgid "Scroll" -msgstr "" +msgstr "Scroll" #: lclstrconsts.ifsvk_select msgid "Select" @@ -209,11 +214,11 @@ msgstr "Вибрати" #: lclstrconsts.ifsvk_shift msgid "Shift" -msgstr "" +msgstr "Shift" #: lclstrconsts.ifsvk_snapshot msgid "Snapshot" -msgstr "Знімок" +msgstr "Скріншот" #: lclstrconsts.ifsvk_space msgid "Space key" @@ -222,7 +227,7 @@ msgstr "Пробіл" #: lclstrconsts.ifsvk_tab msgctxt "lclstrconsts.ifsvk_tab" msgid "Tab" -msgstr "" +msgstr "Tab" #: lclstrconsts.ifsvk_unknown msgid "Unknown" @@ -235,38 +240,36 @@ msgstr "Вверх" #: lclstrconsts.liscannotexecute msgid "can not execute %s" -msgstr "" +msgstr "неможливо виконати %s" #: lclstrconsts.lislclresourcesnotfound msgctxt "lclstrconsts.lislclresourcesnotfound" msgid "Resource %s not found" -msgstr "Ресурсу %s не знайдено" +msgstr "Ресурс %s не знайдено" #: lclstrconsts.lisprogramfilenotfound msgid "program file not found %s" -msgstr "" +msgstr "програмний файл %s не знайдено" #: lclstrconsts.rs3ddkshadowcolorcaption msgid "3D Dark Shadow" -msgstr "" +msgstr "Об'ємна тінь" #: lclstrconsts.rs3dlightcolorcaption msgid "3D Light" -msgstr "" +msgstr "Об'ємне світло" #: lclstrconsts.rsacontrolcannothaveitselfasparent -#, fuzzy -#| msgid "A control can't have itself as parent" msgid "A control can't have itself as a parent" msgstr "Елемент управління не може бути сам собі предком" #: lclstrconsts.rsactivebordercolorcaption msgid "Active Border" -msgstr "" +msgstr "Активні межі" #: lclstrconsts.rsactivecaptioncolorcaption msgid "Active Caption" -msgstr "" +msgstr "Активні заголовки" #: lclstrconsts.rsallfiles msgid "All files (%s)|%s|%s" @@ -274,19 +277,19 @@ msgstr "Всі файли (%s)|%s|%s" #: lclstrconsts.rsappworkspacecolorcaption msgid "Application Workspace" -msgstr "" +msgstr "Робоча область програми" #: lclstrconsts.rsaquacolorcaption msgid "Aqua" -msgstr "" +msgstr "Колір морської хвилі" #: lclstrconsts.rsbackgroundcolorcaption msgid "Desktop" -msgstr "" +msgstr "Робочий стіл" #: lclstrconsts.rsbackward msgid "Backward" -msgstr "" +msgstr "Навпаки" #: lclstrconsts.rsbitmaps msgid "Bitmaps" @@ -294,7 +297,7 @@ msgstr "Піктограмки" #: lclstrconsts.rsblackcolorcaption msgid "Black" -msgstr "" +msgstr "Чорний" #: lclstrconsts.rsblank msgid "Blank" @@ -302,23 +305,23 @@ msgstr "Порожній" #: lclstrconsts.rsbluecolorcaption msgid "Blue" -msgstr "" +msgstr "Синій" #: lclstrconsts.rsbtnfacecolorcaption msgid "Button Face" -msgstr "" +msgstr "Вигляд кнопки" #: lclstrconsts.rsbtnhighlightcolorcaption msgid "Button Highlight" -msgstr "" +msgstr "Підсвітка кнопки" #: lclstrconsts.rsbtnshadowcolorcaption msgid "Button Shadow" -msgstr "" +msgstr "Тінь кнопки" #: lclstrconsts.rsbtntextcolorcaption msgid "Button Text" -msgstr "" +msgstr "Текст кнопки" #: lclstrconsts.rscalculator msgid "Calculator" @@ -327,35 +330,35 @@ msgstr "Калькулятор" #: lclstrconsts.rscancelrecordhint msgctxt "lclstrconsts.rscancelrecordhint" msgid "Cancel" -msgstr "" +msgstr "Скасувати" #: lclstrconsts.rscannotfocus msgid "Can not focus" -msgstr "Не можу прийняти фокус" +msgstr "Не можу сфокусуватися" #: lclstrconsts.rscanvasdoesnotallowdrawing msgid "Canvas does not allow drawing" -msgstr "Канва не підтримує малювання" +msgstr "Полотно не підтримує малювання" #: lclstrconsts.rscaptiontextcolorcaption msgid "Caption Text" -msgstr "" +msgstr "Текст заголовка" #: lclstrconsts.rscasesensitive msgid "Case sensitive" -msgstr "" +msgstr "Врахування регістру" #: lclstrconsts.rscontrolclasscantcontainchildclass msgid "Control of class '%s' can't have control of class '%s' as a child" -msgstr "" +msgstr "Елемент управління класу '%s' не може мати наслідником елемент класу '%s'" #: lclstrconsts.rscontrolhasnoparentwindow msgid "Control '%s' has no parent window" -msgstr "" +msgstr "Елемент управління '%s' не має батьківського вінка" #: lclstrconsts.rscreamcolorcaption msgid "Cream" -msgstr "" +msgstr "Кремовий" #: lclstrconsts.rscreatinggdbcatchableerror msgid "Creating gdb catchable error:" @@ -363,23 +366,23 @@ msgstr "Створення помилки кешування gdb:" #: lclstrconsts.rscursor msgid "Cursor" -msgstr "" +msgstr "Курсор" #: lclstrconsts.rscustomcolorcaption msgid "Custom ..." -msgstr "" +msgstr "Власний..." #: lclstrconsts.rsdefaultcolorcaption msgid "Default" -msgstr "" +msgstr "За замовчуванням" #: lclstrconsts.rsdefaultfileinfovalue msgid "permissions user group size date time" -msgstr "дозволи користувача група дата час" +msgstr "дозволи користувач група розмір дата час" #: lclstrconsts.rsdeleterecord msgid "Delete record?" -msgstr "" +msgstr "Видалити запис?" #: lclstrconsts.rsdeleterecordhint msgctxt "lclstrconsts.rsdeleterecordhint" @@ -388,32 +391,32 @@ msgstr "Видалити" #: lclstrconsts.rsdirection msgid "Direction" -msgstr "" +msgstr "Напрямок" #: lclstrconsts.rsdirectory msgid "&Directory" -msgstr "" +msgstr "&Каталог" #: lclstrconsts.rsdocking msgid "Docking" -msgstr "" +msgstr "Стикування" #: lclstrconsts.rsduplicateiconformat msgid "Duplicate icon format." -msgstr "" +msgstr "Дублювати формат іконок." #: lclstrconsts.rseditrecordhint msgid "Edit" -msgstr "" +msgstr "Редагувати" #: lclstrconsts.rsentirescope msgid "Search entire file" -msgstr "" +msgstr "Шукати по усьому файлу" #: lclstrconsts.rserror msgctxt "lclstrconsts.rserror" msgid "Error" -msgstr "" +msgstr "Помилка" #: lclstrconsts.rserrorcreatingdevicecontext msgid "Error creating device context for %s.%s" @@ -433,15 +436,15 @@ msgstr "Помилка читання %s%s%s: %s" #: lclstrconsts.rserrorwhilesavingbitmap msgid "Error while saving bitmap." -msgstr "" +msgstr "Помилка збереження растрового зображення." #: lclstrconsts.rsexception msgid "Exception" -msgstr "Виняткова ситуація" +msgstr "Виняток" #: lclstrconsts.rsfddirectorymustexist msgid "Directory must exist" -msgstr "Має існувати тека" +msgstr "Тека повинна існувати" #: lclstrconsts.rsfddirectorynotexist msgid "The directory \"%s\" does not exist." @@ -457,11 +460,11 @@ msgstr "Файл має існувати" #: lclstrconsts.rsfdfilenotexist msgid "The file \"%s\" does not exist." -msgstr "Файл \"%s\" не існує" +msgstr "Файл \"%s\" не існує." #: lclstrconsts.rsfdfilereadonly msgid "The file \"%s\" is not writable." -msgstr "Файл \"%s\" не для запису." +msgstr "Файл \"%s\" не може бути записаний." #: lclstrconsts.rsfdfilereadonlytitle msgid "File is not writable" @@ -477,7 +480,7 @@ msgstr "Відкрити існуючий файл" #: lclstrconsts.rsfdoverwritefile msgid "Overwrite file ?" -msgstr "Переписати файл ?" +msgstr "Перезаписати файл ?" #: lclstrconsts.rsfdpathmustexist msgid "Path must exist" @@ -489,7 +492,7 @@ msgstr "Шлях \"%s\" не існує." #: lclstrconsts.rsfdselectdirectory msgid "Select Directory" -msgstr "Виберіть теку" +msgstr "Виберіть каталог" #: lclstrconsts.rsfileinfofilenotfound msgid "(file not found: \"%s\")" @@ -501,43 +504,43 @@ msgstr "Інформація про файл" #: lclstrconsts.rsfind msgid "Find" -msgstr "" +msgstr "Знайти" #: lclstrconsts.rsfindmore msgid "Find more" -msgstr "" +msgstr "Знайти ще" #: lclstrconsts.rsfirstrecordhint msgid "First" -msgstr "" +msgstr "Перший" #: lclstrconsts.rsfixedcolstoobig msgid "FixedCols can't be >= ColCount" -msgstr "FixedCols не може бути >= ColCount" +msgstr "FixedCols не може бути >= ColCount" #: lclstrconsts.rsfixedrowstoobig msgid "FixedRows