From dad1f24f566614e624a91e027a865c4cd38712d0 Mon Sep 17 00:00:00 2001 From: mattias Date: Sun, 16 Aug 2009 19:18:47 +0000 Subject: [PATCH] translation: finnish: updates from Seppo git-svn-id: trunk@21258 - --- languages/lazaruside.fi.po | 2092 ++++++++++++++++++------------------ 1 file changed, 1067 insertions(+), 1025 deletions(-) diff --git a/languages/lazaruside.fi.po b/languages/lazaruside.fi.po index 333e12b352..0e099b640b 100644 --- a/languages/lazaruside.fi.po +++ b/languages/lazaruside.fi.po @@ -31,7 +31,7 @@ msgstr "" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" msgid "Gutter" -msgstr "Vasen reunus" +msgstr "" #: lazarusidestrconsts.dlfmousesimplerightmovecaret msgid "Right mouse includes caret move" @@ -96,11 +96,11 @@ msgstr "" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" -msgstr "" +msgstr "Ensimmäinen kirjain iso muut pieniä" #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" -msgstr "" +msgstr "Lisää := operaattori (saa arvokseen) " #: lazarusidestrconsts.dlgaddhiattrbracketmatch msgid "Brackets highlight" @@ -138,7 +138,7 @@ msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupline msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" msgid "Line" -msgstr "" +msgstr "Rivi" #: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit msgid "Syncron Edit" @@ -241,7 +241,7 @@ msgstr "" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" -msgstr "" +msgstr "Lisää puolipiste" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" @@ -261,7 +261,7 @@ msgstr "" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" -msgstr "" +msgstr "Toiminta moniselitteisten tai epäselvien tiedostojen kanssa" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" @@ -269,7 +269,7 @@ msgstr "" #: lazarusidestrconsts.dlgapplicationsettings msgid "Application Settings" -msgstr "" +msgstr "Sovelluksen asetukset" #: lazarusidestrconsts.dlgassemblerdefault msgctxt "lazarusidestrconsts.dlgassemblerdefault" @@ -282,19 +282,19 @@ msgstr "" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" -msgstr "" +msgstr "Automaattisesti luotavat lomakkeet:" #: lazarusidestrconsts.dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" -msgstr "" +msgstr "Kun tehdään uusi lomake niin se laitetaan automaattisesti luotaviin lomakkeisiin" #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" -msgstr "" +msgstr "Poista tiedosto automaattisesti" #: lazarusidestrconsts.dlgautoform msgid "Auto create form when opening unit" -msgstr "" +msgstr "Luo myös uusi lomake kun avataan uusi käännösyksikkö" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse when typing" @@ -310,27 +310,27 @@ msgstr "" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" -msgstr "" +msgstr "Muunna nimi automaattisesti pienillä kirjaimilla kirjoitetuksi" #: lazarusidestrconsts.dlgautosave msgid "Auto save" -msgstr "" +msgstr "Automaattinen tallennus" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" -msgstr "" +msgstr "Käytettävissä olevat lomakkeet:" #: lazarusidestrconsts.dlgbackcolor msgid "Background" -msgstr "" +msgstr "Taustaväri" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" -msgstr "" +msgstr "(ei alikansiota)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" -msgstr "" +msgstr "Sama nimi (mutta alikansiossa)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" @@ -379,12 +379,12 @@ msgstr "" #: lazarusidestrconsts.dlgcancel msgctxt "lazarusidestrconsts.dlgcancel" msgid "Cancel" -msgstr "" +msgstr "Peru" #: lazarusidestrconsts.dlgcasesensitive msgctxt "lazarusidestrconsts.dlgcasesensitive" msgid "&Case Sensitive" -msgstr "" +msgstr "Sama kirjainkoko" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" @@ -441,11 +441,11 @@ msgstr "" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" -msgstr "" +msgstr "Pienet kirjaimet" #: lazarusidestrconsts.dlgcdtpreview msgid "Preview (Max line length = 1)" -msgstr "" +msgstr "Esikatselu (kun maksimi rivinpituus = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" @@ -457,7 +457,7 @@ msgstr "" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" -msgstr "" +msgstr "ISOT KIRJAIMET" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" @@ -473,15 +473,15 @@ msgstr "" #: lazarusidestrconsts.dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" -msgstr "" +msgstr "'Tallenna nimellä'-toiminnossa, tiedoston nimen automaattinen muuntaminen pieniksi kirjaimiksi" #: lazarusidestrconsts.dlgcheckconsistency msgid "Check consistency" -msgstr "" +msgstr "Tarkista yksikäsitteisyys" #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" -msgstr "" +msgstr "Valitse koodilyhennetiedosto (*.dci)" #: lazarusidestrconsts.dlgclassinsertpolicy msgid "Class part insert policy" @@ -489,11 +489,11 @@ msgstr "" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" -msgstr "" +msgstr "Näytä sulje-painike välilehdellä" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" -msgstr "" +msgstr "Värikaavio" #: lazarusidestrconsts.dlgcmacro msgid "C Style Macros (global)" @@ -568,11 +568,11 @@ msgstr "" #: lazarusidestrconsts.dlgcodefoldingmouse msgctxt "lazarusidestrconsts.dlgcodefoldingmouse" msgid "Mouse" -msgstr "" +msgstr "Hiiri" #: lazarusidestrconsts.dlgcodegeneration msgid "Code" -msgstr "" +msgstr "Koodi" #: lazarusidestrconsts.dlgcodetoolsopts msgid "CodeTools Options" @@ -629,11 +629,11 @@ msgstr "" #: lazarusidestrconsts.dlgcommandlineparameters msgid "Command line parameters" -msgstr "" +msgstr "Komentorivin parametrit" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" -msgstr "" +msgstr "Komentorivin parametrit (ilman ohjelman omaa nimeä)" #: lazarusidestrconsts.dlgcomovedown msgid "Move down" @@ -703,7 +703,7 @@ msgstr "" #: lazarusidestrconsts.dlgcoshowerr msgid "Show Errors" -msgstr "" +msgstr "Näytä virheet" #: lazarusidestrconsts.dlgcoshowoptions msgid "&Show Options" @@ -751,7 +751,7 @@ msgstr "" #: lazarusidestrconsts.dlgcursorgroupoptions msgid "Cursor:" -msgstr "" +msgstr "Kursori:" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Cursor skips selection" @@ -759,7 +759,7 @@ msgstr "" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" -msgstr "" +msgstr "Käyttäjän määrittämä tiedostontarkennin (.pp.xxx)" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" @@ -771,11 +771,11 @@ msgstr "" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" -msgstr "" +msgstr "Editorin oletuskirjasin" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" -msgstr "" +msgstr "Oletusarvo" #: lazarusidestrconsts.dlgdelphi2ext msgid "Delphi 2 Extensions" @@ -783,7 +783,7 @@ msgstr "" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " -msgstr "" +msgstr "Poistetaanko koodilyhenne " #: lazarusidestrconsts.dlgdeplhicomp msgid "Delphi Compatible" @@ -791,7 +791,7 @@ msgstr "" #: lazarusidestrconsts.dlgdesktop msgid "Desktop" -msgstr "" +msgstr "Työpöytä" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " @@ -799,7 +799,7 @@ msgstr "" #: lazarusidestrconsts.dlgdesktopfiles msgid "Desktop files" -msgstr "" +msgstr "Työpöytätiedostot" #: lazarusidestrconsts.dlgdesktopglyphsfor msgid "Glyphs for:" @@ -819,7 +819,7 @@ msgstr "" #: lazarusidestrconsts.dlgdirection msgid "Direction" -msgstr "" +msgstr "Suunta" #: lazarusidestrconsts.dlgdirectorydoesnotexist msgid "Directory does not exist" @@ -899,7 +899,7 @@ msgstr "" #: lazarusidestrconsts.dlgdownword msgctxt "lazarusidestrconsts.dlgdownword" msgid "Down" -msgstr "" +msgstr "Alas" #: lazarusidestrconsts.dlgedadd msgid "Add..." @@ -911,20 +911,22 @@ msgstr "" #: lazarusidestrconsts.dlgedbold msgid "Bold" -msgstr "" +msgstr "Lihavoitu" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" -msgstr "" +msgstr "Alikansio" #: lazarusidestrconsts.dlgedcodetempl msgid "Code templates" -msgstr "" +msgstr "Koodilyhenteet" #: lazarusidestrconsts.dlgedcolor +#, fuzzy +#| msgid "Syntax highlight" msgctxt "lazarusidestrconsts.dlgedcolor" msgid "Colors" -msgstr "" +msgstr "Väri" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Complete blocks" @@ -932,11 +934,11 @@ msgstr "" #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" -msgstr "" +msgstr "Käyttäjän määrittämä tiedostontarkennin" #: lazarusidestrconsts.dlgeddelay msgid "Delay" -msgstr "" +msgstr "Viive" #: lazarusidestrconsts.dlgeddelete msgctxt "lazarusidestrconsts.dlgeddelete" @@ -945,7 +947,7 @@ msgstr "" #: lazarusidestrconsts.dlgeddisplay msgid "Display" -msgstr "" +msgstr "Näkymä" #: lazarusidestrconsts.dlgededit msgid "Edit..." @@ -957,12 +959,12 @@ msgstr "" #: lazarusidestrconsts.dlgedhintcommand msgid "Hint: click on the command you want to edit" -msgstr "" +msgstr "Vihje: Klikkaa komentoa jota haluat muuttaa" #: lazarusidestrconsts.dlgedidcomlet msgctxt "lazarusidestrconsts.dlgedidcomlet" msgid "Identifier completion" -msgstr "" +msgstr "Koodin täydentäminen" #: lazarusidestrconsts.dlgedinvert msgid "Invert" @@ -970,15 +972,15 @@ msgstr "" #: lazarusidestrconsts.dlgedital msgid "Italic" -msgstr "" +msgstr "Kursivoitu" #: lazarusidestrconsts.dlgeditorfont msgid "Editor font" -msgstr "" +msgstr "Editorin käyttämä kirjasin" #: lazarusidestrconsts.dlgeditorfontheight msgid "Editor font height" -msgstr "" +msgstr "Editorin käyttämän kirjasimen koko" #: lazarusidestrconsts.dlgeditoroptions msgctxt "lazarusidestrconsts.dlgeditoroptions" @@ -1003,11 +1005,11 @@ msgstr "" #: lazarusidestrconsts.dlgedunder msgid "Underline" -msgstr "" +msgstr "Alleviivaus" #: lazarusidestrconsts.dlgedusedefcolor msgid "Use default color" -msgstr "" +msgstr "Käytä oletusväriä" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" @@ -1019,46 +1021,46 @@ msgstr "" #: lazarusidestrconsts.dlgentirescope msgid "&Entire Scope" -msgstr "" +msgstr "Ulottuvuuden alkukohta" #: lazarusidestrconsts.dlgenvask msgid "Ask" -msgstr "" +msgstr "Kysy" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" -msgstr "" +msgstr "Huomaa: Projektin tiedostot ovat kaikki tiedostot projektikansiossa" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" -msgstr "" +msgstr "Varmistus" #: lazarusidestrconsts.dlgenvcolors msgctxt "lazarusidestrconsts.dlgenvcolors" msgid "Colors" -msgstr "" +msgstr "Värit" #: lazarusidestrconsts.dlgenvfiles msgid "Files" -msgstr "" +msgstr "Tiedostot" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" -msgstr "" +msgstr "Apupisteet" #: lazarusidestrconsts.dlgenvlanguage msgctxt "lazarusidestrconsts.dlgenvlanguage" msgid "Language" -msgstr "" +msgstr "Kieli" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" -msgstr "" +msgstr "Kohdistusviivat" #: lazarusidestrconsts.dlgenvmisc msgctxt "lazarusidestrconsts.dlgenvmisc" msgid "Miscellaneous" -msgstr "" +msgstr "Muut" #: lazarusidestrconsts.dlgenvnone msgctxt "lazarusidestrconsts.dlgenvnone" @@ -1067,16 +1069,16 @@ msgstr "" #: lazarusidestrconsts.dlgenvotherfiles msgid "Other files" -msgstr "" +msgstr "Muut tiedostot" #: lazarusidestrconsts.dlgenvproject msgid "Project" -msgstr "" +msgstr "Projekti" #: lazarusidestrconsts.dlgenvtype msgctxt "lazarusidestrconsts.dlgenvtype" msgid "Type" -msgstr "" +msgstr "Tyyppi" #: lazarusidestrconsts.dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" @@ -1088,7 +1090,7 @@ msgstr "" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" -msgstr "" +msgstr "Lisäpikselien määrä rivien välissä (tekstin erottaminen helpottuu)" #: lazarusidestrconsts.dlgextsymb msgid "Use external gdb debug symbols file" @@ -1096,11 +1098,11 @@ msgstr "" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" -msgstr "" +msgstr "Tiedostopäätteet" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" -msgstr "" +msgstr "Etsi oletuksena kursorin osoittamaa tekstiä" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" @@ -1146,7 +1148,7 @@ msgstr "" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" msgid "Procedure" -msgstr "" +msgstr "Aliohjelma" #: lazarusidestrconsts.dlgfoldpasprogram msgctxt "lazarusidestrconsts.dlgfoldpasprogram" @@ -1189,7 +1191,7 @@ msgstr "" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" -msgstr "" +msgstr "Kirjaimien väri" #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" @@ -1201,11 +1203,11 @@ msgstr "" #: lazarusidestrconsts.dlgfpcpath msgid "Compiler path (e.g. %s)" -msgstr "" +msgstr "FreePascal kääntäjä (%s) löytyy tästä polusta/linkistä" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" -msgstr "" +msgstr "FPC:n (FreePascal:n) lähdekoodin kansio" #: lazarusidestrconsts.dlgframecolor msgid "Frame color" @@ -1213,16 +1215,16 @@ msgstr "" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" -msgstr "" +msgstr "Lomake-editori" #: lazarusidestrconsts.dlgfromcursor msgid "&From Cursor" -msgstr "" +msgstr "Kohdistimen osoittama kohta" #: lazarusidestrconsts.dlgfropts msgctxt "lazarusidestrconsts.dlgfropts" msgid "Options" -msgstr "" +msgstr "Optiot" #: lazarusidestrconsts.dlggeneratedwarf msgid "Generate dwarf debug information" @@ -1230,11 +1232,11 @@ msgstr "" #: lazarusidestrconsts.dlggetposition msgid "Get position" -msgstr "" +msgstr "Hae sijainti" #: lazarusidestrconsts.dlgglobal msgid "&Global" -msgstr "" +msgstr "Kaikki" #: lazarusidestrconsts.dlgglyphshowalways msgid "Show Always" @@ -1258,27 +1260,27 @@ msgstr "" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" -msgstr "" +msgstr "Valitun komponentin (tai valinta-alueen) ilmaiseminen" #: lazarusidestrconsts.dlggridcolor msgid "Grid color" -msgstr "" +msgstr "Apupisteiden väri" #: lazarusidestrconsts.dlggridx msgid "Grid size X" -msgstr "" +msgstr "Apupisteiden väli X" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" -msgstr "" +msgstr "Apupisteiden välinen etäisyys vaakasuunnassa" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" -msgstr "" +msgstr "Apupisteiden väli Y" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" -msgstr "" +msgstr "Apupisteiden välinen etäisyys pystysuunnassa" #: lazarusidestrconsts.dlggroupcodeexplorer msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" @@ -1295,17 +1297,17 @@ msgstr "Virheenjäljitin" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" -msgstr "" +msgstr "Editori" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" msgid "Environment" -msgstr "" +msgstr "Käyttöympäristö" #: lazarusidestrconsts.dlggrouphelp msgctxt "lazarusidestrconsts.dlggrouphelp" msgid "Help" -msgstr "" +msgstr "Ohje" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" @@ -1313,16 +1315,16 @@ msgstr "" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" -msgstr "" +msgstr "Näytä kohdistusviivat" #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" -msgstr "" +msgstr "Vasen reunus" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" -msgstr "" +msgstr "Reunuksen väri" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" @@ -1334,11 +1336,11 @@ msgstr "" #: lazarusidestrconsts.dlggutterwidth msgid "Gutter width" -msgstr "" +msgstr "Reunuksen leveys" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" -msgstr "" +msgstr "Vain puolen sivun liikutus (scrollaus) (PageUp- & PageDown-näppäimillä)" #: lazarusidestrconsts.dlgheapsize msgid "Heap Size" @@ -1346,11 +1348,11 @@ msgstr "" #: lazarusidestrconsts.dlgheightpos msgid "Height:" -msgstr "" +msgstr "Korkeus:" #: lazarusidestrconsts.dlghideideonrun msgid "Hide IDE windows on run" -msgstr "" +msgstr "Pienennä Lazaruksen käyttöliittymä ohjelmaa suorittaessa " #: lazarusidestrconsts.dlghidemessagesicons msgid "Hide Messages Icons" @@ -1382,7 +1384,7 @@ msgstr "" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" -msgstr "" +msgstr "Home-näppäin siirtyy koodirivin alkuun sisennykset huomioiden" #: lazarusidestrconsts.dlghostapplication msgid "Host application" @@ -1391,7 +1393,7 @@ msgstr "" #: lazarusidestrconsts.dlgidentifiercompletion msgctxt "lazarusidestrconsts.dlgidentifiercompletion" msgid "Identifier completion" -msgstr "" +msgstr "Koodin täydentäminen" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" @@ -1403,7 +1405,7 @@ msgstr "" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" -msgstr "" +msgstr "Ohita" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" @@ -1427,11 +1429,11 @@ msgstr "" #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" -msgstr "" +msgstr "Lisää välilyönti seuraavien jälkeen" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" -msgstr "" +msgstr "Lisää välilyönti ennen seuraavia (merkkejä)" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" @@ -1443,11 +1445,11 @@ msgstr "" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep cursor X position" -msgstr "" +msgstr "Yritä pysyä samalla kohtaa eri riveillä (x-paikka)" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" -msgstr "" +msgstr "Näppäinkomennot" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" @@ -1468,7 +1470,7 @@ msgstr "" #: lazarusidestrconsts.dlglang msgctxt "lazarusidestrconsts.dlglang" msgid "Language" -msgstr "" +msgstr "Kieli" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" @@ -1476,15 +1478,15 @@ msgstr "" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" -msgstr "" +msgstr "Lazarus:n kansio (oletuksena kaikissa projekteissa)" #: lazarusidestrconsts.dlgleftpos msgid "Left:" -msgstr "" +msgstr "Vasemmalta:" #: lazarusidestrconsts.dlglefttopclr msgid "color for left, top" -msgstr "" +msgstr "väri vasemmalla ja ylhäällä" #: lazarusidestrconsts.dlglevel1opt msgid "Level 1 (quick and debugger friendly)" @@ -1500,11 +1502,11 @@ msgstr "" #: lazarusidestrconsts.dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" -msgstr "" +msgstr "Taso 0 (Ei optimointia)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" -msgstr "" +msgstr "Rivin katkaisu" #: lazarusidestrconsts.dlglinklibraries msgid "Link Style:" @@ -1520,15 +1522,15 @@ msgstr "" #: lazarusidestrconsts.dlgloaddfile msgid "Load desktop settings from file" -msgstr "" +msgstr "Lue työpöytäasetukset tiedostosta" #: lazarusidestrconsts.dlgmainmenu msgid "Main Menu" -msgstr "" +msgstr "Päävalikko" #: lazarusidestrconsts.dlgmainviewforms msgid "View project forms" -msgstr "" +msgstr "Näytä projektin lomakkeet (forms)" #: lazarusidestrconsts.dlgmainviewframes msgid "View project frames" @@ -1536,19 +1538,19 @@ msgstr "" #: lazarusidestrconsts.dlgmainviewunits msgid "View project units" -msgstr "" +msgstr "Näytä projektin käännösyksiköt (units)" #: lazarusidestrconsts.dlgmakepath msgid "Make path" -msgstr "" +msgstr "Make -ohjelman hakupolku" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" -msgstr "" +msgstr "Oikea marginaali ja vasen reunus" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" -msgstr "" +msgstr "Valittujen komponenttien ilmaiseminen" #: lazarusidestrconsts.dlgmarkupgroup msgid "Word under Caret Highlight" @@ -1576,19 +1578,19 @@ msgstr "" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" -msgstr "" +msgstr "Suurin laskijanumero" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" -msgstr "" +msgstr "Suurin rivinpituus:" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" -msgstr "" +msgstr "Tallessa pidettävien viimeiseksi käytettyjen tiedostojen nimien lukumäärä" #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" -msgstr "" +msgstr "Tallessa pidettävien viimeiseksi käytettyjen projektien lukumäärä" #: lazarusidestrconsts.dlgmethodinspolicy msgid "Method insert policy" @@ -1605,22 +1607,22 @@ msgstr "" #: lazarusidestrconsts.dlgmousefoldbutton msgctxt "lazarusidestrconsts.dlgmousefoldbutton" msgid "Button" -msgstr "" +msgstr "Painike" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft" msgid "Left" -msgstr "" +msgstr "Vasen" #: lazarusidestrconsts.dlgmousefoldbuttonmiddle msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle" msgid "Middle" -msgstr "" +msgstr "Keskimmäinen" #: lazarusidestrconsts.dlgmousefoldbuttonright msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright" msgid "Right" -msgstr "" +msgstr "Oikea" #: lazarusidestrconsts.dlgmousefoldcolfoldall msgid "Fold All (Some Colapsed)" @@ -1641,7 +1643,7 @@ msgstr "" #: lazarusidestrconsts.dlgmousefoldenabled msgctxt "lazarusidestrconsts.dlgmousefoldenabled" msgid "Enabled" -msgstr "" +msgstr "Sallittu" #: lazarusidestrconsts.dlgmousefoldexpfoldall msgid "Fold All (All Expanded)" @@ -1653,11 +1655,13 @@ msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" -msgstr "" +msgstr "Asetus 1" #: lazarusidestrconsts.dlgmousefoldgroup2 +#, fuzzy +#| msgid "setting 2" msgid "Setting 2" -msgstr "" +msgstr "Asetus" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt" @@ -1676,7 +1680,7 @@ msgstr "" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" -msgstr "" +msgstr "Hiiri:" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" @@ -1697,7 +1701,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnadd msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd" msgid "Add" -msgstr "" +msgstr "Lisää" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" @@ -1706,7 +1710,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptbtncancel msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel" msgid "Cancel" -msgstr "" +msgstr "Peru" #: lazarusidestrconsts.dlgmouseoptbtndel msgctxt "lazarusidestrconsts.dlgmouseoptbtndel" @@ -1716,7 +1720,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptbtndown msgctxt "lazarusidestrconsts.dlgmouseoptbtndown" msgid "Down" -msgstr "" +msgstr "Alas" #: lazarusidestrconsts.dlgmouseoptbtnexport msgid "Export" @@ -1737,12 +1741,12 @@ msgstr "Tuo" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" -msgstr "" +msgstr "Vasen" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" -msgstr "" +msgstr "Keskimmäinen" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" @@ -1756,17 +1760,17 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" -msgstr "" +msgstr "Oikea" #: lazarusidestrconsts.dlgmouseoptbtnudp msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp" msgid "Change" -msgstr "" +msgstr "Muuta" #: lazarusidestrconsts.dlgmouseoptbtnup msgctxt "lazarusidestrconsts.dlgmouseoptbtnup" msgid "Up" -msgstr "" +msgstr "Ylös" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" @@ -1810,7 +1814,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" -msgstr "" +msgstr "Painike" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" @@ -1846,7 +1850,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" msgid "Order" -msgstr "" +msgstr "Järjestys" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" @@ -1861,7 +1865,7 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" -msgstr "" +msgstr "Hiiri" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" @@ -1928,12 +1932,12 @@ msgstr "" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" msgid "Text" -msgstr "Teksti" +msgstr "" #: lazarusidestrconsts.dlgmouseoptnodeselect msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" msgid "Selection" -msgstr "" +msgstr "Valinta" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" @@ -1959,15 +1963,17 @@ msgstr "" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" -msgstr "" +msgstr "Monivalinta" #: lazarusidestrconsts.dlgnaming msgid "Naming" -msgstr "" +msgstr "Nimeäminen" #: lazarusidestrconsts.dlgnoautomaticrenaming +#, fuzzy +#| msgid "no automatic renaming" msgid "No automatic renaming" -msgstr "" +msgstr "Ei automaattista uudelleen nimeämistä" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" @@ -1975,11 +1981,11 @@ msgstr "Ei korostusta" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" -msgstr "" +msgstr "Riviä ei katkaista kun sitä edellä oli:" #: lazarusidestrconsts.dlgnotsplitlinefront msgid "Do not split line In front of:" -msgstr "" +msgstr "Riviä ei katkaista kun sitä seuraa:" #: lazarusidestrconsts.dlgobjinsp msgctxt "lazarusidestrconsts.dlgobjinsp" @@ -1988,17 +1994,17 @@ msgstr "" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height" -msgstr "" +msgstr "Rivin korkeus" #: lazarusidestrconsts.dlgoimiscellaneous msgctxt "lazarusidestrconsts.dlgoimiscellaneous" msgid "Miscellaneous" -msgstr "" +msgstr "Muut" #: lazarusidestrconsts.dlgoioptions msgctxt "lazarusidestrconsts.dlgoioptions" msgid "Options" -msgstr "" +msgstr "Optiot" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" @@ -2030,11 +2036,11 @@ msgstr "" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" -msgstr "" +msgstr "Vihjetekstit komponenttipaletille" #: lazarusidestrconsts.dlgpasext msgid "Default pascal extension" -msgstr "" +msgstr "Oletuksena käytettävä Pascal-kielen tiedostopääte" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" @@ -2054,11 +2060,11 @@ msgstr "" #: lazarusidestrconsts.dlgpoapplication msgid "Application" -msgstr "" +msgstr "Sovellus" #: lazarusidestrconsts.dlgpoclearicon msgid "Clear Icon" -msgstr "" +msgstr "Poista kuvake" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" @@ -2066,7 +2072,7 @@ msgstr "" #: lazarusidestrconsts.dlgpofroms msgid "Forms" -msgstr "" +msgstr "Lomakkeet" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" @@ -2074,7 +2080,7 @@ msgstr "" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" -msgstr "" +msgstr "Kuvake:" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" @@ -2087,20 +2093,20 @@ msgstr "" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" -msgstr "" +msgstr "Tuo kuvake" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" msgid "Miscellaneous" -msgstr "" +msgstr "Muut" #: lazarusidestrconsts.dlgpooutputsettings msgid "Output Settings" -msgstr "" +msgstr "Sovelluksen tiedostoasetukset" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" -msgstr "" +msgstr "Tallenna kuvake" #: lazarusidestrconsts.dlgposavesession msgid "Session" @@ -2108,11 +2114,11 @@ msgstr "" #: lazarusidestrconsts.dlgpotargetfilename msgid "Target file name:" -msgstr "" +msgstr "Tehtävän sovelluksen tiedostonimi:" #: lazarusidestrconsts.dlgpotitle msgid "Title:" -msgstr "" +msgstr "Nimi:" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" @@ -2124,15 +2130,15 @@ msgstr "" #: lazarusidestrconsts.dlgprojectoptions msgid "Project Options" -msgstr "" +msgstr "Projektikohtaiset asetukset" #: lazarusidestrconsts.dlgprojfiles msgid "Project files" -msgstr "" +msgstr "Projektin tiedostot" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt On Replace" -msgstr "" +msgstr "Kysy vielä muutoksille vahvistusta" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" @@ -2140,11 +2146,11 @@ msgstr "" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" -msgstr "" +msgstr "Ominaisuuden nimi" #: lazarusidestrconsts.dlgqopenlastprj msgid "Open last project at start" -msgstr "" +msgstr "Avaa viimeksi käsitelty projekti Lazaruksen käynnistyksen yhteydessä" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" @@ -2152,15 +2158,15 @@ msgstr "" #: lazarusidestrconsts.dlgqshowcompiledialog msgid "Show compile dialog" -msgstr "" +msgstr "Näytä käännösikkuna" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" -msgstr "" +msgstr "Näytä apupisteet" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" -msgstr "" +msgstr "Sijoitu apupisteiden avulla" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" @@ -2168,15 +2174,15 @@ msgstr "" #: lazarusidestrconsts.dlgregularexpressions msgid "&Regular Expressions" -msgstr "" +msgstr "Säännölliset lausekkeet" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" -msgstr "" +msgstr "Korvaa kaikki" #: lazarusidestrconsts.dlgreplacewith msgid "&Replace With" -msgstr "" +msgstr "Korvaava" #: lazarusidestrconsts.dlgreport msgid "Report" @@ -2184,15 +2190,15 @@ msgstr "" #: lazarusidestrconsts.dlgrightbottomclr msgid "color for right, bottom" -msgstr "" +msgstr "väri oikealla ja alhaalla" #: lazarusidestrconsts.dlgrightclickselects msgid "Right Click selects" -msgstr "" +msgstr "Valinta voidaan tehdä hiiren oikean näppäimellä" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" -msgstr "" +msgstr "Oikea marginaaliviiva" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" @@ -2200,7 +2206,7 @@ msgstr "" #: lazarusidestrconsts.dlgrubberbandgroup msgid "Rubber band" -msgstr "" +msgstr "Alueen reunojen esille tuominen" #: lazarusidestrconsts.dlgrubberbandselectsgrandchilds msgid "Select grand childs" @@ -2208,12 +2214,12 @@ msgstr "" #: lazarusidestrconsts.dlgruberbandcreationcolor msgid "Creation" -msgstr "" +msgstr "Luonti" #: lazarusidestrconsts.dlgruberbandselectioncolor msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" msgid "Selection" -msgstr "" +msgstr "Valinta" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" @@ -2222,11 +2228,11 @@ msgstr "" #: lazarusidestrconsts.dlgrunoenvironment msgctxt "lazarusidestrconsts.dlgrunoenvironment" msgid "Environment" -msgstr "" +msgstr "Käyttöympäristö" #: lazarusidestrconsts.dlgrunolocal msgid "Local" -msgstr "" +msgstr "Paikalliset" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" @@ -2251,11 +2257,11 @@ msgstr "" #: lazarusidestrconsts.dlgrunparameters msgid "Run parameters" -msgstr "" +msgstr "Suoritusaikaiset parametrit" #: lazarusidestrconsts.dlgsavedfile msgid "Save desktop settings to file" -msgstr "" +msgstr "Tallenna työpöytäasetukset tiedostoon" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" @@ -2271,7 +2277,7 @@ msgstr "" #: lazarusidestrconsts.dlgscope msgid "Scope" -msgstr "" +msgstr "Ulottuvuus" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" @@ -2283,11 +2289,13 @@ msgstr "" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" -msgstr "" +msgstr "Näytä tiedoston lopussa tyhjää tilaa ('Scrollaa' lopun yli)" #: lazarusidestrconsts.dlgscrollpastendline +#, fuzzy +#| msgid "Scroll past end of line" msgid "Caret past end of line" -msgstr "" +msgstr "Kursoria liikuttaessa ('scrollatessa') ei välitetä rivinlopusta" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." @@ -2295,11 +2303,11 @@ msgstr "" #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." -msgstr "" +msgstr "Käyttäjä keskeytti hakemisen" #: lazarusidestrconsts.dlgsearchcaption msgid "Searching..." -msgstr "" +msgstr "Etsitään..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" @@ -2307,7 +2315,7 @@ msgstr "" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected Text" -msgstr "" +msgstr "Valittu teksti" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" @@ -2323,7 +2331,7 @@ msgstr "" #: lazarusidestrconsts.dlgshowcaps msgid "Show component captions" -msgstr "" +msgstr "Näytä komponenttien nimet vihjeessä" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" @@ -2352,11 +2360,11 @@ msgstr "" #: lazarusidestrconsts.dlgshowedrhints msgid "Show editor hints" -msgstr "" +msgstr "Näytä editointivihjeet" #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" -msgstr "" +msgstr "Näytä kaikki (hidas)" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" @@ -2372,20 +2380,20 @@ msgstr "" #: lazarusidestrconsts.dlgshowhint msgid "Show Hints" -msgstr "" +msgstr "Näytä vihjeet" #: lazarusidestrconsts.dlgshowlinenumbers msgctxt "lazarusidestrconsts.dlgshowlinenumbers" msgid "Show line numbers" -msgstr "" +msgstr "Näytä rivinumerot" #: lazarusidestrconsts.dlgshownotes msgid "Show Notes" -msgstr "" +msgstr "Näytä muistutukset" #: lazarusidestrconsts.dlgshownothing msgid "Show nothing (only errors)" -msgstr "" +msgstr "Näytä ainoastaan virheet" #: lazarusidestrconsts.dlgshowprocserror msgid "Show all procs on error" @@ -2397,7 +2405,7 @@ msgstr "" #: lazarusidestrconsts.dlgshowsummary msgid "Show summary" -msgstr "" +msgstr "Näytä yhteenveto" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" @@ -2409,7 +2417,7 @@ msgstr "" #: lazarusidestrconsts.dlgshowwarnings msgid "Show Warnings" -msgstr "" +msgstr "Näytä varoitukset" #: lazarusidestrconsts.dlgskipforwarddeclarations msgid "Skip forward declarations" @@ -2421,28 +2429,28 @@ msgstr "" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" -msgstr "" +msgstr "Varmistustiedoston symboli tiedoston tarkenteen loppuun (.pp~)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" -msgstr "" +msgstr "Lisätään laskijanumero (.pp;1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" -msgstr "" +msgstr "Varmistustiedoston symboli tiedoston tarkenteen eteen (.~pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" -msgstr "" +msgstr "Kiinnity kohdistusviivojen avulla" #: lazarusidestrconsts.dlgspacenotcosmos msgctxt "lazarusidestrconsts.dlgspacenotcosmos" msgid "Space" -msgstr "" +msgstr "Välilyönnit" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" -msgstr "" +msgstr "Vihjetekstit työkalupainikkeille" #: lazarusidestrconsts.dlgsrcedit msgctxt "lazarusidestrconsts.dlgsrcedit" @@ -2451,7 +2459,7 @@ msgstr "" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" -msgstr "" +msgstr "Lähtökohta" #: lazarusidestrconsts.dlgstatickeyword msgid "Static Keyword in Objects" @@ -2501,11 +2509,11 @@ msgstr "" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" -msgstr "" +msgstr "Kansio jossa käännetään testiprojektit" #: lazarusidestrconsts.dlgtexttofing msgid "&Text to Find" -msgstr "" +msgstr "Etsittävä" #: lazarusidestrconsts.dlgthedirectory msgid "The directory \"" @@ -2525,7 +2533,7 @@ msgstr "" #: lazarusidestrconsts.dlgtoppos msgid "Top:" -msgstr "" +msgstr "Ylhäältä:" #: lazarusidestrconsts.dlgtplfname msgid "Template file name" @@ -2553,7 +2561,7 @@ msgstr "" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" -msgstr "" +msgstr "Poista turhat välilyönnit rivinlopusta" #: lazarusidestrconsts.dlguncertopt msgid "Uncertain Optimizations" @@ -2565,7 +2573,7 @@ msgstr "" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo:" -msgstr "Kumoa / Palauta uudelleen:" +msgstr "Kumoa / Palauta uudelleen" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" @@ -2578,11 +2586,11 @@ msgstr "" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" -msgstr "" +msgstr "käännösyksikön (Unit) riippuvuudet" #: lazarusidestrconsts.dlgunitdeprefresh msgid "Refresh" -msgstr "" +msgstr "Päivitä" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" @@ -2595,11 +2603,11 @@ msgstr "Tallentamaton rivi" #: lazarusidestrconsts.dlgupword msgctxt "lazarusidestrconsts.dlgupword" msgid "Up" -msgstr "" +msgstr "Ylös" #: lazarusidestrconsts.dlgusecodefolding msgid "Code folding" -msgstr "" +msgstr "Koodin laskostus" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional Compiler Config File" @@ -2623,12 +2631,12 @@ msgstr "" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" -msgstr "" +msgstr "Käytä syntaksin korostusta" #: lazarusidestrconsts.dlgvaluecolor msgctxt "lazarusidestrconsts.dlgvaluecolor" msgid "Value" -msgstr "" +msgstr "Arvo" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" @@ -2636,19 +2644,19 @@ msgstr "" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" -msgstr "" +msgstr "Näytä vasen reunus" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" -msgstr "" +msgstr "Näytä oikea marginaaliviiva" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole Words Only" -msgstr "" +msgstr "Etsi vain kokonaisia sanoja" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" -msgstr "" +msgstr "Leveys:" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" @@ -2661,17 +2669,17 @@ msgstr "" #: lazarusidestrconsts.dlgwinpos msgid "Window Positions" -msgstr "" +msgstr "Ikkunoiden paikat" #: lazarusidestrconsts.dlgwordspolicies msgctxt "lazarusidestrconsts.dlgwordspolicies" msgid "Words" -msgstr "" +msgstr "Sanat" #: lazarusidestrconsts.dlgwrdpreview msgctxt "lazarusidestrconsts.dlgwrdpreview" msgid "Preview" -msgstr "" +msgstr "Esikatselu" #: lazarusidestrconsts.dlgwritefpclogo msgid "Write an FPC logo" @@ -2683,11 +2691,13 @@ msgstr "" #: lazarusidestrconsts.fdmalignword msgid "Align" -msgstr "" +msgstr "Sijoittele" #: lazarusidestrconsts.fdmdeleteselection +#, fuzzy +#| msgid "Delete selection" msgid "Delete Selection" -msgstr "" +msgstr "Poista valittu" #: lazarusidestrconsts.fdmmirrorhorizontal msgid "Mirror Horizontal" @@ -2700,31 +2710,41 @@ msgstr "" #: lazarusidestrconsts.fdmorder msgctxt "lazarusidestrconsts.fdmorder" msgid "Order" -msgstr "" +msgstr "Järjestys" #: lazarusidestrconsts.fdmorderbackone +#, fuzzy +#| msgid "Back one" msgid "Back One" -msgstr "" +msgstr "Yksi taaksepäin" #: lazarusidestrconsts.fdmorderforwardone +#, fuzzy +#| msgid "Forward one" msgid "Forward One" -msgstr "" +msgstr "Yksi eteenpäin" #: lazarusidestrconsts.fdmordermovetoback +#, fuzzy +#| msgid "Move to back" msgid "Move to Back" -msgstr "" +msgstr "Siirrä taainmaksi" #: lazarusidestrconsts.fdmordermovetofront +#, fuzzy +#| msgid "Move to front" msgid "Move to Front" -msgstr "" +msgstr "Siirrä päällimmäksi" #: lazarusidestrconsts.fdmsaveformasxml +#, fuzzy +#| msgid "Save form as xml" msgid "Save form as XML" -msgstr "" +msgstr "Tallenna lomake XML-tiedostona" #: lazarusidestrconsts.fdmscaleword msgid "Scale" -msgstr "" +msgstr "Skaalaa" #: lazarusidestrconsts.fdmselectall msgctxt "lazarusidestrconsts.fdmselectall" @@ -2733,15 +2753,15 @@ msgstr "" #: lazarusidestrconsts.fdmsizeword msgid "Size" -msgstr "" +msgstr "Koko" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" -msgstr "" +msgstr "Sijoita apupisteiden mukaan" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" -msgstr "" +msgstr "Sijoita kohdistusviivojen mukaan" #: lazarusidestrconsts.fdmtaborder msgid "Tab Order..." @@ -2757,7 +2777,7 @@ msgstr "" #: lazarusidestrconsts.lisa2paddfile msgid "Add File" -msgstr "" +msgstr "Lisää tiedosto" #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" @@ -2765,7 +2785,7 @@ msgstr "" #: lazarusidestrconsts.lisa2paddfilestopackage msgid "Add files to package" -msgstr "" +msgstr "Lisää nämä tiedostot tähän projektiin tai pakettiin" #: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" @@ -2773,11 +2793,11 @@ msgstr "" #: lazarusidestrconsts.lisa2paddtopackage msgid "Add to package" -msgstr "" +msgstr "Lisää komponenttipakettiin" #: lazarusidestrconsts.lisa2paddunit msgid "Add Unit" -msgstr "" +msgstr "Lisää käännösyksikkö(unit)" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" @@ -2842,15 +2862,15 @@ msgstr "" #: lazarusidestrconsts.lisa2pfilename msgid "File name:" -msgstr "" +msgstr "Tiedoston nimi:" #: lazarusidestrconsts.lisa2pfilename2 msgid "Filename" -msgstr "" +msgstr "Tiedoston nimi" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" -msgstr "" +msgstr "Tiedosto ei ole Pascal:n käännösyksikkö (unit)" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" @@ -2906,7 +2926,7 @@ msgstr "" #: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" -msgstr "" +msgstr "Pascal:n käännösyksikön (unit) tiedostopääte on joko .pp tai .pas" #: lazarusidestrconsts.lisa2psavefiledialog msgid "Save file dialog" @@ -2922,7 +2942,7 @@ msgstr "" #: lazarusidestrconsts.lisa2pswitchpaths msgid "Switch Paths" -msgstr "" +msgstr "Vaihda tiedostopolkua" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." @@ -3013,11 +3033,11 @@ msgstr "" #: lazarusidestrconsts.lisa2punitfilename2 msgid "Unit File Name:" -msgstr "" +msgstr "Käännösyksikön (unit) tiedostonimi:" #: lazarusidestrconsts.lisa2punitname msgid "Unit Name:" -msgstr "" +msgstr "Käännösyksikön (unit) nimi:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" @@ -3041,7 +3061,7 @@ msgstr "" #: lazarusidestrconsts.lisabortall msgid "Abort all" -msgstr "" +msgstr "Keskeytä kaikki" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" @@ -3049,7 +3069,7 @@ msgstr "" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" -msgstr "" +msgstr "Keskeytä projektin lataaminen" #: lazarusidestrconsts.lisabortwholeloading msgid "Abort whole loading" @@ -3061,11 +3081,11 @@ msgstr "" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" -msgstr "" +msgstr "Tietoja Lazarus:sta" #: lazarusidestrconsts.lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." -msgstr "" +msgstr "Lisenssi: GPL/LGPL%sLazarus on FreePascalin kehitysympäristö jolla voi tehdä (graafisia ja komentorivi) sovelluksia FreePascalille. FreePascal on (L)GPL-lisensoitu (mm oliopohjainen) Pascal kääntäjä joka toimii mm. Linux, Win32, OS/2, Mac OS X ja FreeBSD käyttöjärjestelmissä" #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." @@ -3081,7 +3101,7 @@ msgstr "" #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" -msgstr "" +msgstr "Kiitokset" #: lazarusidestrconsts.lisaction msgid "Action:" @@ -3093,7 +3113,7 @@ msgstr "" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" -msgstr "" +msgstr "Salli etsintäoperandit (mm * ja ?)" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" @@ -3121,7 +3141,7 @@ msgstr "" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" -msgstr "" +msgstr "Lisätäänkö tiedosto %s projektiin?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" @@ -3141,11 +3161,11 @@ msgstr "" #: lazarusidestrconsts.lisaf2pfiletype msgid "File Type" -msgstr "" +msgstr "Tiedoston tyyppi" #: lazarusidestrconsts.lisaf2phasregisterprocedure msgid "Has Register procedure" -msgstr "" +msgstr "Sisältää Register aliohjelman" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" @@ -3186,19 +3206,19 @@ msgstr "" #: lazarusidestrconsts.lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" -msgstr "" +msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? " #: lazarusidestrconsts.lisalignment msgid "Alignment" -msgstr "" +msgstr "Sijoita" #: lazarusidestrconsts.lisallblockslooksok msgid "All blocks looks ok." -msgstr "" +msgstr "Kaikki lohkorakenteet vaikuttavat hyviltä." #: lazarusidestrconsts.lisallfiles msgid "All Files" -msgstr "" +msgstr "Kaikki tiedostot" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" @@ -3226,7 +3246,7 @@ msgstr "" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" -msgstr "" +msgstr "Epäselvä (tai moniselitteinen) tiedosto löytyi" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" @@ -3234,7 +3254,7 @@ msgstr "" #: lazarusidestrconsts.lisambiguousfilesfound msgid "Ambiguous files found" -msgstr "" +msgstr "Epäselviä (tai moniselitteisiä) tiedostoja löytyi" #: lazarusidestrconsts.lisambiguousunitfound msgid "Ambiguous Unit found" @@ -3242,7 +3262,7 @@ msgstr "" #: lazarusidestrconsts.lisambiguousunitfound2 msgid "Ambiguous unit found" -msgstr "" +msgstr "Epäselvä (tai moniselitteinen) käännösyksikkö löytyi" #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" @@ -3274,11 +3294,11 @@ msgstr "" #: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" -msgstr "" +msgstr "Virhe esiintyi kun avattiin projektia %s!%s%sAvataanko tämä projekti uudelleen?" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." -msgstr "" +msgstr "Sovellus %sGraafinen lcl/freepascal ohjelma. Ohjelma tehdään Lazaruksella (Näistä suositeltavin vaihtoehto)." #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" @@ -3294,11 +3314,11 @@ msgstr "" #: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." -msgstr "" +msgstr "Perus Pascal-ohjelma tiedosto.%sTämä on tarkoitettu lähinnä testaamiseen.%sYleisesti olisi parempi valita jokin uusi projekti kuten esim. sovellus." #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" -msgstr "" +msgstr "Varmistetaan vielä erikseen että korvataanko kyseinen kohta" #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" @@ -3334,11 +3354,11 @@ msgstr "" #: lazarusidestrconsts.lisautomaticfeatures msgid "Automatic features" -msgstr "" +msgstr "Automaattiset ominaisuudet" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" -msgstr "" +msgstr "Näytetään automaattisesti komponenttimuokkain" #: lazarusidestrconsts.lisavailablepackages msgid "Available packages" @@ -3346,7 +3366,7 @@ msgstr "" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" -msgstr "" +msgstr "Varmuuskopiointi epäonnistui" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." @@ -3414,7 +3434,7 @@ msgstr "" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" -msgstr "" +msgstr "Alareunat" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." @@ -3445,7 +3465,7 @@ msgstr "" #: lazarusidestrconsts.lisbtncontinue msgctxt "lazarusidestrconsts.lisbtncontinue" msgid "Continue" -msgstr "" +msgstr "Jatka" #: lazarusidestrconsts.lisbtnfind msgid "&Find" @@ -3485,11 +3505,11 @@ msgstr "" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" -msgstr "" +msgstr "Perutaan uudelleen nimeäminen" #: lazarusidestrconsts.liscannotcopytoplevelcomponent msgid "Can not copy top level component." -msgstr "" +msgstr "Päätason komponenttia ei voida kopioida" #: lazarusidestrconsts.liscannotcreatefile msgid "Can not create file %s%s%s" @@ -3542,7 +3562,7 @@ msgstr "" #: lazarusidestrconsts.lisccoerrorcaption msgctxt "lazarusidestrconsts.lisccoerrorcaption" msgid "Error" -msgstr "" +msgstr "Virhe" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " @@ -3742,11 +3762,11 @@ msgstr "" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" -msgstr "" +msgstr "Keskelle ikkunaa" #: lazarusidestrconsts.liscenters msgid "Centers" -msgstr "" +msgstr "Keskilinjat" #: lazarusidestrconsts.lisceomode msgid "Preferred Exhibition Mode" @@ -3763,7 +3783,7 @@ msgstr "" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" -msgstr "" +msgstr "Ei koskaan automaattisesti. Ainoastaan erikseen käskettäessä." #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" @@ -3775,7 +3795,7 @@ msgstr "" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" -msgstr "" +msgstr "Automaattinen päivitys" #: lazarusidestrconsts.lisceothergroup msgctxt "lazarusidestrconsts.lisceothergroup" @@ -3822,7 +3842,7 @@ msgstr "Tyypit" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" -msgstr "" +msgstr "Nimeämättömät vakiot" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" @@ -3851,11 +3871,11 @@ msgstr "" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" -msgstr "" +msgstr "Muunna merkistökoodaus" #: lazarusidestrconsts.lischangefile msgid "Change file" -msgstr "" +msgstr "Muunna tiedosto" #: lazarusidestrconsts.lischangeparent msgid "Change Parent..." @@ -3867,7 +3887,7 @@ msgstr "" #: lazarusidestrconsts.lischaractermap msgid "Character Map" -msgstr "" +msgstr "Merkkitaulukko" #: lazarusidestrconsts.lischeckchangesondiskwithloading msgid "Check changes on disk with loading" @@ -3883,7 +3903,7 @@ msgstr "" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" -msgstr "" +msgstr "Valitse toisenlainen nimi" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" @@ -3895,7 +3915,7 @@ msgstr "" #: lazarusidestrconsts.lischoosecompilerpath msgid "Choose compiler filename (%s)" -msgstr "" +msgstr "Valitse kääntäjän tiedostonimi (%s)" #: lazarusidestrconsts.lischoosedebuggerpath msgid "Choose debugger filename" @@ -3911,7 +3931,7 @@ msgstr "" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" -msgstr "" +msgstr "Valitse Delphi:n tekemä unit(*.pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" @@ -3923,23 +3943,23 @@ msgstr "" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" -msgstr "" +msgstr "Valitse Lazarus:n kansio" #: lazarusidestrconsts.lischoosemakepath msgid "Choose make path" -msgstr "" +msgstr "Valitse make-työkalun hakupolku" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" -msgstr "" +msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden tiedoston" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" -msgstr "" +msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden komponenttipaketin" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" -msgstr "" +msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden ohjelmointiprojektin" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" @@ -3947,11 +3967,11 @@ msgstr "" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" -msgstr "" +msgstr "Valitse ohjelman lähdekoodi (*.pp,*.pas,*.lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" -msgstr "" +msgstr "Lisää, alla olevasta listasta valittu, rakenne. Valitun lohkon ympärille" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" @@ -3983,23 +4003,23 @@ msgstr "" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" -msgstr "" +msgstr "Ylimääräisten tiedostojen poisto" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" -msgstr "" +msgstr "Poista tiedostot myös alikansioista" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" -msgstr "" +msgstr "Säilytä kaikki tekstitiedostot" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" -msgstr "" +msgstr "Säilytettävien tiedostojen tiedostopäätteet" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" -msgstr "" +msgstr "Poistettavien tiedostojen tiedostopäätteet" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" @@ -4011,7 +4031,7 @@ msgstr "" #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" -msgstr "" +msgstr "Poistetaanko käännösyksikön tiedostopolku?" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" @@ -4023,7 +4043,7 @@ msgstr "" #: lazarusidestrconsts.lisclose msgid "&Close" -msgstr "" +msgstr "&Sulje" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" @@ -4066,7 +4086,7 @@ msgstr "" #: lazarusidestrconsts.liscocalloncompile msgctxt "lazarusidestrconsts.liscocalloncompile" msgid "Compile" -msgstr "" +msgstr "Käännä" #: lazarusidestrconsts.liscocallonrun msgctxt "lazarusidestrconsts.liscocallonrun" @@ -4080,7 +4100,7 @@ msgstr "" #: lazarusidestrconsts.liscocommand msgctxt "lazarusidestrconsts.liscocommand" msgid "Command:" -msgstr "" +msgstr "Komento:" #: lazarusidestrconsts.liscodebrowser msgid "Code browser" @@ -4225,7 +4245,7 @@ msgstr "" #: lazarusidestrconsts.liscodehelpshowemptymethods msgid "Show empty methods" -msgstr "" +msgstr "Näytä tyhjät metodit" #: lazarusidestrconsts.liscodehelpshowunusedunits msgid "Show unused units" @@ -4234,7 +4254,7 @@ msgstr "" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" -msgstr "" +msgstr "Jätä huomioonottamatta vakiot seuraavissa funktioissa" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" @@ -4248,16 +4268,16 @@ msgstr "" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" -msgstr "" +msgstr "Jätä huomioonottamatta seuravat nimettömät vakiot" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" msgid "Add" -msgstr "" +msgstr "Lisää" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" -msgstr "" +msgstr "Lisää koodilyhenne" #: lazarusidestrconsts.liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " @@ -4270,20 +4290,20 @@ msgstr "" #: lazarusidestrconsts.liscodetemplchange msgctxt "lazarusidestrconsts.liscodetemplchange" msgid "Change" -msgstr "" +msgstr "Muuta" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" -msgstr "" +msgstr "Kommentti:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" -msgstr "" +msgstr "Muokkaa koodilyhenteitä" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" msgid "Error" -msgstr "" +msgstr "Virhe" #: lazarusidestrconsts.liscodetempltoken msgid "Token:" @@ -4384,7 +4404,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefsedit msgctxt "lazarusidestrconsts.liscodetoolsdefsedit" msgid "Edit" -msgstr "" +msgstr "Muokkaa" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" @@ -4396,7 +4416,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" -msgstr "" +msgstr "Virhe luettaessa %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" @@ -4413,7 +4433,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefsexit msgctxt "lazarusidestrconsts.liscodetoolsdefsexit" msgid "Exit" -msgstr "" +msgstr "Lopeta" #: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave msgid "Exit without Save" @@ -4437,7 +4457,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" -msgstr "" +msgstr "Kansio" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" @@ -4558,7 +4578,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefsname msgctxt "lazarusidestrconsts.liscodetoolsdefsname" msgid "Name:" -msgstr "" +msgstr "Nimi:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" @@ -4663,11 +4683,11 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsdefswriteerror msgid "Write error" -msgstr "" +msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" -msgstr "" +msgstr "At (@)" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" @@ -4675,16 +4695,16 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" -msgstr "" +msgstr "Kaksoispiste (:)" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" -msgstr "" +msgstr "Pilkku (,)" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" msgid "Identifier" -msgstr "" +msgstr "Tunniste (mm muuttuja)" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" @@ -4701,7 +4721,7 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" -msgstr "" +msgstr "Numero" #: lazarusidestrconsts.liscodetoolsoptsok msgctxt "lazarusidestrconsts.liscodetoolsoptsok" @@ -4710,16 +4730,16 @@ msgstr "" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" -msgstr "" +msgstr "Piste (.)" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" -msgstr "" +msgstr "Puolipiste (;)" #: lazarusidestrconsts.liscodetoolsoptsspace msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" msgid "Space" -msgstr "" +msgstr "Välilyönnit" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" @@ -4787,7 +4807,7 @@ msgstr "" #: lazarusidestrconsts.liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" -msgstr "" +msgstr "Virhe: toimimaton kääntäjä: %s" #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" @@ -4795,7 +4815,7 @@ msgstr "" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" -msgstr "" +msgstr "Vihje: voitte asettaa kääntäjän halupolun Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehdessä" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" @@ -4807,11 +4827,11 @@ msgstr "" #: lazarusidestrconsts.liscompileroptionsforproject msgid "Compiler Options for Project: %s" -msgstr "" +msgstr "Kääntäjän optiot projektissa: %s" #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" -msgstr "" +msgstr "%s (käännetään ...)" #: lazarusidestrconsts.liscomponent msgid "Component" @@ -4823,19 +4843,19 @@ msgstr "" #: lazarusidestrconsts.liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" -msgstr "" +msgstr "Komponentin nimi (name) %s%s%s ei ole sallittu tunnus" #: lazarusidestrconsts.liscomppalfindcomponent msgid "Find component" -msgstr "" +msgstr "Etsi komponentti" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" -msgstr "" +msgstr "Avaa paketti" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" -msgstr "" +msgstr "Avaa käännösyksikkö (unit)" #: lazarusidestrconsts.liscomptest msgctxt "lazarusidestrconsts.liscomptest" @@ -4860,7 +4880,7 @@ msgstr "" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" -msgstr "" +msgstr "Vahvista seuraavat muutokset" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" @@ -4868,15 +4888,15 @@ msgstr "" #: lazarusidestrconsts.lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" -msgstr "" +msgstr "Haluatteko uudelleen muodostaa (eli kääntää) Lazaruksen?