can't be >= RowCount" -msgstr "FixedRows не може бути >= RowCount" +msgstr "FixedRows не може бути >= RowCount" #: lclstrconsts.rsformcolorcaption msgid "Form" -msgstr "" +msgstr "Форма" #: lclstrconsts.rsformresourcesnotfoundforresourcelessformscreatenew msgid "Form resource %s not found. For resourceless forms CreateNew constructor must be used. See the global variable RequireDerivedFormResource." -msgstr "" +msgstr "Ресурс форми %s не знайдено. Для форм без ресурсів повинен бути використаний конструктор CreateNew. Дивіться глобальну змінну RequireDerivedFormResource." #: lclstrconsts.rsformstreamingerror msgid "Form streaming \"%s\" error: %s" -msgstr "Помилка потоків \"%s\" форм: %s" +msgstr "Помилка потоків форм \"%s\": %s" #: lclstrconsts.rsforward msgid "Forward" -msgstr "" +msgstr "Вперед" #: lclstrconsts.rsfuchsiacolorcaption msgid "Fuchsia" -msgstr "" +msgstr "Фуксія" #: lclstrconsts.rsgdkoptiondebug msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." @@ -549,7 +552,7 @@ msgstr "--gdk-no-debug flags Вимкнути вказані налагоджу #: lclstrconsts.rsgif msgid "Graphics Interchange Format" -msgstr "" +msgstr "Формат обміну графічними даними" #: lclstrconsts.rsgoptionfatalwarnings msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." @@ -557,27 +560,27 @@ msgstr "--g-fatal-warnings Попередження і помилки про #: lclstrconsts.rsgradientactivecaptioncolorcaption msgid "Gradient Active Caption" -msgstr "" +msgstr "Заголовок активного градієнта" #: lclstrconsts.rsgradientinactivecaptioncolorcaption msgid "Gradient Inactive Caption" -msgstr "" +msgstr "Заголовок неактивного градієнта" #: lclstrconsts.rsgraphic msgid "Graphic" -msgstr "" +msgstr "Графічний" #: lclstrconsts.rsgraycolorcaption msgid "Gray" -msgstr "" +msgstr "Сірий" #: lclstrconsts.rsgraytextcolorcaption msgid "Gray Text" -msgstr "" +msgstr "Сірий текст" #: lclstrconsts.rsgreencolorcaption msgid "Green" -msgstr "" +msgstr "Пастельно-зелений" #: lclstrconsts.rsgridfiledoesnotexists msgid "Grid file doesn't exists" @@ -585,19 +588,19 @@ msgstr "Файла сітки не існує" #: lclstrconsts.rsgridindexoutofrange msgid "Grid index out of range." -msgstr "" +msgstr "Індекс сітки поза межею допустимих значень." #: lclstrconsts.rsgroupindexcannotbelessthanprevious msgid "GroupIndex cannot be less than a previous menu item's GroupIndex" -msgstr "GroupIndex не може бути менше GroupIndex для попереднього елемента меню" +msgstr "GroupIndex не може бути менше GroupIndex для попереднього елемента меню" #: lclstrconsts.rsgtkfilter msgid "Filter:" -msgstr "Фільтр" +msgstr "Фільтр:" #: lclstrconsts.rsgtkhistory msgid "History:" -msgstr "Історія" +msgstr "Історія:" #: lclstrconsts.rsgtkoptionclass msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." @@ -609,7 +612,7 @@ msgstr "--gtk-debug flags Ввімкнути вказані налагодж #: lclstrconsts.rsgtkoptiondisplay msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." -msgstr "--display h:s:d Зв'язатись із вказаним сервером іксів, де \"h\" - назва хоста, \"s\" - номер сервера (звичайно 0) і \"d\" - номер дисплея (звичайно нехтують). Якщо --display не вказаний, використовується змінна оточення DISPLAY." +msgstr "--display h:s:d Зв'язатись із вказаним X-сервером, де \"h\" - назва хоста, \"s\" - номер сервера (звичайно 0) і \"d\" - номер дисплея (звичайно нехтують). Якщо --display не вказаний, використовується змінна оточення DISPLAY." #: lclstrconsts.rsgtkoptionmodule msgid "--gtk-module module Load the specified module at startup." @@ -617,7 +620,7 @@ msgstr "--gtk-module модуль Завантажити вказаний мо #: lclstrconsts.rsgtkoptionname msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStrUTF8(0)." -msgstr "" +msgstr "--name ім'япрог Встановити ім'я програми в \"progname\". Якщо не вказано, ім'я програми буде встановлено в ParamStrUTF8(0)." #: lclstrconsts.rsgtkoptionnodebug msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." @@ -629,105 +632,111 @@ msgstr "--lcl-no-transient Не встановлювати тимчасови #: lclstrconsts.rsgtkoptionnoxshm msgid "--no-xshm Disable use of the X Shared Memory Extension." -msgstr "--no-xshm Заборонити використання розширень Х-пам'яті, що розділяється." +msgstr "--no-xshm Заборонити використання спільних розширень Х-пам'яті." #: lclstrconsts.rsgtkoptionsync -#, fuzzy -#| msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediately after the protocol request that generated the error has been processed by the X server." -msgstr "--sync Виклик XSynchronize (display, True) після встановлення з'єднання з Xserver'ом. Це полегшує налагодження помилок протокола X через те, що запити буферування X будуть вимкнені і помилки X будуть одержані одразу після запиту протоколу, який викликав цю помилку, яка була оброблена сервером X." +msgstr "--sync Виклик XSynchronize (display, True) після встановлення з'єднання з X-сервером. Це полегшує налагодження помилок протоколу X через те, що запити буферування X будуть вимкнені і помилки X будуть одержані одразу після запиту протоколу, який викликав цю помилку, яка була оброблена X-сервером." #: lclstrconsts.rshelpalreadyregistered msgid "%s: Already registered" -msgstr "" +msgstr "%s: Вже зареєстрований" #: lclstrconsts.rshelpcontextnotfound +#, fuzzy +#| msgid "Help Context not found" msgid "A help database was found for this topic, but this topic was not found" -msgstr "" +msgstr "Контекст довідки не знайдено" #: lclstrconsts.rshelpdatabasenotfound +#, fuzzy +#| msgid "Help Database not found" msgid "There is no help database installed for this topic" -msgstr "" +msgstr "База даних довідки не знайдена" #: lclstrconsts.rshelperror msgid "Help Error" -msgstr "" +msgstr "Помилка довідки" #: lclstrconsts.rshelphelpcontextnotfound msgid "Help context %s not found." -msgstr "" +msgstr "Контекст довідки %s не знайдено" #: lclstrconsts.rshelphelpcontextnotfoundindatabase msgid "Help context %s not found in Database %s%s%s." -msgstr "" +msgstr "Контекст довідки %s не знайдено в базі %s%s%s." #: lclstrconsts.rshelphelpdatabasedidnotfoundaviewerforahelppageoftype msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" -msgstr "" +msgstr "База даних довідки %s%s%s не знайшла програму перегляду для сторінки довідки типу %s" #: lclstrconsts.rshelphelpdatabasenotfound msgid "Help Database %s%s%s not found" -msgstr "" +msgstr "Базу даних довідки %s%s%s не знайдено" #: lclstrconsts.rshelphelpkeywordnotfound msgid "Help keyword %s%s%s not found." -msgstr "" +msgstr "Ключове слово довідки %s%s%s не знайдено." #: lclstrconsts.rshelphelpkeywordnotfoundindatabase msgid "Help keyword %s%s%s not found in Database %s%s%s." -msgstr "" +msgstr "Ключове слово довідки %s%s%s не знайдено в базі даних %s%s%s." #: lclstrconsts.rshelphelpnodehasnohelpdatabase msgid "Help node %s%s%s has no Help Database" -msgstr "" +msgstr "Вузол довідки %s%s%s не має відповідної бази даних" #: lclstrconsts.rshelpnohelpfoundforsource msgid "No help found for line %d, column %d of %s." -msgstr "" +msgstr "Не знайдено довідки для рядка %d, колонки %d з %s." #: lclstrconsts.rshelpnohelpnodesavailable msgid "No help entries available for this topic" -msgstr "" +msgstr "Відсутні записи довідки на цю тему" #: lclstrconsts.rshelpnotfound +#, fuzzy +#| msgid "Help not found" msgid "No help found for this topic" -msgstr "" +msgstr "Довідку не знайдено" #: lclstrconsts.rshelpnotregistered msgid "%s: Not registered" -msgstr "" +msgstr "%s: Не зареєстрований" #: lclstrconsts.rshelpselectorerror msgid "Help Selector Error" -msgstr "" +msgstr "Помилка відбірника довідки" #: lclstrconsts.rshelpthereisnoviewerforhelptype msgid "There is no viewer for help type %s%s%s" -msgstr "" +msgstr "Відсутня програма для перегляду такого типу довідки %s%s%s" #: lclstrconsts.rshelpviewererror msgid "Help Viewer Error" -msgstr "" +msgstr "Помилка переглядача довідки" #: lclstrconsts.rshelpviewernotfound msgid "No viewer was found for this type of help content" -msgstr "" +msgstr "Для цього типу довідки не знайдено переглядача" #: lclstrconsts.rshighlightcolorcaption msgid "Highlight" -msgstr "" +msgstr "Підсвічений" #: lclstrconsts.rshighlighttextcolorcaption msgid "Highlight Text" -msgstr "" +msgstr "Підсвічений текст" #: lclstrconsts.rshotlightcolorcaption msgid "Hot Light" -msgstr "" +msgstr "Гаряче світло" #: lclstrconsts.rsicns +#, fuzzy +#| msgid "OSX Icon Resource" msgid "Mac OS X Icon" -msgstr "" +msgstr "Ресурс значків OSX" #: lclstrconsts.rsicon msgid "Icon" @@ -735,41 +744,41 @@ msgstr "Іконка" #: lclstrconsts.rsiconimageempty msgid "Icon image cannot be empty" -msgstr "" +msgstr "Зображення іконки не може бути порожнім" #: lclstrconsts.rsiconimageformat msgid "Icon image must have the same format" -msgstr "" +msgstr "Зображення іконки має бути того самого формату" #: lclstrconsts.rsiconimageformatchange msgid "Cannot change format of icon image" -msgstr "" +msgstr "Не вдалося змінити формат зображення іконки" #: lclstrconsts.rsiconimagesize msgid "Icon image must have the same size" -msgstr "" +msgstr "Зображення іконки має бути того самого розміру" #: lclstrconsts.rsiconimagesizechange msgid "Cannot change size of icon image" -msgstr "" +msgstr "Не вдалося змінити розмір іконки" #: lclstrconsts.rsiconnocurrent msgid "Icon has no current image" -msgstr "" +msgstr "Іконка не має поточного зображення" #: lclstrconsts.rsinactivebordercolorcaption msgid "Inactive Border" -msgstr "" +msgstr "Межа неактивного вікна" #: lclstrconsts.rsinactivecaptioncolorcaption msgctxt "lclstrconsts.rsinactivecaptioncolorcaption" msgid "Inactive Caption" -msgstr "" +msgstr "Заголовок неактивного вікна" #: lclstrconsts.rsinactivecaptiontext msgctxt "lclstrconsts.rsinactivecaptiontext" msgid "Inactive Caption" -msgstr "" +msgstr "Заголовок неактивного вікна" #: lclstrconsts.rsindexoutofbounds msgid "%s Index %d out of bounds 0 .. %d" @@ -781,11 +790,11 @@ msgstr "Індекс поза діапазоном Cell[Col=%d Row=%d]" #: lclstrconsts.rsinfobkcolorcaption msgid "Info Background" -msgstr "" +msgstr "Фон повідомлення" #: lclstrconsts.rsinfotextcolorcaption msgid "Info Text" -msgstr "" +msgstr "Текст повідомлення" #: lclstrconsts.rsinsertrecordhint msgctxt "lclstrconsts.rsinsertrecordhint" @@ -818,15 +827,15 @@ msgstr "%s вже зіставлено з %s" #: lclstrconsts.rsjpeg msgid "Joint Picture Expert Group" -msgstr "" +msgstr "Joint Picture Expert Group" #: lclstrconsts.rslastrecordhint msgid "Last" -msgstr "" +msgstr "Остання" #: lclstrconsts.rslimecolorcaption msgid "Lime" -msgstr "" +msgstr "Зелений" #: lclstrconsts.rslistindexexceedsbounds msgid "List index exceeds bounds (%d)" @@ -838,11 +847,11 @@ msgstr "Список має бути порожнім" #: lclstrconsts.rsmarooncolorcaption msgid "Maroon" -msgstr "" +msgstr "Коричнево-малиновий" #: lclstrconsts.rsmbabort msgid "Abort" -msgstr "Скидання" +msgstr "Перервати" #: lclstrconsts.rsmball msgid "&All" @@ -879,7 +888,7 @@ msgstr "&ОК" #: lclstrconsts.rsmbopen msgid "&Open" -msgstr "" +msgstr "&Відкрити" #: lclstrconsts.rsmbretry msgid "&Retry" @@ -887,11 +896,11 @@ msgstr "&Повтор" #: lclstrconsts.rsmbsave msgid "&Save" -msgstr "" +msgstr "&Зберегти" #: lclstrconsts.rsmbunlock msgid "&Unlock" -msgstr "" +msgstr "&Розблокувати" #: lclstrconsts.rsmbyes msgid "&Yes" @@ -899,15 +908,15 @@ msgstr "&Так" #: lclstrconsts.rsmbyestoall msgid "Yes to &All" -msgstr "" +msgstr "Так для &Всіх" #: lclstrconsts.rsmedgraycolorcaption msgid "Medium Gray" -msgstr "" +msgstr "Світло-сірий" #: lclstrconsts.rsmenubarcolorcaption msgid "Menu Bar" -msgstr "" +msgstr "Панель меню" #: lclstrconsts.rsmenucolorcaption msgctxt "lclstrconsts.rsmenucolorcaption" @@ -916,23 +925,23 @@ msgstr "Меню" #: lclstrconsts.rsmenuhighlightcolorcaption msgid "Menu Highlight" -msgstr "" +msgstr "Підсічене меню" #: lclstrconsts.rsmenutextcolorcaption msgid "Menu Text" -msgstr "" +msgstr "Текст меню" #: lclstrconsts.rsmodified msgid " modified " -msgstr "змінений" +msgstr " змінений " #: lclstrconsts.rsmoneygreencolorcaption msgid "Money Green" -msgstr "" +msgstr "Сиваво-зелений" #: lclstrconsts.rsmtauthentication msgid "Authentication" -msgstr "" +msgstr "Ідентифікація" #: lclstrconsts.rsmtconfirmation msgid "Confirmation" @@ -957,7 +966,7 @@ msgstr "Попередження" #: lclstrconsts.rsnavycolorcaption msgid "Navy" -msgstr "" +msgstr "Темно-синій" #: lclstrconsts.rsnextrecordhint msgctxt "lclstrconsts.rsnextrecordhint" @@ -966,7 +975,7 @@ msgstr "Наступний" #: lclstrconsts.rsnonecolorcaption msgid "None" -msgstr "" +msgstr "Жоден" #: lclstrconsts.rsnotavalidgridfile msgid "Not a valid grid file" @@ -978,7 +987,7 @@ msgstr "Об'єкт не є widgetset. Перевірте, чи був дода #: lclstrconsts.rsolivecolorcaption msgid "Olive" -msgstr "" +msgstr "Оливковий" #: lclstrconsts.rspickdate msgid "Select a date" @@ -986,31 +995,31 @@ msgstr "Виберіть дату" #: lclstrconsts.rspixmap msgid "Pixmap" -msgstr "Pixmap" +msgstr "Растрове зображення" #: lclstrconsts.rsportablebitmap msgid "Portable BitMap" -msgstr "" +msgstr "Чорно-біле зображення (PBM)" #: lclstrconsts.rsportablegraymap msgid "Portable GrayMap" -msgstr "" +msgstr "Напівтонове зображення (PGM)" #: lclstrconsts.rsportablenetworkgraphic msgid "Portable Network Graphic" -msgstr "Портативна мережева графіка PNG" +msgstr "Переносна мережева графіка (PNG)" #: lclstrconsts.rsportablepixmap msgid "Portable PixMap" -msgstr "" +msgstr "Кольорове зображення (PPM)" #: lclstrconsts.rspostrecordhint msgid "Post" -msgstr "" +msgstr "Відправити" #: lclstrconsts.rspressoktoignoreandriskdatacorruptionpresscanceltok msgid "%s%sPress OK to ignore and risk data corruption.%sPress Cancel to kill the program." -msgstr "" +msgstr "%s%sНатисніть 'OK' щоб проігнорувати і ризикнути втратити дані.