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" -msgstr "" +msgstr "Vahvista uusi komponettipakettien joukko kehitysympäristöön" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" -msgstr "" +msgstr "Komentorivisovellus" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" @@ -4889,7 +4909,7 @@ msgstr "" #: lazarusidestrconsts.liscontinue msgctxt "lazarusidestrconsts.liscontinue" msgid "Continue" -msgstr "" +msgstr "Jatka" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" @@ -4897,7 +4917,7 @@ msgstr "" #: lazarusidestrconsts.liscontributors msgid "Contributors" -msgstr "" +msgstr "Tekijät" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" @@ -4929,11 +4949,11 @@ msgstr "" #: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" -msgstr "" +msgstr "Kopio kaikki kääntäjän viestit sisältäen myös piilotetut viestit leikepöydälle" #: lazarusidestrconsts.liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" -msgstr "" +msgstr "Kopio kaikki kääntäjän viestit leikepöydälle" #: lazarusidestrconsts.liscopyerror msgid "Copy Error" @@ -4945,11 +4965,11 @@ msgstr "" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." -msgstr "" +msgstr "Kokonaisen lomakkeen (form) kopioiti ei ole tuettuna." #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" -msgstr "" +msgstr "Kopio valitut kääntäjän viestit leikepöydälle" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" @@ -5005,11 +5025,11 @@ msgstr "" #: lazarusidestrconsts.liscpopenpackage msgid "Open Package %s" -msgstr "" +msgstr "Avaa komponenttipaketti %s" #: lazarusidestrconsts.liscpopenunit msgid "Open Unit %s" -msgstr "" +msgstr "Avaa käännösyksikkö %s" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" @@ -5033,7 +5053,7 @@ msgstr "" #: lazarusidestrconsts.liscreatenewproject msgid "Create new project" -msgstr "" +msgstr "Luodaan uusi projekti" #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" @@ -5069,7 +5089,7 @@ msgstr "" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" -msgstr "" +msgstr "Lyhenteet" #: lazarusidestrconsts.lisctinsertmacro msgid "Insert Macro" @@ -5109,7 +5129,7 @@ msgstr "" #: lazarusidestrconsts.liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." -msgstr "" +msgstr "Erikoisohjelma%sFreepascal ohjelma." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" @@ -5117,19 +5137,19 @@ msgstr "" #: lazarusidestrconsts.lisdate msgid "Date" -msgstr "" +msgstr "Olla peräisin" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" -msgstr "" +msgstr "Virheenjäljitintä (debugger) ei ole valittu" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" -msgstr "" +msgstr "Merkitse tämä kuitenkin keskeyskohdaksi" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." -msgstr "" +msgstr "Kun virheenjäljitintä (debugger) ei ole valittu niin keskeytyskohdalla (breakpoint) ei ole vaikutusta ennenkuin 'Käyttöliittymä'-valikon 'Virheenjäljittimen asetus'-kohtaan on asetettu virheenjäjitin." #: lazarusidestrconsts.lisdebuggererror msgid "Debugger error" @@ -5308,7 +5328,7 @@ msgstr "" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" -msgstr "" +msgstr "Poistetaanko kaikki nämä tiedostot?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" @@ -5332,11 +5352,11 @@ msgstr "" #: lazarusidestrconsts.lisdeleteoldfile msgid "Delete old file %s%s%s?" -msgstr "" +msgstr "Poistetaanko %s%s%s-niminen vanha fiedosto?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" -msgstr "" +msgstr "Poistetaanko vanha tiedosto?" #: lazarusidestrconsts.lisdeleteselectedfiles msgid "Delete selected files" @@ -5376,47 +5396,47 @@ msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" -msgstr "" +msgstr "Kirjaimen koolla ei väliä" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" -msgstr "" +msgstr "Jätä huomiotta tyhjät rivit" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" -msgstr "" +msgstr "Jätä huomiotta erilaiset rivinloppumerkinnät (esim. #10 = #13#10)" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" -msgstr "" +msgstr "Jätä huomiotta välilyöntien määrä merkkien välissä " #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" -msgstr "" +msgstr "Jätä välilyönnit huomiotta (ei koske tyhjiä rivejä)" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" -msgstr "" +msgstr "Jätä huomiotta välilyönnit rivin lopussa" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" -msgstr "" +msgstr "Jätä huomiotta välilyönnit rivin alussa" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" -msgstr "" +msgstr "Ainoastaan valittu osa" #: lazarusidestrconsts.lisdiffdlgopendiffineditor msgid "Open Diff in editor" -msgstr "" +msgstr "Avaa eroavuudet editorissa" #: lazarusidestrconsts.lisdiffdlgtext1 msgid "Text1" -msgstr "" +msgstr "Teksti 1" #: lazarusidestrconsts.lisdiffdlgtext2 msgid "Text2" -msgstr "" +msgstr "Teksti 2" #: lazarusidestrconsts.lisdigits msgid "Digits:" @@ -5424,7 +5444,7 @@ msgstr "" #: lazarusidestrconsts.lisdirectives msgid "Directives" -msgstr "" +msgstr "Ohjeet kääntäjälle" #: lazarusidestrconsts.lisdisableallinsamesource msgid "Disable All in same source" @@ -5444,15 +5464,15 @@ msgstr "" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" -msgstr "" +msgstr "Hylkää muutokset" #: lazarusidestrconsts.lisdiskdiffchangedfiles msgid "Changed files:" -msgstr "" +msgstr "Muuttuneet tiedostot:" #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" -msgstr "" +msgstr "Klikkaa jotain ylläolevaa kohtaa nähdäksesi muuttuneet kohdat" #: lazarusidestrconsts.lisdiskdifferrorreadingfile msgid "Error reading file: %s" @@ -5460,19 +5480,19 @@ msgstr "" #: lazarusidestrconsts.lisdiskdiffignorediskchanges msgid "Ignore disk changes" -msgstr "" +msgstr "Jätä huomiotta tallennetun version muutokset" #: lazarusidestrconsts.lisdiskdiffrevertall msgid "Reload from disk" -msgstr "" +msgstr "Hae tallennettuna oleva versio" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" -msgstr "" +msgstr "Seuraava tiedosto on muuttunut (seuraavat tiedostot ovat muuttuneet):" #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" -msgstr "" +msgstr "Erottelee pienet ja isot kirjaimet (esim. A ja a )" #: lazarusidestrconsts.lisdocumentationeditor msgid "Documentation Editor" @@ -5484,7 +5504,7 @@ msgstr "" #: lazarusidestrconsts.lisdonotclosetheide msgid "Do not close the IDE" -msgstr "" +msgstr "Ei sittenkään suljeta Lazarusta" #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" @@ -5548,7 +5568,7 @@ msgstr "" #: lazarusidestrconsts.lisedoptschoosescheme msgid "Choose Scheme" -msgstr "" +msgstr "Valitse näppäinkaavio" #: lazarusidestrconsts.lisedtdefallpackages msgid "All packages" @@ -5638,7 +5658,7 @@ msgstr "" #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" -msgstr "" +msgstr "Muokkaa työkalua" #: lazarusidestrconsts.lisedtexttoolinsert msgid "Insert" @@ -5654,11 +5674,11 @@ msgstr "" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" -msgstr "" +msgstr "Parametrit:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" -msgstr "" +msgstr "Ohjelman tiedostonimi" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" @@ -5683,19 +5703,19 @@ msgstr "" #: lazarusidestrconsts.lisemdall msgid "All" -msgstr "" +msgstr "Kaikki" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" -msgstr "" +msgstr "Tyhjät metodit (luokan tyhjät aliohjelmarungot)" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" -msgstr "" +msgstr "Löydetyt tyhjät metodit:" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" -msgstr "" +msgstr "Vain published" #: lazarusidestrconsts.lisemdpublic msgid "Public" @@ -5707,11 +5727,11 @@ msgstr "" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" -msgstr "" +msgstr "Poista metodit" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" -msgstr "" +msgstr "Haetaan näistä luokan (class) osista:" #: lazarusidestrconsts.lisenableall msgid "&Enable All" @@ -5728,7 +5748,7 @@ msgstr "" #: lazarusidestrconsts.lisenabled msgctxt "lazarusidestrconsts.lisenabled" msgid "Enabled" -msgstr "" +msgstr "Sallittu" #: lazarusidestrconsts.lisenablegroup msgid "Enable Group" @@ -5740,7 +5760,7 @@ msgstr "" #: lazarusidestrconsts.lisenclose msgid "Enclose" -msgstr "" +msgstr "Lisää lauserakenne" #: lazarusidestrconsts.lisencloseselection msgctxt "lazarusidestrconsts.lisencloseselection" @@ -5755,7 +5775,7 @@ msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2 msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." -msgstr "" +msgstr "Merkistö on tiedostossa %s%s%s%skoodattu %s-koodauksella. Muunnetaanko tiedoston uudeksi merkistön koodaukseksi %s." #: lazarusidestrconsts.lisentertransla msgid "Enter translation language" @@ -5771,11 +5791,11 @@ msgstr "" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" -msgstr "" +msgstr "Kansiota ei löytynyt" #: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." -msgstr "" +msgstr "FPC:n (FreePascal:n) lähdekoodin kansiota \"%s\" ei löytynyt." #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" @@ -5783,7 +5803,7 @@ msgstr "Kääntäjän tiedostonimi on virheellinen" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." -msgstr "" +msgstr "Kääntäjän tiedosto \"%s\" ei ole ajettavissa." #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" @@ -5795,11 +5815,11 @@ msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." -msgstr "" +msgstr "Kansio \"%s\" ei vaikuta FreePascalin lähdekoodin kansiolta! Senhän pitäisi sisältää sellaisia kansioita kuten rtl, packages, compiler jne." #: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." -msgstr "" +msgstr "Kansio \"%s\" ei vaikuta Lazarus:n kansiolta! Senhän pitäisi sisältää mm seuraavia kansioita kuten lcl, debugger, designer, components jne." #: lazarusidestrconsts.lisenvoptdlginvalidmakefilename msgid "Invalid make filename" @@ -5811,11 +5831,11 @@ msgstr "" #: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." -msgstr "" +msgstr "Lazarus:n kansiota \"%s\" ei löytynyt." #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." -msgstr "" +msgstr "Testiprojektien kansiota \"%s\" ei löytynyt. " #: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" @@ -5840,7 +5860,7 @@ msgstr "" #: lazarusidestrconsts.liserror msgid "Error: " -msgstr "" +msgstr "Virhe: " #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" @@ -5872,11 +5892,11 @@ msgstr "" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" -msgstr "" +msgstr "Virhe siirrettäessä komponenttia" #: lazarusidestrconsts.liserrormovingcomponent2 msgid "Error moving component %s:%s" -msgstr "" +msgstr "Virhe siirrettäessä %s:%s komponenttia" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" @@ -5905,7 +5925,7 @@ msgstr "" #: lazarusidestrconsts.liserrors msgctxt "lazarusidestrconsts.liserrors" msgid "Errors" -msgstr "" +msgstr "Virheet" #: lazarusidestrconsts.liserrorsavingto msgid "Error saving %s to%s%s%s%s" @@ -5969,11 +5989,11 @@ msgstr "" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" -msgstr "" +msgstr "Ohjelman suoritus on pysäytetty" #: lazarusidestrconsts.lisexecutionstoppedon msgid "Execution stopped%s" -msgstr "" +msgstr "Ohjelman suoritus on pysäytetty%s" #: lazarusidestrconsts.lisexeprograms msgid "Programs" @@ -6009,11 +6029,11 @@ msgstr "" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" -msgstr "" +msgstr "Laajennetaanko käännösyksikön tiedostopolkua?" #: lazarusidestrconsts.lisextract msgid "Extract" -msgstr "" +msgstr "Tee aliohjelma" #: lazarusidestrconsts.lisextractprocedure msgctxt "lazarusidestrconsts.lisextractprocedure" @@ -6022,7 +6042,7 @@ msgstr "" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External tools" -msgstr "" +msgstr "Ulkopuoliset työkalut" #: lazarusidestrconsts.lisexttoolfailedtoruntool msgid "Failed to run tool" @@ -6035,16 +6055,16 @@ msgstr "" #: lazarusidestrconsts.lisexttoolmovedown msgctxt "lazarusidestrconsts.lisexttoolmovedown" msgid "Down" -msgstr "" +msgstr "Alas" #: lazarusidestrconsts.lisexttoolmoveup msgctxt "lazarusidestrconsts.lisexttoolmoveup" msgid "Up" -msgstr "" +msgstr "Ylös" #: lazarusidestrconsts.lisexttoolremove msgid "Remove" -msgstr "" +msgstr "Poista" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." @@ -6064,7 +6084,7 @@ msgstr "" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" -msgstr "" +msgstr "Vähennä näytön päivittämistä" #: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" @@ -6073,12 +6093,12 @@ msgstr "" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "" +msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2 msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" -msgstr "" +msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" @@ -6090,11 +6110,11 @@ msgstr "" #: lazarusidestrconsts.lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" -msgstr "Tiedosto %s%s%s on muuttunut. Talletetaanko?" +msgstr "Tiedeosto %s%s%s on muuttunut. Talletetaanko?" #: lazarusidestrconsts.lisfileisnotwritable msgid "File is not writable" -msgstr "" +msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.lisfileissymlink msgid "File is symlink" @@ -6114,15 +6134,15 @@ msgstr "" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" -msgstr "" +msgstr "Tiedostoa ei löytynyt" #: lazarusidestrconsts.lisfilenotfound2 msgid "File %s%s%s not found.%s" -msgstr "" +msgstr "Tiedostoa %s%s%s ei löytynyt.%s" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" -msgstr "" +msgstr "Tiedostoa %s%s%s ei löytynyt.%sHaluatko luoda sen?%s" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" @@ -6130,11 +6150,11 @@ msgstr "" #: lazarusidestrconsts.lisfilenottext msgid "File not text" -msgstr "" +msgstr "Tiedosto ei ole tekstitiedosto" #: lazarusidestrconsts.lisfilesettings msgid "File Settings ..." -msgstr "" +msgstr "Tiedoston asetukset ..." #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" @@ -6162,19 +6182,19 @@ msgstr "" #: lazarusidestrconsts.lisfindfilecasesensitive msgid "&Case sensitive" -msgstr "" +msgstr "Sama kirjainkoko" #: lazarusidestrconsts.lisfindfiledirectoryoptions msgid "Directory options" -msgstr "" +msgstr "Kansion lisäasetukset" #: lazarusidestrconsts.lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" -msgstr "" +msgstr "Tiedostojen suodatus/maskaus (*;*.*;*.bak?)" #: lazarusidestrconsts.lisfindfileincludesubdirectories msgid "Include sub directories" -msgstr "" +msgstr "Sisällytetään myös alikansiot " #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" @@ -6186,11 +6206,11 @@ msgstr "" #: lazarusidestrconsts.lisfindfileregularexpressions msgid "&Regular expressions" -msgstr "" +msgstr "Säännölliset lausekkeet" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "search all files in &project" -msgstr "" +msgstr "Hae projektin kaikista tiedostoista" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "search all &open files" @@ -6198,19 +6218,19 @@ msgstr "Hae kaikista avoinna olevista tiedostoista" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "search in &directories" -msgstr "" +msgstr "Etsi kansioista" #: lazarusidestrconsts.lisfindfiletexttofind msgid "Text to find:" -msgstr "" +msgstr "Etsittävä teksti:" #: lazarusidestrconsts.lisfindfilewhere msgid "Where" -msgstr "" +msgstr "Mistä" #: lazarusidestrconsts.lisfindfilewholewordsonly msgid "&Whole words only" -msgstr "" +msgstr "Etsi vain kokonaisia sanoja" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" @@ -6222,7 +6242,7 @@ msgstr "" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" -msgstr "" +msgstr "LFM tiedoston korjaus" #: lazarusidestrconsts.lisfloatingpoin msgid "Floating Point" @@ -6230,7 +6250,7 @@ msgstr "" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" -msgstr "" +msgstr "Kaikesta huolimatta nimetään näin" #: lazarusidestrconsts.lisform msgid "Form" @@ -6251,7 +6271,7 @@ msgstr "" #: lazarusidestrconsts.lisfpcomponents msgctxt "lazarusidestrconsts.lisfpcomponents" msgid "Components" -msgstr "" +msgstr "Komponentit" #: lazarusidestrconsts.lisfpcsourcedirectoryerror msgid "FPC Source Directory error" @@ -6272,7 +6292,7 @@ msgstr "" #: lazarusidestrconsts.lisfpfindpalettecomponent msgid "Find palette component" -msgstr "" +msgstr "Etsi komponenttipaletista komponentti" #: lazarusidestrconsts.lisframe msgid "Frame" @@ -6280,7 +6300,7 @@ msgstr "" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" -msgstr "" +msgstr "Taaksepäin" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" @@ -6292,7 +6312,7 @@ msgstr "" #: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." -msgstr "" +msgstr "FreePascal ohjelma joka käyttää TCustomApplication luokkaa. Sillä on helppo tarkastaa komentoriviltä annetut parametrit ja poikkeukset. Ohjelman tekoa hallitaan Lazaruksella." #: lazarusidestrconsts.lisfreepascalsourcedirectory msgid "Freepascal source directory" @@ -6308,23 +6328,23 @@ msgstr "FreePascalin lähdekoodeja ei löytynyt" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" -msgstr "" +msgstr "Eteenpäin" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" -msgstr "" +msgstr "Laajennetaan toiminta koskemaan myös näihin tiedostoihin (esim. /path/*.pas;/path2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" -msgstr "" +msgstr "Etsi tai vaihda tunnisteiden nimiä" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" -msgstr "" +msgstr "Etsi tunnisteet" #: lazarusidestrconsts.lisfriidentifier msgid "Identifier: %s" -msgstr "" +msgstr "Tunniste on: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" @@ -6332,11 +6352,11 @@ msgstr "" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" -msgstr "" +msgstr "vain käytössä oleva lähdekoodiyksikkö (unit)" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" -msgstr "" +msgstr "kaikista tämän projektin tiedostoista" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" @@ -6348,23 +6368,23 @@ msgstr "" #: lazarusidestrconsts.lisfrirename msgid "Rename" -msgstr "" +msgstr "Nimeä uudelleen" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" -msgstr "" +msgstr "Uudelleen nimeä kaikki tunnisteet" #: lazarusidestrconsts.lisfrirenameto msgid "Rename to" -msgstr "" +msgstr "Uusi nimi on" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" -msgstr "" +msgstr "Käy kommentit myöskin läpi" #: lazarusidestrconsts.lisfrisearchwhere msgid "Search where" -msgstr "" +msgstr "Mistä etsitään" #: lazarusidestrconsts.lisfunction msgid "Function" @@ -6400,7 +6420,7 @@ msgstr "" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" -msgstr "" +msgstr "Ohjeen valinta" #: lazarusidestrconsts.lishexadecimal msgid "Hexadecimal" @@ -6412,12 +6432,12 @@ msgstr "" #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." -msgstr "" +msgstr "Vihje: Tarkista sisältääkö kaksi eri komponenttipakettia käännösyksikön samalla nimellä." #: lazarusidestrconsts.lishintopen msgctxt "lazarusidestrconsts.lishintopen" msgid "Open" -msgstr "" +msgstr "Avaa" #: lazarusidestrconsts.lishintpause msgctxt "lazarusidestrconsts.lishintpause" @@ -6436,7 +6456,7 @@ msgstr "" #: lazarusidestrconsts.lishintsaveall msgid "Save all" -msgstr "" +msgstr "Tallenna kaikki" #: lazarusidestrconsts.lishintstepinto msgid "Step Into" @@ -6449,7 +6469,7 @@ msgstr "" #: lazarusidestrconsts.lishintstop msgctxt "lazarusidestrconsts.lishintstop" msgid "Stop" -msgstr "" +msgstr "Pysäytä" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." @@ -6461,15 +6481,15 @@ msgstr "" #: lazarusidestrconsts.lishinttoggleformunit msgid "Toggle Form/Unit" -msgstr "" +msgstr "Siirry lomakkeen ja käännösyksikön välillä" #: lazarusidestrconsts.lishintviewforms msgid "View Forms" -msgstr "" +msgstr "Näytä lomakkeet" #: lazarusidestrconsts.lishintviewunits msgid "View Units" -msgstr "" +msgstr "Näytä käännösyksiköt (Unit)" #: lazarusidestrconsts.lishitcount msgid "Hitcount" @@ -6481,7 +6501,7 @@ msgstr "" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" -msgstr "" +msgstr "Ohjeen asetukset" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" @@ -6497,7 +6517,7 @@ msgstr "" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" -msgstr "" +msgstr "Vaakasuunta" #: lazarusidestrconsts.liside msgid "IDE" @@ -6578,7 +6598,7 @@ msgstr "" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" -msgstr "" +msgstr "Ohita kaikki" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" @@ -6594,7 +6614,7 @@ msgstr "" #: lazarusidestrconsts.lisignoremissingfile msgid "Ignore missing file" -msgstr "" +msgstr "Jätä huomiotta puuttuva tiedosto" #: lazarusidestrconsts.lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" @@ -6631,11 +6651,11 @@ msgstr "" #: lazarusidestrconsts.lisinfobuildcaption msgid "Compile Project" -msgstr "" +msgstr "Tietoja projektin käännöksestä" #: lazarusidestrconsts.lisinfobuildcomplile msgid "Compiling..." -msgstr "" +msgstr "Käännetään..." #: lazarusidestrconsts.lisinfobuilderror msgid "Error..." @@ -6643,37 +6663,37 @@ msgstr "" #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" -msgstr "" +msgstr "Virheitä:" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" -msgstr "" +msgstr "Vihjeitä:" #: lazarusidestrconsts.lisinfobuildlines msgctxt "lazarusidestrconsts.lisinfobuildlines" msgid "Lines:" -msgstr "" +msgstr "Rivejä:" #: lazarusidestrconsts.lisinfobuildmakeabort msgctxt "lazarusidestrconsts.lisinfobuildmakeabort" msgid "Abort" -msgstr "" +msgstr "Keskeytä" #: lazarusidestrconsts.lisinfobuildnote msgid "Notes:" -msgstr "" +msgstr "Huomioita:" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success..." -msgstr "" +msgstr "Kääntäminen onnistui..." #: lazarusidestrconsts.lisinfobuildwarning msgid "Warnings:" -msgstr "" +msgstr "Varoituksia:" #: lazarusidestrconsts.lisinformationaboutunit msgid "Information about %s" -msgstr "" +msgstr "Tietoja %s tiedostosta" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" @@ -6754,7 +6774,7 @@ msgstr "" #: lazarusidestrconsts.lisinstallationfailed msgid "Installation failed" -msgstr "" +msgstr "Asennus epäonnistui" #: lazarusidestrconsts.lisinstalledpackages msgid "Installed Packages" @@ -6830,11 +6850,11 @@ msgstr "" #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" -msgstr "" +msgstr "Vääränlainen aliohjelman nimi" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" -msgstr "" +msgstr "Vääränlainen projektitiedoston nimi" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" @@ -6842,15 +6862,15 @@ msgstr "" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" -msgstr "" +msgstr "Vääränlainen valinta" #: lazarusidestrconsts.lisisalreadypartoftheproject msgid "%s is already part of the Project." -msgstr "" +msgstr "%s on jo osa projektia." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" -msgstr "" +msgstr "%s%s%s on vääränlainen projektin tiedostonimi.%sOle hyvä ja valitse joku muu (esim. projekti1.lpi)" #: lazarusidestrconsts.lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." @@ -6862,11 +6882,11 @@ msgstr "" #: lazarusidestrconsts.liskeepname msgid "Keep name" -msgstr "" +msgstr "Hyväksy nimi tälläisenään" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" -msgstr "" +msgstr "Pidä ne ja jatka" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" @@ -6906,7 +6926,7 @@ msgstr "" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" -msgstr "" +msgstr "Valitse näppäinkaavio" #: lazarusidestrconsts.liskmclassic msgid "Classic" @@ -6914,11 +6934,11 @@ msgstr "" #: lazarusidestrconsts.liskmcloseall msgid "Close All" -msgstr "" +msgstr "Sulje kaikki" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" -msgstr "" +msgstr "Sulje projekti" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" @@ -6930,7 +6950,7 @@ msgstr "" #: lazarusidestrconsts.liskmcompileroptions msgid "Compiler options" -msgstr "" +msgstr "Kääntäjän optioasetukset" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config %sBuild File%s" @@ -7180,19 +7200,19 @@ msgstr "" #: lazarusidestrconsts.liskmsaveall msgid "SaveAll" -msgstr "" +msgstr "Tallenna kaikki" #: lazarusidestrconsts.liskmsaveas msgid "SaveAs" -msgstr "" +msgstr "Tallenna nimellä" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" -msgstr "" +msgstr "Tallenna projekti" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" -msgstr "" +msgstr "Tallenna projekti nimellä" #: lazarusidestrconsts.liskmselectlineend msgid "Select line end" @@ -7376,7 +7396,7 @@ msgstr "" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" -msgstr "" +msgstr "Näytä käännösyksikön (Unit) tietoja" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" @@ -7432,7 +7452,7 @@ msgstr "" #: lazarusidestrconsts.lislazaruspackage msgid "Lazarus package" -msgstr "" +msgstr "Lazarus komponenttipakettitiedostot" #: lazarusidestrconsts.lislazarusproject msgid "Lazarus project" @@ -7507,7 +7527,7 @@ msgstr "" #: lazarusidestrconsts.lislazbuildcancel msgctxt "lazarusidestrconsts.lislazbuildcancel" msgid "Cancel" -msgstr "" +msgstr "Peru" #: lazarusidestrconsts.lislazbuildcleanall msgid "Clean all" @@ -7652,7 +7672,7 @@ msgstr "" #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" msgid "Left" -msgstr "" +msgstr "Vasen" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." @@ -7668,7 +7688,7 @@ msgstr "" #: lazarusidestrconsts.lisleftsides msgid "Left sides" -msgstr "" +msgstr "Vasemmat reunat" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" @@ -7680,11 +7700,11 @@ msgstr "" #: lazarusidestrconsts.lislevels msgid "Levels" -msgstr "" +msgstr "Tasot" #: lazarusidestrconsts.lislfmfile msgid "LFM file" -msgstr "" +msgstr "LFM tiedosto" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" @@ -7704,7 +7724,7 @@ msgstr "" #: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." -msgstr "" +msgstr "Kirjasto%sFreePascal kirjasto (.dll windows:ssa, .so linux:ssa, .dylib MacOSX:ssa). Kirjaston lähdekoodia hallitaan Lazarus:lla." #: lazarusidestrconsts.lislibrarypath msgid "library path" @@ -7750,7 +7770,7 @@ msgstr "" #: lazarusidestrconsts.lislocalsdlgvalue msgctxt "lazarusidestrconsts.lislocalsdlgvalue" msgid "Value" -msgstr "" +msgstr "Arvo" #: lazarusidestrconsts.lislogmessage msgid "Log message" @@ -7782,15 +7802,15 @@ msgstr "" #: lazarusidestrconsts.lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" -msgstr "" +msgstr "Pääohjelmassa on Application.CreateForm -lause tai -lauseet" #: lazarusidestrconsts.lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" -msgstr "" +msgstr "Pääohjelmassa on Application.Title -lause" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" -msgstr "" +msgstr "Pääohjelman Uses -esittelyosassa on kaikki projektin käännösyksiköt (eli unitit)" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main Unit is Pascal Source" @@ -7827,7 +7847,7 @@ msgstr "" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" msgid "Identifier" -msgstr "" +msgstr "Tunniste (mm muuttuja)" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" @@ -7899,11 +7919,11 @@ msgstr "" #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add jump point to history" -msgstr "" +msgstr "Lisää hyppy historia" #: lazarusidestrconsts.lismenuaddtoproject msgid "Add editor file to Project" -msgstr "" +msgstr "Lisää editorin tiedosto projektiin" #: lazarusidestrconsts.lismenuaddwatch msgid "Add watch ..." @@ -7916,11 +7936,11 @@ msgstr "" #: lazarusidestrconsts.lismenubuild msgctxt "lazarusidestrconsts.lismenubuild" msgid "Build" -msgstr "" +msgstr "Käännä" #: lazarusidestrconsts.lismenubuildall msgid "Build all" -msgstr "" +msgstr "Käännä kaikki" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" @@ -7936,20 +7956,22 @@ msgstr "" #: lazarusidestrconsts.lismenucleandirectory msgid "Clean directory ..." -msgstr "" +msgstr "Ylimääräisten tiedostojen poisto ..." #: lazarusidestrconsts.lismenuclose msgctxt "lazarusidestrconsts.lismenuclose" msgid "Close" -msgstr "" +msgstr "Sulje" #: lazarusidestrconsts.lismenucloseall +#, fuzzy +#| msgid "Close all editor files" msgid "Close a&ll editor files" -msgstr "" +msgstr "Sulje kaikki editorin tiedostot" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" -msgstr "" +msgstr "Sulje projekti" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." @@ -7961,20 +7983,20 @@ msgstr "" #: lazarusidestrconsts.lismenucommentselection msgid "Comment selection" -msgstr "" +msgstr "Laita lohko kommentiksi (//)" #: lazarusidestrconsts.lismenucompileroptions msgid "Compiler Options ..." -msgstr "" +msgstr "Kääntäjän optiot ..." #: lazarusidestrconsts.lismenucompletecode msgctxt "lazarusidestrconsts.lismenucompletecode" msgid "Complete Code" -msgstr "" +msgstr "Täydennä koodia" #: lazarusidestrconsts.lismenuconditionalselection msgid "Insert $IFDEF..." -msgstr "" +msgstr "Ehdollinen kääntäminen" #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." @@ -7986,7 +8008,7 @@ msgstr "" #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." -msgstr "" +msgstr "Muokkaa ulkopuolisia työkaluja ..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." @@ -7994,7 +8016,7 @@ msgstr "" #: lazarusidestrconsts.lismenuconfigurehelp msgid "Configure Help ..." -msgstr "" +msgstr "Ohjeen asetukset ..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" @@ -8002,19 +8024,19 @@ msgstr "" #: lazarusidestrconsts.lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." -msgstr "" +msgstr "Muunna tiedosto: DPK -> LPK ..." #: lazarusidestrconsts.lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." -msgstr "" +msgstr "Muunna tiedosto: DPR -> LPR ..." #: lazarusidestrconsts.lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." -msgstr "" +msgstr "Muunna tiedosto: Delphi unit -> Lazarus unit ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm msgid "Convert DFM file to LFM ..." -msgstr "" +msgstr "Muunna tiedosto: DFM -> LFM ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." @@ -8023,7 +8045,7 @@ msgstr "" #: lazarusidestrconsts.lismenucopy msgctxt "lazarusidestrconsts.lismenucopy" msgid "Copy" -msgstr "" +msgstr "Kopioi" #: lazarusidestrconsts.lismenucreatefpdocfiles msgid "Create FPDoc files" @@ -8036,7 +8058,7 @@ msgstr "" #: lazarusidestrconsts.lismenucut msgctxt "lazarusidestrconsts.lismenucut" msgid "Cut" -msgstr "" +msgstr "Leikkaa" #: lazarusidestrconsts.lismenudebugwindows msgid "Debug windows" @@ -8045,15 +8067,15 @@ msgstr "" #: lazarusidestrconsts.lismenudiff msgctxt "lazarusidestrconsts.lismenudiff" msgid "Diff" -msgstr "" +msgstr "Eroavuudet" #: lazarusidestrconsts.lismenuedit msgid "&Edit" -msgstr "" +msgstr "&Muokkaa" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." -msgstr "" +msgstr "Koodilyhenteet ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" @@ -8066,11 +8088,11 @@ msgstr "" #: lazarusidestrconsts.lismenueditorcancel msgctxt "lazarusidestrconsts.lismenueditorcancel" msgid "Cancel" -msgstr "" +msgstr "Peru" #: lazarusidestrconsts.lismenueditorcreatesubmenu msgid "Create Submenu" -msgstr "" +msgstr "Luo alivalikko" #: lazarusidestrconsts.lismenueditordeletefromtemplate msgid "Delete From Template..." @@ -8078,7 +8100,7 @@ msgstr "" #: lazarusidestrconsts.lismenueditordeleteitem msgid "Delete Item" -msgstr "" +msgstr "Poista valikon kohta" #: lazarusidestrconsts.lismenueditorhandleonclickevent msgid "Handle OnClick Event" @@ -8086,27 +8108,27 @@ msgstr "" #: lazarusidestrconsts.lismenueditorinsertfromtemplate msgid "Insert From Template..." -msgstr "" +msgstr "Lisää valmiista malleista..." #: lazarusidestrconsts.lismenueditorinsertnewitemafter msgid "Insert New Item (after)" -msgstr "" +msgstr "Lisää uusi valikon kohta (jälkeen)" #: lazarusidestrconsts.lismenueditorinsertnewitembefore msgid "Insert New Item (before)" -msgstr "" +msgstr "Lisää uusi valikon kohta (eteen)" #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" -msgstr "" +msgstr "Valikkomuokkain" #: lazarusidestrconsts.lismenueditormovedown msgid "Move Down (or right)" -msgstr "" +msgstr "Siirrä alaspäin (tai oikeallepäin)" #: lazarusidestrconsts.lismenueditormoveup msgid "Move Up (or left)" -msgstr "" +msgstr "Siirrä ylöspäin (tai vasemmallepäin)" #: lazarusidestrconsts.lismenueditornewtemplatedescription msgid "New Template Description..." @@ -8118,23 +8140,23 @@ msgstr "" #: lazarusidestrconsts.lismenueditorselectmenu msgid "Select Menu:" -msgstr "" +msgstr "Valitse muokattava valikko (menu)" #: lazarusidestrconsts.lismenueditorselecttemplate msgid "Select Template:" -msgstr "" +msgstr "Valitse valmis malli:" #: lazarusidestrconsts.lismenueditortemplatepreview msgid "Template Preview" -msgstr "" +msgstr "Mallin esikatselu" #: lazarusidestrconsts.lismenuencloseselection msgid "Enclose selection ..." -msgstr "" +msgstr "Lauserakenteen lisäys ..." #: lazarusidestrconsts.lismenuenvironent msgid "E&nvironment" -msgstr "" +msgstr "Käyttöliittymä" #: lazarusidestrconsts.lismenuevaluate msgid "Evaluate/Modify ..." @@ -8142,48 +8164,48 @@ msgstr "" #: lazarusidestrconsts.lismenuextractproc msgid "Extract procedure ..." -msgstr "" +msgstr "Tee valitusta lohkosta aliohjelma ..." #: lazarusidestrconsts.lismenufile msgid "&File" -msgstr "" +msgstr "&Tiedosto" #: lazarusidestrconsts.lismenufind msgctxt "lazarusidestrconsts.lismenufind" msgid "Find" -msgstr "" +msgstr "Etsi" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." -msgstr "" +msgstr "Etsi" #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find other end of code block" -msgstr "" +msgstr "Mene koodilohkon toiseen päähän (begin <-> end)" #: lazarusidestrconsts.lismenufindcodeblockstart msgid "Find code block start" -msgstr "" +msgstr "Etsi koodilohkon alku" #: lazarusidestrconsts.lismenufinddeclarationatcursor msgid "Find Declaration at cursor" -msgstr "" +msgstr "Etsi kohdistimen osoittaman kohdan määrittely" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." -msgstr "" +msgstr "Etsi tunnisteiden nimiä ..." #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in files ..." -msgstr "" +msgstr "Etsi tiedostoista ..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" -msgstr "" +msgstr "Etsi &Seuraava" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" -msgstr "" +msgstr "Etsi &Edellinen" #: lazarusidestrconsts.lismenufpdoceditor msgctxt "lazarusidestrconsts.lismenufpdoceditor" @@ -8192,7 +8214,7 @@ msgstr "" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." -msgstr "" +msgstr "Asetukset ..