%sНатисніть 'Скасувати' для закриття програми." #: lclstrconsts.rspriorrecordhint msgctxt "lclstrconsts.rspriorrecordhint" @@ -1023,140 +1032,140 @@ msgstr "Властивості %s не існує" #: lclstrconsts.rspurplecolorcaption msgid "Purple" -msgstr "" +msgstr "Пурпуровий" #: lclstrconsts.rsqtoptiondograb msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG." -msgstr "" +msgstr "-dograb (лише під X11), запуск під налаголжувачем може спричинити неявний -nograb, використайте -dograb щоб перевизначити. Потрібен QT_DEBUG." #: lclstrconsts.rsqtoptiongraphicsstyle msgid "-graphicssystem param, sets the backend to be used for on-screen widgets and QPixmaps. Available options are native, raster and opengl. OpenGL is still unstable." -msgstr "" +msgstr "-graphicssystem param, задає бекенд, який буде використовуватись для екранних віджетів та QPixmaps. Доступні опції: native, raster та opengl. OpenGL все ще нестабільний." #: lclstrconsts.rsqtoptionnograb msgid "-nograb, tells Qt that it must never grab the mouse or the keyboard. Need QT_DEBUG." -msgstr "" +msgstr "-nograb, вказує Qt щоб він ніколи не захоплював мишку чи клавіатуру. Потрібен QT_DEBUG." #: lclstrconsts.rsqtoptionreverse msgid "-reverse, sets the application's layout direction to Qt::RightToLeft." -msgstr "" +msgstr "-reverse, виставляє напрямок макету програми на Qt::RightToLeft." #: lclstrconsts.rsqtoptionsession msgid "-session session, restores the application from an earlier session." -msgstr "" +msgstr "-session session, відновлює програму з попереднього сеансу." #: lclstrconsts.rsqtoptionstyle msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)." -msgstr "" +msgstr "-style style або -style=style, задає стиль GUI програми. Можливі значення: motif, windows, та platinum. Якщо ви зібрали Qt з додатковими стилями ябо маєте додаткові стилі як плагіни вони будуть доступні для опцій командного рядка -style. ПРИМІТКА: Не всі стилі доступні на всіх платформах. Якщо параметр style не існує Qt запустить програму з типовим стилем (windows)." #: lclstrconsts.rsqtoptionstylesheet msgid "-stylesheet stylesheet or -stylesheet=stylesheet, sets the application Style Sheet. The value must be a path to a file that contains the Style Sheet. Note: Relative URLs in the Style Sheet file are relative to the Style Sheet file's path." -msgstr "" +msgstr "-stylesheet stylesheet або -stylesheet=stylesheet, задає програмі Список Стилів. Значення повинне бути шляхом до файлу що містить Список Стилів. Note: Відносні URLs в файлі Списку Стилів сприймаються відносно шляху до файлу Списку Стилів." #: lclstrconsts.rsqtoptionsync msgid "-sync (only under X11), switches to synchronous mode for debugging." -msgstr "" +msgstr "-sync (лише під X11), перемикає в снхронний режим налагодження." #: lclstrconsts.rsqtoptionwidgetcount msgid "-widgetcount, prints debug message at the end about number of widgets left undestroyed and maximum number of widgets existed at the same time." -msgstr "" +msgstr "-widgetcount, друкує налагоджувальне повідомлення в кінці про кількість незнищених віджетів та максимальну кількість віджетів, що існували в той же час." #: lclstrconsts.rsqtoptionx11bgcolor msgid "-bg or -background color, sets the default background color and an application palette (light and dark shades are calculated)." -msgstr "" +msgstr "-bg or -background color, задає типовий колір фону та палітру програми (обчислюються світлі на темні відтінки)." #: lclstrconsts.rsqtoptionx11btncolor msgid "-btn or -button color, sets the default button color." -msgstr "" +msgstr "-btn або -button color, задає типовий колір кнопок." #: lclstrconsts.rsqtoptionx11cmap msgid "-cmap, causes the application to install a private color map on an 8-bit display." -msgstr "" +msgstr "-cmap, змушує програму встановити карту приватних кольорів на 8-бітний дисплей." #: lclstrconsts.rsqtoptionx11display msgid "-display display, sets the X display (default is $DISPLAY)." -msgstr "" +msgstr "-display display, задає дисплей Іксів (типовим є $DISPLAY)." #: lclstrconsts.rsqtoptionx11fgcolor msgid "-fg or -foreground color, sets the default foreground color." -msgstr "" +msgstr "-fg або -foreground color, задає типовий колір переднього плану." #: lclstrconsts.rsqtoptionx11font msgid "-fn or -font font, defines the application font. The font should be specified using an X logical font description." -msgstr "" +msgstr "-fn або -font font, визначає шрифт для програми. Шрифт повинен бути вказаний використовуючи X-логічний опис шрифту." #: lclstrconsts.rsqtoptionx11geometry msgid "-geometry geometry, sets the client geometry of the first window that is shown." -msgstr "" +msgstr "-geometry geometry, задає клієнтську геометрію першого показаного вікна." #: lclstrconsts.rsqtoptionx11im msgid "-im, sets the input method server (equivalent to setting the XMODIFIERS environment variable)." -msgstr "" +msgstr "-im, задає сервер методу вводу (аналогічно до задання змінної оточення XMODIFIERS)." #: lclstrconsts.rsqtoptionx11inputstyle msgid "-inputstyle, defines how the input is inserted into the given widget, e.g. onTheSpot makes the input appear directly in the widget, while overTheSpot makes the input appear in a box floating over the widget and is not inserted until the editing is done." -msgstr "" +msgstr "-inputstyle, визначає як ввід вставляється в заданий віджет, наприклад onTheSpot вносить ввід прямо в віджет, тоді як overTheSpot робить так, що ввід з'являється в вікні, що плаває над віджетом і не вставляється поки редагування не завершено." #: lclstrconsts.rsqtoptionx11name msgid "-name name, sets the application name." -msgstr "" +msgstr "-name name, задає назву програми." #: lclstrconsts.rsqtoptionx11ncols msgid "-ncols count, limits the number of colors allocated in the color cube on an 8-bit display, if the application is using the QApplication::ManyColor color specification. If count is 216 then a 6x6x6 color cube is used (i.e. 6 levels of red, 6 of green, and 6 of blue); for other values, a cube approximately proportional to a 2x3x1 cube is used." -msgstr "" +msgstr "-ncols count, обмежує кількість кольорів, розміщних в кольоровому кубі на 8-бітному дисплеї, якщо програма використовує специфікацію кольору QApplication::ManyColor. Якщо кількість рівна 216 тоді використовується кольоровий куб 6x6x6 (тобто 6 рівнів червоного, 6 зеленого, та 6 синього); для інших значень використовується куб приблизно пропорційний до 2x3x1." #: lclstrconsts.rsqtoptionx11title msgid "-title title, sets the application title." -msgstr "" +msgstr "-title title, задає заголовок програми." #: lclstrconsts.rsqtoptionx11visual msgid "-visual TrueColor, forces the application to use a TrueColor visual on an 8-bit display." -msgstr "" +msgstr "-visual TrueColor, змушує програму використовувати TrueColor visual на 8-бітному дисплеї." #: lclstrconsts.rsrasterimageendupdate msgid "Endupdate while no update in progress" -msgstr "" +msgstr "Команда Endupdate, хоча ніякого оновлення не проводиться" #: lclstrconsts.rsrasterimagesaveinupdate msgid "Cannot save image while update in progress" -msgstr "" +msgstr "Неможливо зберегти зображення під час оновлення" #: lclstrconsts.rsrasterimageupdateall msgid "Cannot begin update all when canvas only update in progress" -msgstr "" +msgstr "Неможливо почати оновлення під час оновлення полотна" #: lclstrconsts.rsredcolorcaption msgid "Red" -msgstr "" +msgstr "Червоний" #: lclstrconsts.rsrefreshrecordshint msgid "Refresh" -msgstr "" +msgstr "Оновити" #: lclstrconsts.rsreplace msgid "Replace" -msgstr "" +msgstr "Замінити" #: lclstrconsts.rsreplaceall msgid "Replace all" -msgstr "" +msgstr "Замінити все" #: lclstrconsts.rsresourcenotfound msgctxt "lclstrconsts.rsresourcenotfound" msgid "Resource %s not found" -msgstr "Ресурсу %s не знайдено" +msgstr "Ресурс %s не знайдено" #: lclstrconsts.rsscrollbarcolorcaption msgid "ScrollBar" -msgstr "" +msgstr "Смуга прокрутки" #: lclstrconsts.rsscrollbaroutofrange msgid "ScrollBar property out of range" -msgstr "Властивість ScrollBar поза діапазоном" +msgstr "Властивості смуги прокручування виходять