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" @@ -8200,7 +8222,7 @@ msgstr "" #: lazarusidestrconsts.lismenugotoline msgid "Goto line ..." -msgstr "" +msgstr "Hyppää riville ..." #: lazarusidestrconsts.lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" @@ -8212,7 +8234,7 @@ msgstr "" #: lazarusidestrconsts.lismenuhelp msgid "&Help" -msgstr "" +msgstr "&Ohje" #: lazarusidestrconsts.lismenuideinternals msgid "IDE internals" @@ -8220,11 +8242,11 @@ msgstr "" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" -msgstr "" +msgstr "Etsi kirjain kerrallaan" #: lazarusidestrconsts.lismenuindentselection msgid "Indent selection" -msgstr "" +msgstr "Sisennä valittu lohko" #: lazarusidestrconsts.lismenuinsertchangelogentry msgid "ChangeLog entry" @@ -8232,7 +8254,7 @@ msgstr "" #: lazarusidestrconsts.lismenuinsertcharacter msgid "Insert from Character Map" -msgstr "" +msgstr "Lisää merkkitaulukosta" #: lazarusidestrconsts.lismenuinsertcvskeyword msgid "CVS keyword" @@ -8240,11 +8262,11 @@ msgstr "" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current date and time" -msgstr "" +msgstr "Päivämäärä ja aika" #: lazarusidestrconsts.lismenuinsertgeneral msgid "General" -msgstr "" +msgstr "Yleistä" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL notice" @@ -8260,11 +8282,11 @@ msgstr "" #: lazarusidestrconsts.lismenuinserttext msgid "Insert text" -msgstr "" +msgstr "Lisää seuraava teksti" #: lazarusidestrconsts.lismenuinsertusername msgid "Current username" -msgstr "" +msgstr "Käyttäjätunnus" #: lazarusidestrconsts.lismenuinspect msgid "Inspect ..." @@ -8272,19 +8294,19 @@ msgstr "" #: lazarusidestrconsts.lismenujumpback msgid "Jump back" -msgstr "" +msgstr "Hyppää takaisin" #: lazarusidestrconsts.lismenujumpforward msgid "Jump forward" -msgstr "" +msgstr "Hyppää eteenpäin" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" -msgstr "" +msgstr "Hyppää" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to next bookmark" -msgstr "" +msgstr "Mene seuraavaan kirjainmerkkiin" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to next error" @@ -8292,7 +8314,7 @@ msgstr "" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to previous bookmark" -msgstr "" +msgstr "Mene edelliseen kirjainmerkkiin" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to previous error" @@ -8300,7 +8322,7 @@ msgstr "" #: lazarusidestrconsts.lismenulowercaseselection msgid "Lowercase selection" -msgstr "" +msgstr "Muuta pieniksi kirjaimiksi" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." @@ -8308,48 +8330,50 @@ msgstr "" #: lazarusidestrconsts.lismenunewform msgid "New Form" -msgstr "" +msgstr "Uusi Lomake" #: lazarusidestrconsts.lismenunewother msgid "New ..." -msgstr "" +msgstr "Uusi" #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." -msgstr "" +msgstr "Uusi komponenttipaketti ..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." -msgstr "" +msgstr "Luo uusi Projekti ..." #: lazarusidestrconsts.lismenunewprojectfromfile msgid "New Project from file ..." -msgstr "" +msgstr "Luo uusi projekti tiedostosta ..." #: lazarusidestrconsts.lismenunewunit msgctxt "lazarusidestrconsts.lismenunewunit" msgid "New Unit" -msgstr "" +msgstr "Uusi käännösyksikkö (Unit)" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "" #: lazarusidestrconsts.lismenuopen +#, fuzzy +#| msgid "Open ..." msgid "&Open ..." -msgstr "" +msgstr "Avaa ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open filename at cursor" -msgstr "" +msgstr "Avaa kohdistimen osoittama tiedosto" #: lazarusidestrconsts.lismenuopenpackage msgid "Open loaded package ..." -msgstr "" +msgstr "Avaa komponenttipaketti ..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open package file (.lpk) ..." -msgstr "" +msgstr "Avataan komponenttipakettitiedosto (.lpk) ..." #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open package of current unit" @@ -8357,23 +8381,25 @@ msgstr "" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." -msgstr "" +msgstr "Avaa Projekti ..." #: lazarusidestrconsts.lismenuopenrecent +#, fuzzy +#| msgid "Open Recent ..." msgid "Open &Recent ..." -msgstr "" +msgstr "Avaa viimeksi esillä olleista ..." #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open recent package ..." -msgstr "" +msgstr "Avaa esillä ollut komponenttipaketti ..." #: lazarusidestrconsts.lismenuopenrecentproject msgid "Open Recent Project ..." -msgstr "" +msgstr "Avaa esillä ollut projekti ..." #: lazarusidestrconsts.lismenupackage msgid "&Package" -msgstr "" +msgstr "Komponenttipaketti" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph ..." @@ -8386,7 +8412,7 @@ msgstr "" #: lazarusidestrconsts.lismenupaste msgctxt "lazarusidestrconsts.lismenupaste" msgid "Paste" -msgstr "" +msgstr "Liitä" #: lazarusidestrconsts.lismenupause msgctxt "lazarusidestrconsts.lismenupause" @@ -8395,20 +8421,20 @@ msgstr "" #: lazarusidestrconsts.lismenuproject msgid "&Project" -msgstr "" +msgstr "&Projekti" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" -msgstr "" +msgstr "Projektinhallinta" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." -msgstr "" +msgstr "Projektikohtaiset asetukset ..." #: lazarusidestrconsts.lismenuprojectrun msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "Run" -msgstr "" +msgstr "Suorita" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." @@ -8420,37 +8446,39 @@ msgstr "" #: lazarusidestrconsts.lismenuquicksyntaxcheck msgid "Quick syntax check" -msgstr "" +msgstr "Nopea syntaksin tarkistus" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "" #: lazarusidestrconsts.lismenuquit +#, fuzzy +#| msgid "Quit" msgid "&Quit" -msgstr "" +msgstr "Lopeta" #: lazarusidestrconsts.lismenuredo msgctxt "lazarusidestrconsts.lismenuredo" msgid "Redo" -msgstr "" +msgstr "Uudelleen" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." -msgstr "" +msgstr "Poista projektista ..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." -msgstr "" +msgstr "Vaihda tunnisteen nimeä ..." #: lazarusidestrconsts.lismenureplace msgctxt "lazarusidestrconsts.lismenureplace" msgid "Replace" -msgstr "" +msgstr "Etsi ja korvaa" #: lazarusidestrconsts.lismenureplace2 msgid "&Replace ..." -msgstr "" +msgstr "Etsi ja korvaa..." #: lazarusidestrconsts.lismenureportingbug msgid "Reporting a bug..." @@ -8466,15 +8494,15 @@ msgstr "" #: lazarusidestrconsts.lismenurestart msgid "Restart" -msgstr "" +msgstr "Käynnistä Lazarus uudelleen" #: lazarusidestrconsts.lismenurevert msgid "Revert" -msgstr "" +msgstr "Palauta" #: lazarusidestrconsts.lismenurun msgid "&Run" -msgstr "" +msgstr "&Suorita" #: lazarusidestrconsts.lismenurunfile msgid "Run File" @@ -8482,44 +8510,48 @@ msgstr "" #: lazarusidestrconsts.lismenurunparameters msgid "Run Parameters ..." -msgstr "" +msgstr "Suoritusaikaiset parametrit..." #: lazarusidestrconsts.lismenuruntocursor msgid "Run to cursor" msgstr "" #: lazarusidestrconsts.lismenusave +#, fuzzy +#| msgid "Save" msgctxt "lazarusidestrconsts.lismenusave" msgid "&Save" -msgstr "" +msgstr "Tallenna" #: lazarusidestrconsts.lismenusaveall msgid "Save All" -msgstr "" +msgstr "Tallenna kaikki" #: lazarusidestrconsts.lismenusaveas +#, fuzzy +#| msgid "Save As ..." msgid "Save &As ..." -msgstr "" +msgstr "Tallenna nimellä ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" -msgstr "" +msgstr "Tallenna Projekti" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." -msgstr "" +msgstr "Tallenna Projekti nimellä ..." #: lazarusidestrconsts.lismenusearch msgid "&Search" -msgstr "" +msgstr "&Etsi" #: lazarusidestrconsts.lismenuselect msgid "Select" -msgstr "" +msgstr "Valitse" #: lazarusidestrconsts.lismenuselectall msgid "Select all" -msgstr "" +msgstr "Valitse kaikki" #: lazarusidestrconsts.lismenuselectcodeblock msgid "Select code block" @@ -8527,7 +8559,7 @@ msgstr "" #: lazarusidestrconsts.lismenuselectline msgid "Select line" -msgstr "" +msgstr "Valitse rivi" #: lazarusidestrconsts.lismenuselectparagraph msgid "Select paragraph" @@ -8547,7 +8579,7 @@ msgstr "" #: lazarusidestrconsts.lismenusortselection msgid "Sort selection ..." -msgstr "" +msgstr "Lajittele lohko ..." #: lazarusidestrconsts.lismenustepinto msgid "Step into" @@ -8560,7 +8592,7 @@ msgstr "" #: lazarusidestrconsts.lismenustop msgctxt "lazarusidestrconsts.lismenustop" msgid "Stop" -msgstr "" +msgstr "Pysäytä" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to spaces in selection" @@ -8568,12 +8600,12 @@ msgstr "" #: lazarusidestrconsts.lismenutemplateabout msgid "About" -msgstr "" +msgstr "Tietoja" #: lazarusidestrconsts.lismenutemplateclose msgctxt "lazarusidestrconsts.lismenutemplateclose" msgid "Close" -msgstr "" +msgstr "Sulje" #: lazarusidestrconsts.lismenutemplatecontents msgid "Contents" @@ -8582,12 +8614,12 @@ msgstr "" #: lazarusidestrconsts.lismenutemplatecopy msgctxt "lazarusidestrconsts.lismenutemplatecopy" msgid "Copy" -msgstr "" +msgstr "Kopioi" #: lazarusidestrconsts.lismenutemplatecut msgctxt "lazarusidestrconsts.lismenutemplatecut" msgid "Cut" -msgstr "" +msgstr "Leikkaa" #: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" @@ -8604,63 +8636,63 @@ msgstr "" #: lazarusidestrconsts.lismenutemplateedit msgctxt "lazarusidestrconsts.lismenutemplateedit" msgid "Edit" -msgstr "" +msgstr "Muokkaa" #: lazarusidestrconsts.lismenutemplateexit msgctxt "lazarusidestrconsts.lismenutemplateexit" msgid "Exit" -msgstr "" +msgstr "Lopeta" #: lazarusidestrconsts.lismenutemplatefile msgid "File" -msgstr "" +msgstr "Tiedosto" #: lazarusidestrconsts.lismenutemplatefind msgctxt "lazarusidestrconsts.lismenutemplatefind" msgid "Find" -msgstr "" +msgstr "Etsi" #: lazarusidestrconsts.lismenutemplatefindnext msgid "Find Next" -msgstr "" +msgstr "Etsi seuraava" #: lazarusidestrconsts.lismenutemplatehelp msgctxt "lazarusidestrconsts.lismenutemplatehelp" msgid "Help" -msgstr "" +msgstr "Ohje" #: lazarusidestrconsts.lismenutemplatenew msgid "New" -msgstr "" +msgstr "Uusi" #: lazarusidestrconsts.lismenutemplateopen msgctxt "lazarusidestrconsts.lismenutemplateopen" msgid "Open" -msgstr "" +msgstr "Avaa" #: lazarusidestrconsts.lismenutemplateopenrecent msgctxt "lazarusidestrconsts.lismenutemplateopenrecent" msgid "Open Recent" -msgstr "" +msgstr "Avaa viimeksi esillä olleista" #: lazarusidestrconsts.lismenutemplatepaste msgctxt "lazarusidestrconsts.lismenutemplatepaste" msgid "Paste" -msgstr "" +msgstr "Liitä" #: lazarusidestrconsts.lismenutemplateredo msgctxt "lazarusidestrconsts.lismenutemplateredo" msgid "Redo" -msgstr "" +msgstr "Uudelleen" #: lazarusidestrconsts.lismenutemplatesave msgctxt "lazarusidestrconsts.lismenutemplatesave" msgid "Save" -msgstr "" +msgstr "Tallenna" #: lazarusidestrconsts.lismenutemplatesaveas msgid "Save As" -msgstr "" +msgstr "Tallenna nimellä" #: lazarusidestrconsts.lismenutemplatetutorial msgid "Tutorial" @@ -8677,28 +8709,28 @@ msgstr "" #: lazarusidestrconsts.lismenutools msgid "&Tools" -msgstr "" +msgstr "&Työkalut" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment selection" -msgstr "" +msgstr "Poista lohkon kommentointi (//)" #: lazarusidestrconsts.lismenuundo msgctxt "lazarusidestrconsts.lismenuundo" msgid "Undo" -msgstr "" +msgstr "Kumoa" #: lazarusidestrconsts.lismenuunindentselection msgid "Unindent selection" -msgstr "" +msgstr "Poista lohkon sisennys" #: lazarusidestrconsts.lismenuuppercaseselection msgid "Uppercase selection" -msgstr "" +msgstr "Muuta isoiksi kirjaimiksi" #: lazarusidestrconsts.lismenuview msgid "&View" -msgstr "" +msgstr "&Näytä" #: lazarusidestrconsts.lismenuviewanchoreditor msgid "Anchor Editor" @@ -8726,12 +8758,14 @@ msgid "Code Explorer" msgstr "" #: lazarusidestrconsts.lismenuviewcomponentpalette +#, fuzzy +#| msgid "View Component Palette" msgid "Component Palette" -msgstr "" +msgstr "Näytä tai poista komponenttipaletti näkyvistä" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" -msgstr "" +msgstr "&Komponentit" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug output" @@ -8739,7 +8773,7 @@ msgstr "" #: lazarusidestrconsts.lismenuviewforms msgid "Forms..." -msgstr "" +msgstr "Lomakkeet..." #: lazarusidestrconsts.lismenuviewidespeedbuttons msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons" @@ -8747,8 +8781,10 @@ msgid "IDE speed buttons" msgstr "" #: lazarusidestrconsts.lismenuviewjumphistory +#, fuzzy +#| msgid "View Jump-History ..." msgid "Jump-History ..." -msgstr "" +msgstr "Näytä hyppy historia ..." #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" @@ -8757,12 +8793,12 @@ msgstr "" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" -msgstr "" +msgstr "Kääntäjän viestit" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" msgid "Object Inspector" -msgstr "" +msgstr "Komponenttimuokkain" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" @@ -8775,37 +8811,41 @@ msgstr "" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" -msgstr "" +msgstr "Hakutulokset" #: lazarusidestrconsts.lismenuviewsource msgid "&View Source" -msgstr "" +msgstr "Näytä lähdekoodi" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" msgid "Source Editor" -msgstr "" +msgstr "Lähdekoodi editori" #: lazarusidestrconsts.lismenuviewtodolist msgctxt "lazarusidestrconsts.lismenuviewtodolist" msgid "ToDo List" -msgstr "" +msgstr "Tehtävälista (ToDo List)" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle form/unit view" -msgstr "" +msgstr "Siirry lomakkeen ja käännösyksikön välillä" #: lazarusidestrconsts.lismenuviewunitdependencies +#, fuzzy +#| msgid "View Unit Dependencies" msgid "Unit Dependencies" -msgstr "" +msgstr "Näytä käännösyksikön (Unit) riippuvuudet" #: lazarusidestrconsts.lismenuviewunitinfo +#, fuzzy +#| msgid "View Unit Information" msgid "Unit Information" -msgstr "" +msgstr "Näytä käännösyksikön (Unit) tietoja" #: lazarusidestrconsts.lismenuviewunits msgid "Units..." -msgstr "" +msgstr "Käännösyksiköt eli unitit ..." #: lazarusidestrconsts.lismenuviewwatches msgid "Watches" @@ -8813,7 +8853,7 @@ msgstr "" #: lazarusidestrconsts.lismenuwindow msgid "&Window" -msgstr "" +msgstr "Ikkunat" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" @@ -8825,7 +8865,7 @@ msgstr "" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" -msgstr "" +msgstr "Puuttuvia tapahtumia" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" @@ -8833,7 +8873,7 @@ msgstr "" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" -msgstr "" +msgstr "Komponenttipaketti puuttuu" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." @@ -8849,7 +8889,7 @@ msgstr "" #: lazarusidestrconsts.lismovepage msgid "Move Page ..." -msgstr "" +msgstr "Siirrä välilehdelle ..." #: lazarusidestrconsts.lisms msgid "(ms)" @@ -8869,7 +8909,7 @@ msgstr "" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" -msgstr "" +msgstr "Uuden aliohjelman nimi" #: lazarusidestrconsts.lisnever msgid "Never" @@ -8897,7 +8937,7 @@ msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram msgid "Create a new program." -msgstr "" +msgstr "Tee uusi ohjelma" #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." @@ -8905,15 +8945,15 @@ msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." -msgstr "" +msgstr "Tee uusi tyhjä tekstitiedosto (*.txt)." #: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." -msgstr "" +msgstr "Luo uusi graafinen sovellus.%sOhjelma tehdään ja ylläpidetään Lazaruksella." #: lazarusidestrconsts.lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." -msgstr "" +msgstr "Tee uusi pascal käännösyksikkö (unit)" #: lazarusidestrconsts.lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." @@ -8925,7 +8965,7 @@ msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." -msgstr "" +msgstr "Tee uusi standardi paketti.%sPaketti on kokoelma käännösyksiköitä ja komponentteja. Soveltuu pitkälle ehtineille käyttäjille." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." @@ -8937,7 +8977,7 @@ msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." -msgstr "" +msgstr "Tee uusi unit ja lomake (LCL form)" #: lazarusidestrconsts.lisnewdlginheritanexistingcomponent msgid "Inherit from an existing component." @@ -8969,15 +9009,15 @@ msgstr "Ei" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" -msgstr "" +msgstr "Ei varmuuskopioita" #: lazarusidestrconsts.lisnochange msgid "No change" -msgstr "" +msgstr "Ei muutoksia" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" -msgstr "" +msgstr "Ei valittua koodia" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." @@ -9001,7 +9041,7 @@ msgstr "" #: lazarusidestrconsts.lisnone2 msgid "none" -msgstr "" +msgstr "Ei mikään" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" @@ -9061,11 +9101,11 @@ msgstr "" #: lazarusidestrconsts.lisnpcreate msgid "Create" -msgstr "" +msgstr "Luo" #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" -msgstr "" +msgstr "Luo uusi projekti" #: lazarusidestrconsts.lisnpselectaprojecttype msgid "Select a project type" @@ -9097,7 +9137,7 @@ msgstr "" #: lazarusidestrconsts.lisoifclassnotfound msgid "Class %s%s%s not found." -msgstr "" +msgstr "Luokkaa (Class) %s%s%s ei löydy." #: lazarusidestrconsts.lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" @@ -9121,7 +9161,7 @@ msgstr "" #: lazarusidestrconsts.lisoipfilename msgid "Filename: %s" -msgstr "" +msgstr "Tiedostonimi: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" @@ -9145,11 +9185,11 @@ msgstr "" #: lazarusidestrconsts.lisoipopenloadedpackage msgid "Open loaded package" -msgstr "" +msgstr "Avaa komponenttipaketti" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" -msgstr "" +msgstr "Komponenttipaketin nimi" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" @@ -9165,7 +9205,7 @@ msgstr "" #: lazarusidestrconsts.lisoipstate msgid "State" -msgstr "" +msgstr "Tila" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" @@ -9181,7 +9221,7 @@ msgstr "" #: lazarusidestrconsts.lisold msgid "old" -msgstr "" +msgstr "vanha" #: lazarusidestrconsts.lisoldancestors msgid "Old Ancestors" @@ -9197,11 +9237,11 @@ msgstr "" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" -msgstr "" +msgstr "Esittävä sana ei voi olla osa toista sanaa" #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" -msgstr "" +msgstr "Avataan XML-tiedostona" #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" @@ -9209,15 +9249,15 @@ msgstr "Avaa tiedosto" #: lazarusidestrconsts.lisopenfile msgid "Open file" -msgstr "" +msgstr "Avaa tiedosto" #: lazarusidestrconsts.lisopenfile2 msgid "Open File ..." -msgstr "" +msgstr "Avaa tiedosto ..." #: lazarusidestrconsts.lisopenlfm msgid "Open %s" -msgstr "" +msgstr "Avaa %s" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" @@ -9229,23 +9269,23 @@ msgstr "" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" -msgstr "" +msgstr "Avataan komponenttipakettitiedosto" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" -msgstr "" +msgstr "Avataanko projekti?