поза діапазон" #: lclstrconsts.rsselectcolortitle msgid "Select color" -msgstr "Вибати колір" +msgstr "Вибрати колір" #: lclstrconsts.rsselectfonttitle msgid "Select a font" @@ -1164,27 +1173,27 @@ msgstr "Вибрати шрифт" #: lclstrconsts.rssilvercolorcaption msgid "Silver" -msgstr "" +msgstr "Срібний" #: lclstrconsts.rssize msgid " size " -msgstr "розмір" +msgstr " розмір " #: lclstrconsts.rsskybluecolorcaption msgid "Sky Blue" -msgstr "" +msgstr "Небесно-синій" #: lclstrconsts.rstealcolorcaption msgid "Teal" -msgstr "" +msgstr "Синьо-зелений" #: lclstrconsts.rstext msgid "Text" -msgstr "" +msgstr "Текст" #: lclstrconsts.rstiff msgid "Tagged Image File Format" -msgstr "" +msgstr "Тегований формат файлу зображення" #: lclstrconsts.rsunabletoloaddefaultfont msgid "Unable to load default font" @@ -1192,7 +1201,7 @@ msgstr "Не можу завантажити шрифт за замовчува #: lclstrconsts.rsunknownerrorpleasereportthisbug msgid "Unknown Error, please report this bug" -msgstr "" +msgstr "Невідома помилка, повідомте розробників" #: lclstrconsts.rsunknownpictureextension msgid "Unknown picture extension" @@ -1200,15 +1209,15 @@ msgstr "Невідоме розширення файлу зображення" #: lclstrconsts.rsunknownpictureformat msgid "Unknown picture format" -msgstr "" +msgstr "Невідомий формат зображення" #: lclstrconsts.rsunsupportedbitmapformat msgid "Unsupported bitmap format." -msgstr "Не підтримуваний тип точкового малюнка." +msgstr "Непідтримуваний тип растрового малюнку." #: lclstrconsts.rsunsupportedclipboardformat msgid "Unsupported clipboard format: %s" -msgstr "Формат не підтримує буфер обміну: %s" +msgstr "Непідтримуваний формат буферу обміну: %s" #: lclstrconsts.rswarningunreleaseddcsdump msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" @@ -1232,11 +1241,11 @@ msgstr " УВАГА: Знайдено %s не видалених LM_PAINT/LM_Gtk #: lclstrconsts.rswhitecolorcaption msgid "White" -msgstr "" +msgstr "Білий" #: lclstrconsts.rswholewordsonly msgid "Whole words only" -msgstr "" +msgstr "Тільки цілі слова" #: lclstrconsts.rswin32error msgid "Error:" @@ -1248,19 +1257,19 @@ msgstr "Попередження:" #: lclstrconsts.rswindowcolorcaption msgid "Window" -msgstr "" +msgstr "Вікно" #: lclstrconsts.rswindowframecolorcaption msgid "Window Frame" -msgstr "" +msgstr "Межі вікна" #: lclstrconsts.rswindowtextcolorcaption msgid "Window Text" -msgstr "" +msgstr "Текст вікна" #: lclstrconsts.rsyellowcolorcaption msgid "Yellow" -msgstr "" +msgstr "Жовтий" #: lclstrconsts.scannotfocus msgid "Cannot focus a disabled or invisible window" @@ -1268,7 +1277,7 @@ msgstr "Не можна дати фокус вимкненому або неви #: lclstrconsts.sduplicatemenus msgid "Duplicate menus" -msgstr "Повторювані меню" +msgstr "Дублювати меню" #: lclstrconsts.sinvalidactioncreation msgid "Invalid action creation" @@ -1284,19 +1293,19 @@ msgstr "Неправильна реєстрація дії" #: lclstrconsts.sinvalidactionunregistration msgid "Invalid action unregistration" -msgstr "Неправильна дія зняття реєстрації" +msgstr "Скасування реєстрації невірної дії" #: lclstrconsts.sinvalidcharset msgid "The char set in mask \"%s\" is not valid!" -msgstr "" +msgstr "Невірний набір символів по масці \"%s\"!" #: lclstrconsts.sinvalidimagesize msgid "Invalid image size" -msgstr "Неправильний розмір малюнка" +msgstr "Невірний розмір зображення" #: lclstrconsts.sinvalidindex msgid "Invalid ImageList Index" -msgstr "Неправильний індекс ImageList" +msgstr "Невірний індекс ImageList" #: lclstrconsts.smenuindexerror msgid "Menu index out of range" @@ -1312,19 +1321,19 @@ msgstr "Підменю не в меню" #: lclstrconsts.smkcalt msgid "Alt+" -msgstr "" +msgstr "Alt+" #: lclstrconsts.smkcbksp msgid "BkSp" -msgstr "" +msgstr "BkSp" #: lclstrconsts.smkcctrl msgid "Ctrl+" -msgstr "" +msgstr "Ctrl+" #: lclstrconsts.smkcdel msgid "Del" -msgstr "" +msgstr "Del" #: lclstrconsts.smkcdown msgctxt "lclstrconsts.smkcdown" @@ -1334,24 +1343,24 @@ msgstr "Вниз" #: lclstrconsts.smkcend msgctxt "lclstrconsts.smkcend" msgid "End" -msgstr "Кінець" +msgstr "End" #: lclstrconsts.smkcenter msgid "Enter" -msgstr "" +msgstr "Enter" #: lclstrconsts.smkcesc msgid "Esc" -msgstr "" +msgstr "Esc" #: lclstrconsts.smkchome msgctxt "lclstrconsts.smkchome" msgid "Home" -msgstr "" +msgstr "Home" #: lclstrconsts.smkcins msgid "Ins" -msgstr "" +msgstr "Ins" #: lclstrconsts.smkcleft msgctxt "lclstrconsts.smkcleft" @@ -1360,76 +1369,76 @@ msgstr "Вліво" #: lclstrconsts.smkcmeta msgid "Meta+" -msgstr "" +msgstr "Meta+" #: lclstrconsts.smkcpgdn msgid "PgDn" -msgstr "" +msgstr "PgDn" #: lclstrconsts.smkcpgup msgid "PgUp" -msgstr "" +msgstr "PgUp" #: lclstrconsts.smkcright msgctxt "lclstrconsts.smkcright" msgid "Right" -msgstr "" +msgstr "Вправо" #: lclstrconsts.smkcshift msgid "Shift+" -msgstr "" +msgstr "Shift+" #: lclstrconsts.smkcspace msgid "Space" -msgstr "" +msgstr "Пробіл" #: lclstrconsts.smkctab msgctxt "lclstrconsts.smkctab" msgid "Tab" -msgstr "" +msgstr "Tab" #: lclstrconsts.smkcup msgctxt "lclstrconsts.smkcup" msgid "Up" -msgstr "Вверх" +msgstr "Вгору" #: lclstrconsts.snomdiform msgid "No MDI form present." -msgstr "Немає MDI форми" +msgstr "Немає MDI форми." #: lclstrconsts.snotimers msgid "No timers available" -msgstr "Таймери є недоступними" +msgstr "Немає доступних таймерів" #: lclstrconsts.sparexpected msgid "Wrong token type: %s expected" -msgstr "" +msgstr "Невірний тип маркера: очікується %s" #: lclstrconsts.sparinvalidfloat msgid "Invalid floating point number: %s" -msgstr "" +msgstr "Невірне число з плаваючою крапкою: %s" #: lclstrconsts.sparinvalidinteger msgid "Invalid integer number: %s" -msgstr "" +msgstr "Невірне ціле число: %s" #: lclstrconsts.sparlocinfo msgid " (at %d,%d, stream offset %.8x)" -msgstr "" +msgstr " (на %d,%d, зміщення потоку %.8x)" #: lclstrconsts.sparunterminatedbinvalue msgid "Unterminated byte value" -msgstr "" +msgstr "Значення байта незавершене" #: lclstrconsts.sparunterminatedstring msgid "Unterminated string" -msgstr "" +msgstr "Незавершений рядок" #: lclstrconsts.sparwrongtokensymbol msgid "Wrong token symbol: %s expected but %s found" -msgstr "" +msgstr "Невірний символ маркера: очікувався %s, але знайдений %s" #: lclstrconsts.sparwrongtokentype msgid "Wrong token type: %s expected but %s found" -msgstr "" +msgstr "Невірний тип маркера: очікувався %s, але знайдений %s" diff --git a/tools/jsonviewer/languages/jsonviewer.uk.po b/tools/jsonviewer/languages/jsonviewer.uk.po new file mode 100644 index 0000000000..8a3f3cab69 --- /dev/null +++ b/tools/jsonviewer/languages/jsonviewer.uk.po @@ -0,0 +1,309 @@ +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Transfer-Encoding: 8bit\n" + +#: msgjsonviewer.sarray +msgid "Array (%d elements)" +msgstr "Масив (%d елементів)" + +#: msgjsonviewer.scancelclose +msgid "Do not close the window" +msgstr "Не закривати вікно" + +#: msgjsonviewer.scancelpaste +msgid "Do not paste the new data" +msgstr "Не вставляти нові дані" + +#: msgjsonviewer.scaption +msgctxt "msgjsonviewer.scaption" +msgid "JSON Viewer" +msgstr "Переглядач JSON" + +#: msgjsonviewer.sdiscard +msgid "Discard changes" +msgstr "Відхилити зміни" + +#: msgjsonviewer.sdocumentmodified +msgid "JSON document modified" +msgstr "Документ JSON був змінений" + +#: msgjsonviewer.sdocumentmodifiedaction +msgid "" +"The JSON data was changed but not saved.