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" -msgstr "" +msgstr "Avaa projekti" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" -msgstr "" +msgstr "Avaa projekti uudelleen" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" -msgstr "" +msgstr "Avaa projektitiedosto" #: lazarusidestrconsts.lisopensymlink msgid "Open symlink" @@ -9257,7 +9297,7 @@ msgstr "" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" -msgstr "" +msgstr "Avaa tiedosto normaalina lähdekoodina" #: lazarusidestrconsts.lisopenthepackage msgid "Open the package %s?" @@ -9265,11 +9305,11 @@ msgstr "" #: lazarusidestrconsts.lisopentheproject msgid "Open the project %s?" -msgstr "" +msgstr "Avataanko projekti %s?" #: lazarusidestrconsts.lisor msgid "or" -msgstr "" +msgstr "tai" #: lazarusidestrconsts.lisoriginalfilename msgid "Original File Name:" @@ -9297,11 +9337,11 @@ msgstr "" #: lazarusidestrconsts.lisoverwritefile msgid "Overwrite file?" -msgstr "" +msgstr "Korvataanko tiedosto?" #: lazarusidestrconsts.lisoverwritefileondisk msgid "Overwrite file on disk" -msgstr "" +msgstr "Korvaa tällä tiedostolla" #: lazarusidestrconsts.lispackage msgid "Package" @@ -9313,7 +9353,7 @@ msgstr "" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" -msgstr "" +msgstr "Komponenttipaketin tietoja" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." @@ -9362,7 +9402,7 @@ msgstr "" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" msgid "Browse" -msgstr "" +msgstr "Selaa" #: lazarusidestrconsts.lispatheditmovepathdown msgid "Move path down" @@ -9408,7 +9448,7 @@ msgstr "" #: lazarusidestrconsts.lispckeditcompile msgctxt "lazarusidestrconsts.lispckeditcompile" msgid "Compile" -msgstr "" +msgstr "Käännä" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" @@ -9416,7 +9456,7 @@ msgstr "" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" -msgstr "" +msgstr "Kääntää komponenttipaketin" #: lazarusidestrconsts.lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" @@ -9455,15 +9495,15 @@ msgstr "" #: lazarusidestrconsts.lispckedithelp msgctxt "lazarusidestrconsts.lispckedithelp" msgid "Help" -msgstr "" +msgstr "Ohje" #: lazarusidestrconsts.lispckeditinstall msgid "Install" -msgstr "" +msgstr "Asenna" #: lazarusidestrconsts.lispckeditinstallpackageintheide msgid "Install package in the IDE" -msgstr "" +msgstr "Asenna komponenttipaketti kehitysympäristöön" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" @@ -9487,35 +9527,35 @@ msgstr "" #: lazarusidestrconsts.lispckeditmore msgid "More ..." -msgstr "" +msgstr "Näytä muut ..." #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" -msgstr "" +msgstr "Siirrä riippuvuutta alaspäin" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" -msgstr "" +msgstr "Siirrä riippuvuutta ylöspäin" #: lazarusidestrconsts.lispckeditpackage msgid "Package %s" -msgstr "" +msgstr "Komponenttipaketti %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" -msgstr "" +msgstr "Komponenttipaketti %s%s%s on muuttunut.%sTallennetaanko komponenttipaketti?" #: lazarusidestrconsts.lispckeditpackagenotsaved msgid "package %s not saved" -msgstr "" +msgstr "komponenttipakettia %s ei ole tallennettu" #: lazarusidestrconsts.lispckeditpage msgid "%s, Page: %s" -msgstr "" +msgstr "%s, Komponenttipaletin välilehti: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" -msgstr "" +msgstr "Palauta riippuvuus" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" @@ -9523,7 +9563,7 @@ msgstr "" #: lazarusidestrconsts.lispckeditreadonly msgid "Read Only: %s" -msgstr "" +msgstr "Tämä on vain luettavissa: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired msgid "Recompile all required" @@ -9547,7 +9587,7 @@ msgstr "" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" -msgstr "" +msgstr "Poista riippuvuus" #: lazarusidestrconsts.lispckeditremovedependency2 msgid "Remove Dependency?" @@ -9567,15 +9607,15 @@ msgstr "" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" -msgstr "" +msgstr "Poista tiedosto" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" -msgstr "" +msgstr "Poistetaanko tiedosto?" #: lazarusidestrconsts.lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" -msgstr "" +msgstr "Poistetaanko tiedosto %s%s%s%skomponenttipaketista %s%s%s?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" @@ -9583,15 +9623,15 @@ msgstr "" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" -msgstr "" +msgstr "Tarvittavat komponenttipaketit" #: lazarusidestrconsts.lispckeditsavechanges msgid "Save Changes?" -msgstr "" +msgstr "Talletetaanko muutokset?" #: lazarusidestrconsts.lispckeditsavepackage msgid "Save package" -msgstr "" +msgstr "Tallenna komponenttipaketti" #: lazarusidestrconsts.lispckeditsetdependencydefaultfilename msgid "Store dependency filename" @@ -9607,7 +9647,7 @@ msgstr "" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" -msgstr "" +msgstr "Poista asennuksesta" #: lazarusidestrconsts.lispckeditviewpackgesource msgid "View Package Source" @@ -9623,7 +9663,7 @@ msgstr "" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" -msgstr "" +msgstr "Asennetaan seuraavan käynnistyksen yhteydessä" #: lazarusidestrconsts.lispckexplisrequiredby msgid "Selected package is required by:" @@ -9635,7 +9675,7 @@ msgstr "" #: lazarusidestrconsts.lispckexplpackagenotfound msgid "Package %s not found" -msgstr "" +msgstr "Komponenttipakettia %s ei löydetty" #: lazarusidestrconsts.lispckexplstate msgid "%sState: " @@ -9655,7 +9695,7 @@ msgstr "" #: lazarusidestrconsts.lispckoptsauthor msgid "Author:" -msgstr "" +msgstr "Tekijä:" #: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" @@ -9704,11 +9744,11 @@ msgstr "" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" -msgstr "" +msgstr "Aliohjelmakirjasto" #: lazarusidestrconsts.lispckoptslicense msgid "License:" -msgstr "" +msgstr "Lisenssi:" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" @@ -9769,7 +9809,7 @@ msgstr "" #: lazarusidestrconsts.lispdabort msgctxt "lazarusidestrconsts.lispdabort" msgid "Abort" -msgstr "" +msgstr "Keskeytä" #: lazarusidestrconsts.lispdprogress msgid "Progress" @@ -9790,7 +9830,7 @@ msgstr "" #: lazarusidestrconsts.lispefilename msgid "Filename:" -msgstr "" +msgstr "Tiedostonimi:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" @@ -9866,7 +9906,7 @@ msgstr "" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" -msgstr "" +msgstr "Uusi käännösyksikkö (unit) ei ole hakupolussa" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" @@ -9878,19 +9918,19 @@ msgstr "" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" -msgstr "" +msgstr "Tiedosto %s%s%s%sei ole komponenttipaketin hakupolussa.%s%sLisätäänkö kansio %s%s%s käännösyksikköjen hakupolkuun?" #: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" -msgstr "" +msgstr "Avustusta ei ole vielä tehty" #: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." -msgstr "" +msgstr "Näpäyttämällä hiiren oikeaa näppäintä saat esiin ponnahdusvalikon jossa on kaikki saatavissa olevat komponenttipakettiin liittyvät toiminnallisuudet" #: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" -msgstr "" +msgstr "Lista lisätoiminnoista" #: lazarusidestrconsts.lispkgfiletypebinary msgid "Binary" @@ -9915,7 +9955,7 @@ msgstr "" #: lazarusidestrconsts.lispkgfiletypetext msgctxt "lazarusidestrconsts.lispkgfiletypetext" msgid "Text" -msgstr "" +msgstr "Teksti" #: lazarusidestrconsts.lispkgfiletypeunit msgctxt "lazarusidestrconsts.lispkgfiletypeunit" @@ -9948,7 +9988,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" -msgstr "" +msgstr "Automaattisesti asennettavat komponenttipaketit" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." @@ -10001,7 +10041,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" -msgstr "" +msgstr "Tiedosto on jo projektissa" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" @@ -10017,7 +10057,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangfilenotfound msgid "File %s%s%s not found." -msgstr "" +msgstr "Tiedostoa %s%s%s ei löytynyt." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" @@ -10033,7 +10073,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" -msgstr "" +msgstr "Asennettaessa komponettipaketti %s tullaan automaattisesti asentamaan paketit:" #: lazarusidestrconsts.lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" @@ -10041,7 +10081,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" -msgstr "" +msgstr "Vääränlainen tiedoston tarkennin" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" @@ -10097,11 +10137,11 @@ msgstr "" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" -msgstr "" +msgstr "Ei ole suunnitteluaikainen komponenttipaketti" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" -msgstr "" +msgstr "Komponenttipakettia tarvitaan" #: lazarusidestrconsts.lispkgmangpackagemainsourcefile msgid "package main source file" @@ -10129,11 +10169,11 @@ msgstr "" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" -msgstr "" +msgstr "Rakennetaanko Lazarus uudelleen?" #: lazarusidestrconsts.lispkgmangrenamefileinpackage msgid "Rename file in package?" -msgstr "" +msgstr "Vaihdetaanko tiedoston nimeä komponenttipaketissa?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" @@ -10157,7 +10197,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" -msgstr "" +msgstr "Tallenna komponenttipaketti %s (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" @@ -10206,19 +10246,19 @@ msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" -msgstr "" +msgstr "Seuraavan komponenttipaketin lataaminen epäonnistui:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" -msgstr "" +msgstr "Seuraavien komponenttipakettien lataaminen epäonnistui:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" -msgstr "" +msgstr "%sSeuraava käännösyksikkö (unit) lisätään %s-tiedoston uses-lauseeseen :%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" -msgstr "" +msgstr "Komponenttipaketin %s%s%s kääntäminen epäonnistui.%sPoistetaanko se asennuksesta?" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." @@ -10226,15 +10266,15 @@ msgstr "" #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." -msgstr "" +msgstr "Komponenttipaketti %s on ainoastaan ajonaikainen.%sVain ajonaikaisia komponenttipaketteja ei asenneta kehitysympäristöön." #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" -msgstr "" +msgstr "Komponenttipaketti %s%s%s oli merkitty asennettavaksi mutta sitä ei löydetty. Poistetaanko tämä riippuvuus komponettipakettien asennusluettelosta?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." -msgstr "" +msgstr "Komponenttipakettia %s tarvitaan komponettipaketissa %s, mikä on merkitty asennukseen.%sKatso komponenttipakettien kuvauksista" #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" @@ -10246,19 +10286,19 @@ msgstr "" #: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" -msgstr "" +msgstr "Komponenttipaketti %s omistaa tiedoston%s%s%s%s.%sPitäisikö tuota komponenttipaketin nimeäkin myöskin muuttaa?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "Komponenttipaketti %s%s%s oli merkitty.%sNykyinen Lazarus tukee ainoastaan staattisesti linkitettyjä komponenttipaketteja. komponenttipakettien poistaminen vatii Lazaruksen uudelleen rakentamisen ja käynnistämisen.%s%sTehdäänkö tämä nyt?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" -msgstr "" +msgstr "Paketti %s%s%s on merkitty asennettavaksi.%sNykyinen lazarus tukee ainoastaan staattisesti linkattuja paketteja. Asennus vaatii Lazaruksen uudelleen rakentamisen ja uudelleen käynnistämisen.%s%sHaluako tehdä sen nyt?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." -msgstr "" +msgstr "Sovellus tarvitsee komponenttipaketin %s%s%s.%sMutta sitä ei löydy (tai ei ole asennettu). Katso projektivalikon kohtaa -> Projektinhallinta." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" @@ -10306,7 +10346,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatedirectory msgid "Unable to create directory" -msgstr "" +msgstr "Kansion luonti epäonnistui" #: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." @@ -10338,7 +10378,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." -msgstr "" +msgstr "Ei pystytä avaamaan komponenttipakettia %s%s%s.%sTämä komponenttipaketti oli merkitty asennettavaksi." #: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" @@ -10354,11 +10394,11 @@ msgstr "" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" -msgstr "" +msgstr "Poistetaanko komponenttipaketti Lazaruksen asennuksesta?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 msgid "Uninstall package %s?" -msgstr "" +msgstr "Poistetaanko komponenttipaketti %s ?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" @@ -10370,7 +10410,7 @@ msgstr "" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." -msgstr "" +msgstr "Varoitus: Tiedosto %s%s%s%skuuluu jo projektiin." #: lazarusidestrconsts.lispkgreg msgid "Package Registration" @@ -10506,11 +10546,11 @@ msgstr "" #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." -msgstr "" +msgstr "Ole hyvä ja valitse ensin jokin koodin osa josta tehdään uusi aliohjelma tai metodi" #: lazarusidestrconsts.lisplistall msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" @@ -10518,7 +10558,7 @@ msgstr "" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" -msgstr "" +msgstr "Kopio aliohjelman (/funktion/metodin...) nimi leikepöydälle" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" @@ -10530,20 +10570,20 @@ msgstr "" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" -msgstr "" +msgstr "Mene valittuun aliohjelmaan,funktioon..." #: lazarusidestrconsts.lisplistnone msgid "" -msgstr "" +msgstr "" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" -msgstr "" +msgstr "Luokka" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" msgid "Type" -msgstr "" +msgstr "Tyyppi" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" @@ -10583,7 +10623,7 @@ msgstr "" #: lazarusidestrconsts.lisprint msgid "Print" -msgstr "" +msgstr "Tulosta" #: lazarusidestrconsts.lisprivate msgid "Private" @@ -10591,7 +10631,7 @@ msgstr "" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" -msgstr "" +msgstr "Private - metodi" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" @@ -10600,11 +10640,11 @@ msgstr "" #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" msgid "Procedure" -msgstr "" +msgstr "Aliohjelma" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" -msgstr "" +msgstr "Aliohjelma ja interface osaan sen esittely" #: lazarusidestrconsts.lisproductname msgid "Product Name:" @@ -10621,15 +10661,15 @@ msgstr "" #: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." -msgstr "" +msgstr "Ohjelma%s Freepascal ohjelma. Ohjelmatiedosto hyödyntää lazarusta." #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" -msgstr "" +msgstr "Tunnistettiin ohjelmaksi" #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" -msgstr "" +msgstr "Ohjelman lähdekoodin tiedosto tarkennin pitää olla .pas, .pp tai .lpr" #: lazarusidestrconsts.lisprojaddaddfilestoproject msgid "Add files to project" @@ -10637,7 +10677,7 @@ msgstr "" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" -msgstr "" +msgstr "Lisää tiedosto projektiin:" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" @@ -10645,11 +10685,11 @@ msgstr "" #: lazarusidestrconsts.lisprojaddeditorfile msgid "Add editor files" -msgstr "" +msgstr "Lisää editorissa avoinna olevia tiedostoja" #: lazarusidestrconsts.lisprojaddfiles msgid "Add files" -msgstr "" +msgstr "Lisää tiedostoja" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" @@ -10685,11 +10725,11 @@ msgstr "" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" -msgstr "" +msgstr "Komponenttipakettia ei löytynyt" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." -msgstr "" +msgstr "Tarvittavaa komponenttipakettia %s%s%s ei löytynyt.