\n" +"What do want to do ?\n" +msgstr "" +"Дані JSON були змінені, але не збережені.\n" +"Що треба зробити ?\n" + +#: msgjsonviewer.sduplicatemembername +msgid "Duplicate member name \"%s\"." +msgstr "" + +#: msgjsonviewer.selement +msgid "Element nr. %d" +msgstr "Елемент номер %d" + +#: msgjsonviewer.sempty +msgid "Empty document" +msgstr "Порожній документ" + +#: msgjsonviewer.serrcreatingconfigdir +msgid "Could not create the configuration files directory \"s\"" +msgstr "" + +#: msgjsonviewer.serrinvalidvalue +msgid "Invalid value or wrong type: \"%s\"" +msgstr "" + +#: msgjsonviewer.serrnovalidjsonclipboard +msgid "The clipboard does not contain valid JSON data" +msgstr "" + +#: msgjsonviewer.snewmember +msgid "New object member" +msgstr "Новий член об'єкту" + +#: msgjsonviewer.snewmembername +msgid "Enter a name for the new member (type: %s)" +msgstr "" + +#: msgjsonviewer.snomorematches +msgid "No nodes match the criterium" +msgstr "" + +#: msgjsonviewer.snull +msgid "null" +msgstr "порожньо" + +#: msgjsonviewer.sobject +msgid "Object (%d members)" +msgstr "Об'єкт (%d членів)" + +#: msgjsonviewer.ssavedata +msgid "Save the changes" +msgstr "Зберегти зміни" + +#: TMAINFORM.ACOPY.CAPTION +msgid "&Copy" +msgstr "&Копіювати" + +#: TMAINFORM.ACOPY.HINT +msgid "Copy selected node to clipboard as JSON" +msgstr "" + +#: TMAINFORM.ACUT.CAPTION +msgid "C&ut" +msgstr "Ви&різати" + +#: TMAINFORM.ACUT.HINT +msgid "Cut selected node to clipboard as JSON" +msgstr "" + +#: TMAINFORM.ADELETEVALUE.CAPTION +msgid "&Delete value" +msgstr "" + +#: TMAINFORM.ADELETEVALUE.HINT +msgid "Delete the selected value" +msgstr "" + +#: TMAINFORM.AEXPANDALL.CAPTION +msgid "E&xpand all nodes" +msgstr "Роз&горнути всі вузли" + +#: TMAINFORM.AEXPANDALL.HINT +msgid "Expand all nodes in the document" +msgstr "Розгорнути всі вузли в документі" + +#: TMAINFORM.AEXPANDCURRENTCONTAINER.CAPTION +msgid "Expand ¤t object/array" +msgstr "Розгорнути по&точний об'єкт/масив" + +#: TMAINFORM.AEXPANDCURRENTCONTAINER.HINT +msgid "Expand all nodes in the current object/array" +msgstr "Розгорнути всі вузли в поточному об'єкті/масиві" + +#: TMAINFORM.AFIND.CAPTION +msgid "&Find" +msgstr "&Знайти" + +#: TMAINFORM.AFINDNEXT.CAPTION +msgid "Find &next occurrence" +msgstr "" + +#: TMAINFORM.ANEW.CAPTION +msgid "&New" +msgstr "&Новий" + +#: TMAINFORM.ANEW.HINT +msgid "Create new JSON document" +msgstr "" + +#: TMAINFORM.ANEWARRAY.CAPTION +msgid "New &Array" +msgstr "Новий &Масив" + +#: TMAINFORM.ANEWARRAY.HINT +msgid "Add a new JSON array" +msgstr "" + +#: TMAINFORM.ANEWBOOLEANVALUE.CAPTION +msgid "New &boolean value" +msgstr "" + +#: TMAINFORM.ANEWBOOLEANVALUE.HINT +msgid "Add a new boolean value" +msgstr "" + +#: TMAINFORM.ANEWNULLVALUE.CAPTION +msgid "New N&ull value" +msgstr "" + +#: TMAINFORM.ANEWNULLVALUE.HINT +msgid "Add a new null value" +msgstr "" + +#: TMAINFORM.ANEWNUMBERVALUE.CAPTION +msgid "&New numerical Value" +msgstr "" + +#: TMAINFORM.ANEWNUMBERVALUE.HINT +msgid "Add a new number value" +msgstr "" + +#: TMAINFORM.ANEWOBJECT.CAPTION +msgid "New &Object" +msgstr "Новий &Об'єкт" + +#: TMAINFORM.ANEWOBJECT.HINT +msgid "Add a new JSON object" +msgstr "" + +#: TMAINFORM.ANEWSTRINGVALUE.CAPTION +msgid "New &string value" +msgstr "" + +#: TMAINFORM.ANEWSTRINGVALUE.HINT +msgid "Add a new string value" +msgstr "" + +#: TMAINFORM.AOPEN.CAPTION +msgid "&Open" +msgstr "Від&крити" + +#: TMAINFORM.AOPEN.HINT +msgid "Open JSON document from file" +msgstr "" + +#: TMAINFORM.APASTE.CAPTION +msgid "&Paste" +msgstr "&Вставити" + +#: TMAINFORM.APASTE.HINT +msgid "Paste JSON data in clipboard as new member" +msgstr "" + +#: TMAINFORM.APASTEASDOCUMENT.CAPTION +msgid "Paste as new document" +msgstr "" + +#: TMAINFORM.APASTEASDOCUMENT.HINT +msgid "Paste JSON data in clipboard as new document" +msgstr "" + +#: TMAINFORM.AQUIT.CAPTION +msgid "&Quit" +msgstr "Ви&хід" + +#: TMAINFORM.AQUIT.HINT +msgid "Exit the program" +msgstr "Вийти з програми" + +#: TMAINFORM.ASAVE.CAPTION +msgid "&Save" +msgstr "&Зберегти" + +#: TMAINFORM.ASAVE.HINT +msgid "Save the JSON document to file" +msgstr "" + +#: TMAINFORM.ASAVEAS.CAPTION +msgid "Save &as" +msgstr "Зберегти &як" + +#: TMAINFORM.ASAVEAS.HINT +msgid "Save JSON document with a new name" +msgstr "" + +#: TMAINFORM.MAINFORM.CAPTION +msgctxt "TMAINFORM.MAINFORM.CAPTION" +msgid "JSON Viewer" +msgstr "Переглядач JSON" + +#: TMAINFORM.MEDIT.CAPTION +msgid "&Edit" +msgstr "&Редагувати" + +#: TMAINFORM.MENUITEM1.CAPTION +msgctxt "TMAINFORM.MENUITEM1.CAPTION" +msgid "-" +msgstr "-" + +#: TMAINFORM.MENUITEM2.CAPTION +msgctxt "TMAINFORM.MENUITEM2.CAPTION" +msgid "-" +msgstr "-" + +#: TMAINFORM.MENUITEM3.CAPTION +msgctxt "TMAINFORM.MENUITEM3.CAPTION" +msgid "-" +msgstr "-" + +#: TMAINFORM.MENUITEM8.CAPTION +msgctxt "TMAINFORM.MENUITEM8.CAPTION" +msgid "-" +msgstr "-" + +#: TMAINFORM.MFILE.CAPTION +msgid "&File" +msgstr "&Файл" + +#: TMAINFORM.MIDOCUMENT.CAPTION +msgid "&New document with object" +msgstr "" + +#: TMAINFORM.MIINSERT.CAPTION +msgid "&Values" +msgstr "&Значення" + +#: TMAINFORM.MISORTMEMBERS.CAPTION +msgid "Sort object members" +msgstr "Сортувати елементи об'єкта" + +#: TMAINFORM.MISTRICT.CAPTION +msgid "&Strict JSON" +msgstr "" + +#: TMAINFORM.MOPTIONS.CAPTION +msgid "&Options" +msgstr "&Параметри" + +#: TMAINFORM.TBJSON.CAPTION +msgid "TBJSON" +msgstr "TBJSON" + +#: TMAINFORM.TOOLBUTTON1.CAPTION +msgid "ToolButton1" +msgstr "ToolButton1" + +#: TMAINFORM.TOOLBUTTON4.CAPTION +msgid "ToolButton4" +msgstr "ToolButton4" + diff --git a/tools/lazdatadesktop/languages/lazdatadesktop.uk.po b/tools/lazdatadesktop/languages/lazdatadesktop.uk.po new file mode 100644 index 0000000000..7ec275a77a --- /dev/null +++ b/tools/lazdatadesktop/languages/lazdatadesktop.uk.po @@ -0,0 +1,780 @@ +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Project-Id-Version: \n" +"POT-Creation-Date: \n" +"PO-Revision-Date: \n" +"Last-Translator: Igor Paliychuk \n" +"Language-Team: \n" +"MIME-Version: 1.0\n" +"Content-Transfer-Encoding: 8bit\n" + +#: lazdatadeskstr.eoaddterminator +msgid "Add terminator" +msgstr "" + +#: lazdatadeskstr.eoandtermsinbrackets +msgid "Put brackets around AND Terms" +msgstr "" + +#: lazdatadeskstr.eolinefeedafterandterm +msgid "Linefeed after AND terms" +msgstr "" + +#: lazdatadeskstr.eolinefeedafterfield +msgid "Linefeed after each field" +msgstr "" + +#: lazdatadeskstr.eoquotefieldnames +msgid "Quote field names" +msgstr "" + +#: lazdatadeskstr.eoskipforeignkeys +msgid "Skip foreign keys" +msgstr "" + +#: lazdatadeskstr.eouseoldinwhereparams +msgid "Use OLD prefix in where parameters" +msgstr "" + +#: lazdatadeskstr.sclose +msgid "Close result" +msgstr "" + +#: lazdatadeskstr.scolfields +msgctxt "lazdatadeskstr.scolfields" +msgid "Fields" +msgstr "Поля" + +#: lazdatadeskstr.scolname +msgctxt "lazdatadeskstr.scolname" +msgid "Name" +msgstr "Назва" + +#: lazdatadeskstr.scoloptions +msgctxt "lazdatadeskstr.scoloptions" +msgid "Options" +msgstr "Параметри" + +#: lazdatadeskstr.scolsize +msgid "Size" +msgstr "Розмір" + +#: lazdatadeskstr.scoltype +msgid "Type" +msgstr "Тип" + +#: lazdatadeskstr.sconfirmclose +msgid "Confirm close" +msgstr "Підтвердження закриття" + +#: lazdatadeskstr.sconnectiondescription +msgid "Enter a descriptive name for the connection" +msgstr "" + +#: lazdatadeskstr.sconnectionnameexists +msgid "" +"There is already a connection named \"%s\"\n" +"Would you like to override the connection data ?\n" +msgstr "" +"З'єднання з іменем \"%s\" вже існує.\n" +"Хочете перезаписати його дані?\n" + +#: lazdatadeskstr.screatecode +msgid "Create code" +msgstr "Створити код" + +#: lazdatadeskstr.screateconnection +msgid "Would you like to create a new connection for this database ?" +msgstr "" + +#: lazdatadeskstr.sddmodified +msgid "" +"Data dictionary \"%s\" has changed.\n" +"What do you want to do with the changes?\n" +msgstr "" +"Словник даних \"%s\" був змінений.\n" +"Що ви хочете зробити зі змінами?\n" + +#: lazdatadeskstr.sdeleteobject +msgid "Delete this %s" +msgstr "" + +#: lazdatadeskstr.sdescription +msgctxt "lazdatadeskstr.sdescription" +msgid "Description" +msgstr "Опис" + +#: lazdatadeskstr.sdomain +msgid "Domain" +msgstr "Домен" + +#: lazdatadeskstr.sdontclose +msgid "Do not close editor" +msgstr "Не закривати редактор" + +#: lazdatadeskstr.sdontsave +msgid "Discard changes" +msgstr "Відхилити зміни" + +#: lazdatadeskstr.senginetype +msgid "Engine" +msgstr "" + +#: lazdatadeskstr.serrnoengine +msgid "No database engine !" +msgstr "" + +#: lazdatadeskstr.serrselectfields +msgid "No fields selected. Please select some fields" +msgstr "" + +#: lazdatadeskstr.serrselecttable +msgid "No table selected. Please select a table" +msgstr "" + +#: lazdatadeskstr.serrunknowntype +msgid "Unknown object type: %d" +msgstr "" + +#: lazdatadeskstr.sexecute +msgid "Execute SQL" +msgstr "" + +#: lazdatadeskstr.sexport +msgid "Export data" +msgstr "" + +#: lazdatadeskstr.sfield +msgid "Field" +msgstr "Поле" + +#: lazdatadeskstr.sforeignkey +msgid "Foreign key" +msgstr "" + +#: lazdatadeskstr.shintclose +msgid "Close query result data panel" +msgstr "" + +#: lazdatadeskstr.shintcreatecode +msgid "Create pascal code for this data" +msgstr "" + +#: lazdatadeskstr.shintexecute +msgid "Execute SQL statement" +msgstr "" + +#: lazdatadeskstr.shintexport +msgid "Export this data" +msgstr "" + +#: lazdatadeskstr.shintload +msgid "Load SQL statement from file" +msgstr "" + +#: lazdatadeskstr.shintnext +msgid "Next SQL statement" +msgstr "" + +#: lazdatadeskstr.shintprevious +msgid "Previous SQL statement" +msgstr "" + +#: lazdatadeskstr.shintsave +msgid "Save SQL statement to file" +msgstr "" + +#: lazdatadeskstr.simportdictinto +msgid "Import datadictionary" +msgstr "" + +#: lazdatadeskstr.sindex +msgid "Index" +msgstr "Індекс" + +#: lazdatadeskstr.sld_actionadddomain +msgid "New domain" +msgstr "Новий домен" + +#: lazdatadeskstr.sld_actionadddomainh +msgid "Add a domain to the data dictionary" +msgstr "" + +#: lazdatadeskstr.sld_actionaddforeignkey +msgid "New Foreign Key" +msgstr "" + +#: lazdatadeskstr.sld_actionaddforeignkeyh +msgid "Add a foreign key to the table" +msgstr "" + +#: lazdatadeskstr.sld_actionaddsequence +msgid "New sequence" +msgstr "" + +#: lazdatadeskstr.sld_actionaddsequenceh +msgid "Add a sequence" +msgstr "" + +#: lazdatadeskstr.sld_actionclose +msgid "&Close" +msgstr "&Закрити" + +#: lazdatadeskstr.sld_actioncloseall +msgid "Close &All" +msgstr "Закрити В&се" + +#: lazdatadeskstr.sld_actioncloseallh +msgid "Close all Data Dictionaries" +msgstr "" + +#: lazdatadeskstr.sld_actioncloseh +msgid "Close current Data Dictionary" +msgstr "" + +#: lazdatadeskstr.sld_actioncopy +msgid "&Copy" +msgstr "&Копіювати" + +#: lazdatadeskstr.sld_actioncopyconnection +msgid "&Copy connection" +msgstr "" + +#: lazdatadeskstr.sld_actioncopyh +msgid "Copy" +msgstr "Копіювати" + +#: lazdatadeskstr.sld_actioncreatecode +msgid "Create &code" +msgstr "" + +#: lazdatadeskstr.sld_actioncreatecodeh +msgid "Create code from definition or data" +msgstr "" + +#: lazdatadeskstr.sld_actioncut +msgid "Cu&t" +msgstr "Ви&різати" + +#: lazdatadeskstr.sld_actioncuth +msgid "Cut" +msgstr "Вирізати" + +#: lazdatadeskstr.sld_actiondeleteconnection +msgid "&Delete connection" +msgstr "" + +#: lazdatadeskstr.sld_actiondeleteobject +msgid "Delete &Object" +msgstr "" + +#: lazdatadeskstr.sld_actiondeleteobjecth +msgid "Delete the currently selected object" +msgstr "" + +#: lazdatadeskstr.sld_actiondeleterecentdatadict +msgctxt "lazdatadeskstr.sld_actiondeleterecentdatadict" +msgid "&Delete" +msgstr "Ви&далити" + +#: lazdatadeskstr.sld_actionexit +msgid "E&xit" +msgstr "Ви&хід" + +#: lazdatadeskstr.sld_actionexith +msgid "Quit this program" +msgstr "" + +#: lazdatadeskstr.sld_actiongeneratesql +msgid "&Generate SQL" +msgstr "" + +#: lazdatadeskstr.sld_actiongeneratesqlh +msgid "Generate SQL statements for the current table" +msgstr "" + +#: lazdatadeskstr.sld_actionnew +msgid "&New" +msgstr "&Новий" + +#: lazdatadeskstr.sld_actionnewconnection +msgid "&New connection" +msgstr "" + +#: lazdatadeskstr.sld_actionnewfield +msgid "New &field" +msgstr "Нове &поле" + +#: lazdatadeskstr.sld_actionnewfieldh +msgid "Create a new field in the current table" +msgstr "" + +#: lazdatadeskstr.sld_actionnewh +msgid "Create a new Data Dictionary" +msgstr "" + +#: lazdatadeskstr.sld_actionnewindex +msgid "New index" +msgstr "" + +#: lazdatadeskstr.sld_actionnewindexh +msgid "Add new index to current table" +msgstr "" + +#: lazdatadeskstr.sld_actionnewtable +msgid "New &table" +msgstr "Нова &таблиця" + +#: lazdatadeskstr.sld_actionnewtableh +msgid "Create a new table" +msgstr "" + +#: lazdatadeskstr.sld_actionopen +msgid "&Open..." +msgstr "&Відкрити..." + +#: lazdatadeskstr.sld_actionopenconnection +msgid "&Open connection" +msgstr "" + +#: lazdatadeskstr.sld_actionopenconnectionh +msgid "Open selected recent connection" +msgstr "" + +#: lazdatadeskstr.sld_actionopenh +msgid "Open a new Data Dictionary" +msgstr "" + +#: lazdatadeskstr.sld_actionopenrecentdatadict +msgid "Open" +msgstr "Відкрити" + +#: lazdatadeskstr.sld_actionopenrecentdatadicth +msgid "Open selected recent datadictionary" +msgstr "" + +#: lazdatadeskstr.sld_actionpaste +msgid "&Paste" +msgstr "&Вставити" + +#: lazdatadeskstr.sld_actionpasteh +msgid "Paste" +msgstr "Вставити" + +#: lazdatadeskstr.sld_actionsave +msgid "&Save" +msgstr "&Зберегти" + +#: lazdatadeskstr.sld_actionsaveas +msgid "Save &as" +msgstr "Зберегти &як" + +#: lazdatadeskstr.sld_actionsaveash +msgid "Save datadictionary as" +msgstr "" + +#: lazdatadeskstr.sld_actionsaveh +msgid "Save Data Dictionary" +msgstr "" + +#: lazdatadeskstr.sld_cancel +msgid "&Cancel" +msgstr "&Скасувати" + +#: lazdatadeskstr.sld_charset +msgid "Charset" +msgstr "Кодування" + +#: lazdatadeskstr.sld_connectionlv1 +msgctxt "lazdatadeskstr.sld_connectionlv1" +msgid "Name" +msgstr "Назва" + +#: lazdatadeskstr.sld_connectionlv2 +msgid "Driver" +msgstr "Драйвер" + +#: lazdatadeskstr.sld_connectionlv3 +msgid "Last used" +msgstr "" + +#: lazdatadeskstr.sld_connectionlv4 +msgctxt "lazdatadeskstr.sld_connectionlv4" +msgid "Description" +msgstr "Опис" + +#: lazdatadeskstr.sld_connections +msgctxt "lazdatadeskstr.sld_connections" +msgid "Connections" +msgstr "З'єднання" + +#: lazdatadeskstr.sld_connecttoadatabase +msgid "Connect to a database" +msgstr "" + +#: lazdatadeskstr.sld_createfulltablecreationsql +msgid "Create full table creation SQL" +msgstr "" + +#: lazdatadeskstr.sld_createtable +msgid "Create table" +msgstr "Створити таблицю" + +#: lazdatadeskstr.sld_database +msgctxt "lazdatadeskstr.sld_database" +msgid "Database" +msgstr "База даних" + +#: lazdatadeskstr.sld_delete +msgctxt "lazdatadeskstr.sld_delete" +msgid "&Delete" +msgstr "Ви&далити" + +#: lazdatadeskstr.sld_dictionaries +msgid "Dictionaries" +msgstr "Словники" + +#: lazdatadeskstr.sld_fromconnection +msgid "From connection" +msgstr "" + +#: lazdatadeskstr.sld_generatesql +msgid "Generate SQL" +msgstr "" + +#: lazdatadeskstr.sld_generatesqlstatements +msgid "Generate SQL statements" +msgstr "" + +#: lazdatadeskstr.sld_host +msgid "Host" +msgstr "Хост" + +#: lazdatadeskstr.sld_importupdatedatadictionary +msgid "Import/Update datadictionary" +msgstr "" + +#: lazdatadeskstr.sld_indent +msgid "I&ndent" +msgstr "" + +#: lazdatadeskstr.sld_insert +msgid "&Insert" +msgstr "&Вставка" + +#: lazdatadeskstr.sld_keyfields +msgid "&Key fields" +msgstr "" + +#: lazdatadeskstr.sld_lazarusdatabasedesktop +msgid "Lazarus Database Desktop" +msgstr "" + +#: lazdatadeskstr.sld_linelength +msgid "Line Length" +msgstr "Довжина рядка" + +#: lazdatadeskstr.sld_menuconnections +msgctxt "lazdatadeskstr.sld_menuconnections" +msgid "Connections" +msgstr "З'єднання" + +#: lazdatadeskstr.sld_menudictionary +msgid "&Dictionary" +msgstr "&Словник" + +#: lazdatadeskstr.sld_menudictionaryimport +msgid "&Import" +msgstr "&Імпорт" + +#: lazdatadeskstr.sld_menuedit +msgid "&Edit" +msgstr "&Редагувати" + +#: lazdatadeskstr.sld_menufile +msgid "&File" +msgstr "&Файл" + +#: lazdatadeskstr.sld_ok +msgid "&OK" +msgstr "&OK" + +#: lazdatadeskstr.sld_opendatadictionaryfilter +msgctxt "lazdatadeskstr.sld_opendatadictionaryfilter" +msgid "Data dictionary files|*.fpd|Ini files|*.ini|All files|*.*" +msgstr "" + +#: lazdatadeskstr.sld_opendatadictionarytitle +msgid "Open data dictionary" +msgstr "" + +#: lazdatadeskstr.sld_options +msgctxt "lazdatadeskstr.sld_options" +msgid "Options" +msgstr "Параметри" + +#: lazdatadeskstr.sld_password +msgid "Password" +msgstr "Пароль" + +#: lazdatadeskstr.sld_recentlv1 +msgctxt "lazdatadeskstr.sld_recentlv1" +msgid "Name" +msgstr "Назва" + +#: lazdatadeskstr.sld_recentlv2 +msgid "Filename" +msgstr "Ім'я файлу" + +#: lazdatadeskstr.sld_recentlv3 +msgid "Last used on" +msgstr "" + +#: lazdatadeskstr.sld_savefileasfilter +msgctxt "lazdatadeskstr.sld_savefileasfilter" +msgid "Data dictionary files|*.fpd|Ini files|*.ini|All files|*.*" +msgstr "" + +#: lazdatadeskstr.sld_savefileastitle +msgid "Save file as" +msgstr "Зберегти файл як" + +#: lazdatadeskstr.sld_select +msgid "&Select" +msgstr "&Вибрати" + +#: lazdatadeskstr.sld_selectaconnectiontype +msgid "Select a conection type" +msgstr "" + +#: lazdatadeskstr.sld_selectall +msgid "Select &all" +msgstr "Вибрати в&се" + +#: lazdatadeskstr.sld_selectnone +msgid "Select &none" +msgstr "" + +#: lazdatadeskstr.sld_selectupdateinsertfields +msgid "Select/Update/Insert fields" +msgstr "" + +#: lazdatadeskstr.sld_separator +msgid "-" +msgstr "-" + +#: lazdatadeskstr.sld_table +msgid "Ta&ble" +msgstr "Та&блиця" + +#: lazdatadeskstr.sld_tableandfields +msgid "Tables and &Fields" +msgstr "" + +#: lazdatadeskstr.sld_update +msgid "&Update" +msgstr "&Оновлення" + +#: lazdatadeskstr.sld_updateexistingtables +msgid "Update existing tables" +msgstr "" + +#: lazdatadeskstr.sld_username +msgid "Username" +msgstr "" + +#: lazdatadeskstr.sload +msgid "Load SQL" +msgstr "Завантажити SQL" + +#: lazdatadeskstr.snamefor +msgid "Enter a name for the new %s" +msgstr "" + +#: lazdatadeskstr.snew +msgid "New %s" +msgstr "" + +#: lazdatadeskstr.snewconnection +msgid "New connection" +msgstr "Нове з'єднання" + +#: lazdatadeskstr.snewdictionary +msgid "New database" +msgstr "Нова база даних" + +#: lazdatadeskstr.snewdomain +msgid "Create new domain" +msgstr "" + +#: lazdatadeskstr.snewdomainname +msgid "Enter a name for the new domain:" +msgstr "" + +#: lazdatadeskstr.snewfield +msgid "Create new field in table %s" +msgstr "" + +#: lazdatadeskstr.snewfieldname +msgid "Enter a name for the new field:" +msgstr "" + +#: lazdatadeskstr.snewforeignkey +msgid "Create new foreign key in table %s" +msgstr "" + +#: lazdatadeskstr.snewforeignkeyname +msgid "Enter a name for the new foreign key:" +msgstr "" + +#: lazdatadeskstr.snewindex +msgid "Create new index on table %s" +msgstr "" + +#: lazdatadeskstr.snewindexname +msgid "Enter a name for the new index:" +msgstr "" + +#: lazdatadeskstr.snewobject +msgid "Create new %s" +msgstr "" + +#: lazdatadeskstr.snewsequence +msgid "Create new sequence" +msgstr "" + +#: lazdatadeskstr.snewsequencename +msgid "Enter a name for the new sequence:" +msgstr "" + +#: lazdatadeskstr.snewtable +msgid "Create new table" +msgstr "" + +#: lazdatadeskstr.snewtablename +msgid "Enter a name for the new table:" +msgstr "" + +#: lazdatadeskstr.snext +msgid "Next" +msgstr "Наступний" + +#: lazdatadeskstr.snodedatabase +msgctxt "lazdatadeskstr.snodedatabase" +msgid "Database" +msgstr "База даних" + +#: lazdatadeskstr.snodedatadictionary +msgid "Datadictionary" +msgstr "" + +#: lazdatadeskstr.snodedomains +msgid "Domains" +msgstr "Домени" + +#: lazdatadeskstr.snodefields +msgctxt "lazdatadeskstr.snodefields" +msgid "Fields" +msgstr "Поля" + +#: lazdatadeskstr.snodeforeignkeys +msgid "Foreign keys" +msgstr "" + +#: lazdatadeskstr.snodeindexes +msgid "Indexes" +msgstr "Індекси" + +#: lazdatadeskstr.snodeindexfields +msgid "Index fields: " +msgstr "" + +#: lazdatadeskstr.snodeindexoptions +msgid "Index options: " +msgstr "" + +#: lazdatadeskstr.snodesequences +msgid "Sequences" +msgstr "" + +#: lazdatadeskstr.snodetabledata +msgid "Table Data" +msgstr "Дані Таблиці" + +#: lazdatadeskstr.snodetables +msgid "Tables" +msgstr "Таблиці" + +#: lazdatadeskstr.sobject +msgid "Object" +msgstr "Об'єкт" + +#: lazdatadeskstr.sparameter +msgid "Parameter" +msgstr "Параметр" + +#: lazdatadeskstr.sprevious +msgid "Previous" +msgstr "Попередній" + +#: lazdatadeskstr.squery +msgid "Run query" +msgstr "" + +#: lazdatadeskstr.srowsaffected +msgid "Query executed succesfully: %d rows affected." +msgstr "" + +#: lazdatadeskstr.ssave +msgid "Save SQL" +msgstr "Зберегти SQL" + +#: lazdatadeskstr.ssavedata +msgid "Save changes" +msgstr "Зберегти зміни" + +#: lazdatadeskstr.sselectdbfdir +msgid "Select a directory with DBF files" +msgstr "" + +#: lazdatadeskstr.sselectedobject +msgid "Selected object" +msgstr "" + +#: lazdatadeskstr.ssequence +msgid "Sequence" +msgstr "" + +#: lazdatadeskstr.ssqlfilters +msgid "SQL files|*.sql|All files|*.*" +msgstr "" + +#: lazdatadeskstr.stable +msgid "Table" +msgstr "Таблиця" + +#: lazdatadeskstr.sunknownconnection +msgid "Unknown connection: %s" +msgstr "" + +#: lazdatadeskstr.sunknowndictionary +msgid "Unknown data dictionary: %s" +msgstr "" + +#: lazdatadeskstr.susecurrentdict +msgid "Yes, use the active dictionary" +msgstr "" + +#: lazdatadeskstr.susenewdict +msgid "No, import in a new dictionary" +msgstr "" + +#: lazdatadeskstr.svalue +msgid "Value" +msgstr "" + +#: lazdatadeskstr.swhichcurrentdicttouse +msgid "A data dictionary is active.Would you like to import into this data dictionary ?" +msgstr "" +