%sJos mahdollista niin valitse jokin toinen komponenttipaketti." #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" @@ -10716,7 +10756,7 @@ msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." -msgstr "" +msgstr "Käännösyksikkö (unit) %s%s%s on jo olemassa projektissa%stiedostona: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." @@ -10729,15 +10769,15 @@ msgstr "" #: lazarusidestrconsts.lisprojaddtoproject msgctxt "lazarusidestrconsts.lisprojaddtoproject" msgid "Add to project" -msgstr "" +msgstr "Lisää projektiin" #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" -msgstr "" +msgstr "Käännösyksikön (Unit) nimi on jo olemassa" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" -msgstr "" +msgstr "Projekti on muuttunut" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" @@ -10754,7 +10794,7 @@ msgstr "" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" -msgstr "" +msgstr "Tunnistettiin 'Project Info'-tiedostoksi" #: lazarusidestrconsts.lisprojectinformation msgid "Project Information" @@ -10762,7 +10802,7 @@ msgstr "" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" -msgstr "" +msgstr "Projekti on ajettavissa virheenjäljittimessä" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" @@ -10794,31 +10834,31 @@ msgstr "" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" -msgstr "" +msgstr "Projektin valinta" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" -msgstr "" +msgstr "Vahvista riippuvuuden poistaminen" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" -msgstr "" +msgstr "Vahvista tiedoston poistaminen" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" -msgstr "" +msgstr "Poistetaanko riippuvuus %s :n ?" #: lazarusidestrconsts.lisprojinspprojectinspector msgid "Project Inspector - %s" -msgstr "" +msgstr "Projektinhallinta - %s" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgid "Removed required packages" -msgstr "" +msgstr "Poistettuja tarvittavia komponenttipaketteja" #: lazarusidestrconsts.lisprojinspremovefilefromproject msgid "Remove file %s from project?" -msgstr "" +msgstr "Poistetaanko tiedosto %s projektista?" #: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" @@ -10830,12 +10870,12 @@ msgstr "" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" -msgstr "" +msgstr "Aina käännetään kaikki (vaikka mikään ei muuttunutkaan)" #: lazarusidestrconsts.lisprojoptserror msgctxt "lazarusidestrconsts.lisprojoptserror" msgid "Error" -msgstr "" +msgstr "Virhe" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." @@ -10859,15 +10899,15 @@ msgstr "" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" -msgstr "" +msgstr "Protected - metodi" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" -msgstr "" +msgstr "Public - metodi" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" -msgstr "" +msgstr "Published - metodi" #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" @@ -10916,32 +10956,32 @@ msgstr "" #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" -msgstr "" +msgstr "Muunna Delphi-projektista" #: lazarusidestrconsts.lispwnewproject msgid "New Project" -msgstr "" +msgstr "Luo uusi Projekti" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" -msgstr "" +msgstr "Avaa Projekti" #: lazarusidestrconsts.lispwopenrecentproject msgctxt "lazarusidestrconsts.lispwopenrecentproject" msgid "Open Recent" -msgstr "" +msgstr "Avaa viimeksi esillä olleista" #: lazarusidestrconsts.lispwrecentprojects msgid "Recent Projects" -msgstr "" +msgstr "Viimeksi esillä olleet projektit" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" -msgstr "" +msgstr "Poistu Lazaruksesta" #: lazarusidestrconsts.lisreaderror msgid "Read Error" -msgstr "" +msgstr "Lukuvirhe" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" @@ -10960,7 +11000,7 @@ msgstr "" #: lazarusidestrconsts.lisregistersdlgvalue msgctxt "lazarusidestrconsts.lisregistersdlgvalue" msgid "Value" -msgstr "" +msgstr "Arvo" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" @@ -10968,7 +11008,7 @@ msgstr "" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" -msgstr "" +msgstr "Suhteelliset hakupolut" #: lazarusidestrconsts.lisremove msgid "remove" @@ -10976,7 +11016,7 @@ msgstr "" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" -msgstr "" +msgstr "Poista kaikki vikaantuneet tai toimimattomat ominaisuudet" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" @@ -10984,7 +11024,7 @@ msgstr "" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" -msgstr "" +msgstr "Valitse projektista poistettava käännösyksikkö" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" @@ -10992,11 +11032,11 @@ msgstr "" #: lazarusidestrconsts.lisremovethem msgid "Remove them" -msgstr "" +msgstr "Poista ne" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" -msgstr "" +msgstr "Muutetaanko tiedoston nimeä?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" @@ -11004,11 +11044,11 @@ msgstr "" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" -msgstr "" +msgstr "Vaihda nimi pienillä kirjaimilla kirjoitetuksi" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" -msgstr "" +msgstr "Avaa uudestaan toisella merkistön koodauksella" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" @@ -11028,7 +11068,7 @@ msgstr "" #: lazarusidestrconsts.lisresourceloaderror msgid "Resource load error" -msgstr "" +msgstr "Resurssitiedoston lukeminen epäonnistui" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" @@ -11053,7 +11093,7 @@ msgstr "" #: lazarusidestrconsts.lisright msgctxt "lazarusidestrconsts.lisright" msgid "Right" -msgstr "" +msgstr "Oikea" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" @@ -11069,7 +11109,7 @@ msgstr "" #: lazarusidestrconsts.lisrightsides msgid "Right sides" -msgstr "" +msgstr "Oikeat reunat" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" @@ -11141,11 +11181,11 @@ msgstr "" #: lazarusidestrconsts.lissave msgid "Save ..." -msgstr "" +msgstr "Tallenna ..." #: lazarusidestrconsts.lissaveallmessagestofile msgid "Save all messages to file" -msgstr "" +msgstr "Tallenna kaikki kääntäjän viestit tiedostoon" #: lazarusidestrconsts.lissaveallmodified msgid "save all modified files" @@ -11161,11 +11201,11 @@ msgstr "" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" -msgstr "" +msgstr "Tallennetaanko muutokset?" #: lazarusidestrconsts.lissavechangestoproject msgid "Save changes to project %s?" -msgstr "" +msgstr "Tallennetaanko %s -projektiin tehdyt muutokset?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "save current editor file" @@ -11181,7 +11221,7 @@ msgstr "" #: lazarusidestrconsts.lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" -msgstr "" +msgstr "Tallennetaanko tiedosto %s%s%s%sennenkuin suljetaan lomake (form) %s%s%s?" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" @@ -11189,7 +11229,7 @@ msgstr "" #: lazarusidestrconsts.lissaveprojectlpi msgid "Save Project %s (*.lpi)" -msgstr "" +msgstr "Tallenna %s projekti (*.lpi)" #: lazarusidestrconsts.lissavesettings msgid "Save Settings" @@ -11197,7 +11237,7 @@ msgstr "" #: lazarusidestrconsts.lissavespace msgid "Save " -msgstr "" +msgstr "Tallenna " #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" @@ -11205,7 +11245,7 @@ msgstr "" #: lazarusidestrconsts.lissearchfor msgid "Search For " -msgstr "" +msgstr "Viittaukset tunnisteeseen: " #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " @@ -11213,15 +11253,15 @@ msgstr "" #: lazarusidestrconsts.lisseemessages msgid "See messages." -msgstr "" +msgstr "Katso \"Kääntäjän viestit \" -ikkunaa" #: lazarusidestrconsts.lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" -msgstr "" +msgstr "%sKatso projektivalikon kohtaa -> Projektinhallinta" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" -msgstr "" +msgstr "Valitse jokin kohta seuraavista:" #: lazarusidestrconsts.lisselectanode msgid "Select a node" @@ -11229,7 +11269,7 @@ msgstr "" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" -msgstr "" +msgstr "Valitse Delphi form (lomake) tiedosto (*.dfm)" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" @@ -11257,7 +11297,7 @@ msgstr "" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" -msgstr "" +msgstr "Valintatyökalu" #: lazarusidestrconsts.lissetdefault msgid "Set default" @@ -11281,7 +11321,7 @@ msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" -msgstr "" +msgstr "Näytä komponenttimuokkaimessa vihjeet" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" @@ -11301,7 +11341,7 @@ msgstr "" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" -msgstr "" +msgstr "Tuo esille erikoismerkit (kuten välilyönnit pisteinä, kelpaattomat merkit kysymysmerkkeinä)" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" @@ -11329,7 +11369,7 @@ msgstr "" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" -msgstr "" +msgstr "Ohita tiedosto ja jatka lataamista" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project" @@ -11341,7 +11381,7 @@ msgstr "" #: lazarusidestrconsts.lissmatches msgid "Matches" -msgstr "" +msgstr "Löydetty" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" @@ -11353,60 +11393,60 @@ msgstr "" #: lazarusidestrconsts.lissortselascending msgid "Ascending" -msgstr "" +msgstr "Normaali (aakkostus)" #: lazarusidestrconsts.lissortselcancel msgctxt "lazarusidestrconsts.lissortselcancel" msgid "Cancel" -msgstr "" +msgstr "Peru" #: lazarusidestrconsts.lissortselcasesensitive msgctxt "lazarusidestrconsts.lissortselcasesensitive" msgid "&Case Sensitive" -msgstr "" +msgstr "Sama kirjainkoko" #: lazarusidestrconsts.lissortseldescending msgid "Descending" -msgstr "" +msgstr "Käänteinen (aakkostus)" #: lazarusidestrconsts.lissortseldomain msgid "Domain" -msgstr "" +msgstr "Lajittelu peruste" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" -msgstr "" +msgstr "Jätä välilyönnit huomiotta" #: lazarusidestrconsts.lissortsellines msgid "Lines" -msgstr "" +msgstr "Rivit" #: lazarusidestrconsts.lissortseloptions msgctxt "lazarusidestrconsts.lissortseloptions" msgid "Options" -msgstr "" +msgstr "Optiot" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" -msgstr "" +msgstr "Rivit (sisennykset ovat ed. riviä)" #: lazarusidestrconsts.lissortselpreview msgctxt "lazarusidestrconsts.lissortselpreview" msgid "Preview" -msgstr "" +msgstr "Esikatselu" #: lazarusidestrconsts.lissortselsort msgid "Accept" -msgstr "" +msgstr "Hyväksy" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" -msgstr "" +msgstr "Lajittele lohko" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" msgid "Words" -msgstr "" +msgstr "Sanat" #: lazarusidestrconsts.lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" @@ -11426,7 +11466,7 @@ msgstr "" #: lazarusidestrconsts.lissourcemodified msgid "Source modified" -msgstr "" +msgstr "Lähdekoodi muuttunut" #: lazarusidestrconsts.lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" @@ -11446,27 +11486,27 @@ msgstr "" #: lazarusidestrconsts.lisssearching msgid "Searching" -msgstr "" +msgstr "Etsitään" #: lazarusidestrconsts.lisssearchtext msgid "Search text" -msgstr "" +msgstr "Etsittävä teksti" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" -msgstr "" +msgstr "Aloita uusi projekti" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" -msgstr "" +msgstr "Pysäytetäänkö nykyinen virheenjäljitys ja muodostetaan käännös uudelleen?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" -msgstr "" +msgstr "Lopetetaanko testaus/virheenjäljitys?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" -msgstr "" +msgstr "Pysäytetäänkö virheenjäljitys?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" @@ -11474,7 +11514,7 @@ msgstr "" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" -msgstr "" +msgstr "Pysäytetäänkö virheenjäljitys?" #: lazarusidestrconsts.lisstreamerror msgid "Stream Error" @@ -11495,7 +11535,7 @@ msgstr "" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" -msgstr "" +msgstr "Aliohjelman sisäinen aliohjelma" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" @@ -11503,7 +11543,7 @@ msgstr "" #: lazarusidestrconsts.lissuccess msgid "Success" -msgstr "" +msgstr "Onnistui" #: lazarusidestrconsts.lissvnrevision msgid "SVN Revision: " @@ -11515,7 +11555,7 @@ msgstr "" #: lazarusidestrconsts.lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." -msgstr "" +msgstr "%s%s%s ei ole laillinen tunniste" #: lazarusidestrconsts.lissvuook msgctxt "lazarusidestrconsts.lissvuook" @@ -11616,7 +11656,7 @@ msgstr "" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" -msgstr "" +msgstr "Tällä hetkellä käytössä oleva kääntäjän tiedostonimi %s%s%s%sei ole suoritettavissa.%sValitsemalla Ok käytetään oletuksena olevaa %s%s%s.%sMuussa tapauksessa tarkista Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehden kohdat" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" @@ -11656,11 +11696,11 @@ msgstr "" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" -msgstr "" +msgstr "Kansiota %s%s%s ei enään tarvita käännösyksikön tiedostopolussa.%sPoistetaanko se?" #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" -msgstr "" +msgstr "Kansio %s%s%s ei vielä ole käännösyksikön polussa.%sLisätäänkö se sinne?" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." @@ -11668,7 +11708,7 @@ msgstr "" #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" -msgstr "" +msgstr "Tiedosto %s%s%s" #: lazarusidestrconsts.listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" @@ -11684,11 +11724,11 @@ msgstr "" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." -msgstr "" +msgstr "Tiedosto %s%s%s%s näyttää olevan Pascal-ohjelma. Suljetaanko nykyinen projekti ja avataan tämä uutena projektina?%s\"Ei\"-näppäin avaa sen vain lähdekoodina." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." -msgstr "" +msgstr "Tiedosto %s vaikuttaa siltä että se on ohjelmatiedosto Lazaruksella tehdyssä projektissa." #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" @@ -11700,15 +11740,15 @@ msgstr "" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." -msgstr "" +msgstr "Tiedostoa %s%s%s%sei löytynyt.%sOhita-näppäimen nainallus jatkaa projektin lataamista,%sKeskeytä-näppäin keskeyttää sen." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" -msgstr "" +msgstr "Seuraavaa metodia %s on käytetty mutta sitä ei löydy lähdekoodista%s%s%s%s%s%sPoistetaanko 'roikkuva' viittaus?" #: lazarusidestrconsts.listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." -msgstr "" +msgstr "Seuraavia käännösyksiköitä (unit) ei löydetty:%s%s%s%s1) Joko nämä käännösyksiköt eivät olleet hakupolussa jolloin keskeytä ja korjaa hakupolut sekä yritä uudelleen.%s2) Tai voit ohittaa puuttuvat käännösyksiköt ja kommentoida ne pois käytöstä." #: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." @@ -11740,7 +11780,7 @@ msgstr "" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." -msgstr "" +msgstr "Lazaruksen lomake eli LFM-tiedosto sisältää vääränlaisia ominaisuuksia. Tämä tarkoittanee esimerkiksi jotain luokkaa tai sen ominaisuutta mitä ei ole käytettävissä käytössä olevassa LCL-kirjastossa. Normaali korjaus on poistaa nämä ominaisuudet LFM-tiedostosta ja korjata Pascal-koodi käsin." #: lazarusidestrconsts.listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." @@ -11784,7 +11824,7 @@ msgstr "" #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" -msgstr "" +msgstr "Projektn info tiedosto %s%s%s%son/olisi saman niminen kuin projektin pääohjelman lähdekoodi tiedosto!" #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" @@ -11796,11 +11836,11 @@ msgstr "" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" -msgstr "" +msgstr "Kansiossa on muitakin saman nimisiä tiedostoja,%sne eroavat ainoastaan kirjaimien koon perusteella:%s%s%sPoistetaanko ne?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" -msgstr "" +msgstr "Kansiosta löytyy jo myös samanlainen (epäselvä) tiedosto samantapaisella tiedostopäätteellä%sTallennettavatiedosto: %s%sSamanlainen (epäselvä) tiedosto: %s%s%sPoistetaanko samanlainen (epäselvä) tiedosto?" #: lazarusidestrconsts.listhereisalreadyabuildmodewiththename msgid "There is already a build mode with the name %s%s%s." @@ -11808,7 +11848,7 @@ msgstr "" #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" -msgstr "" +msgstr "Projektissa on jo %s%s%s-niminen lomake (form)" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." @@ -11844,11 +11884,11 @@ msgstr "" #: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." -msgstr "" +msgstr "Käännösyksikön (unit) %s%s%s nimeä käytetään jo projektissa.%sVoitte kaikesta huolimatta nimetä näin jolloin nimenvaihto tapahtuu,%sMahdollista on myös perua tämä tallennus tai sitten keskeyttää kaikki tallennukset." #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" -msgstr "" +msgstr "Käännösyksikkö (unit) %s löytyy %s:n kahdesta eri käännösyksikön hakupolusta:" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" @@ -11860,7 +11900,7 @@ msgstr "Käännösyksikössä %s käytetään muitakin tiedostoja.%sPäivitetä #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." -msgstr "" +msgstr "Käännösyksikkö (unit) on jo nimeltään %s%s%s. Pascal:ssa tunnukset pitää olla yksilöllisiä" #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" @@ -11880,15 +11920,15 @@ msgstr "" #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" -msgstr "" +msgstr "Tämä vaikuttaa pascal-tiedostolta.%sOn suositeltavaa käyttää pieniä kirjaimia tiedoston nimessä jotta vältytään ongelmilta joissakin tiedostojärjestelmissä.%Vaihdetaanko tiedoston nimi pienillä kirjaimilla kirjoitetuksi?" #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." -msgstr "" +msgstr "Tästä ei voi tehdä omaa aliohjelmaa.%sOle hyvä ja valitse ensin jokin muu koodin osa josta voi tehdä uusi aliohjelma tai metodi" #: lazarusidestrconsts.listhiswillhappencontinue msgid "This will happen:%s%s%sContinue?" -msgstr "" +msgstr "Näin tulee tapahtumaan:%s%s%sJatketaanko?" #: lazarusidestrconsts.listitle msgid "&Title" @@ -11928,12 +11968,12 @@ msgstr "" #: lazarusidestrconsts.listodogoto msgid "Goto" -msgstr "" +msgstr "Mene" #: lazarusidestrconsts.listodoldescription msgctxt "lazarusidestrconsts.listodoldescription" msgid "Description" -msgstr "" +msgstr "Kuvaus" #: lazarusidestrconsts.listodoldone msgid "Done" @@ -11947,11 +11987,11 @@ msgstr "" #: lazarusidestrconsts.listodolistcaption msgctxt "lazarusidestrconsts.listodolistcaption" msgid "ToDo List" -msgstr "" +msgstr "Tehtävälista (ToDo List)" #: lazarusidestrconsts.listodolistgotoline msgid "Goto selected source line" -msgstr "" +msgstr "Mene valitun kohdan osoittamalle lähdekoodiriville" #: lazarusidestrconsts.listodolistoptions msgid "ToDo options..." @@ -11963,12 +12003,12 @@ msgstr "" #: lazarusidestrconsts.listodolistrefresh msgid "Refresh todo items" -msgstr "" +msgstr "Päivitä tehtävälistaa (ToDo-list)" #: lazarusidestrconsts.listodolline msgctxt "lazarusidestrconsts.listodolline" msgid "Line" -msgstr "" +msgstr "Rivi" #: lazarusidestrconsts.listodolowner msgid "Owner" @@ -11981,7 +12021,7 @@ msgstr "" #: lazarusidestrconsts.listofpcpath msgid "Path:" -msgstr "" +msgstr "Tiedostopolku:" #: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" @@ -12001,7 +12041,7 @@ msgstr "" #: lazarusidestrconsts.listops msgid "Tops" -msgstr "" +msgstr "Yläreunat" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." @@ -12022,7 +12062,7 @@ msgstr "" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." -msgstr "" +msgstr "Älä näytä tätä viestiä uudelleen" #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" @@ -12034,11 +12074,11 @@ msgstr "" #: lazarusidestrconsts.lisuegotoline msgid "Goto line :" -msgstr "" +msgstr "Hyppää riville :" #: lazarusidestrconsts.lisuenotfound msgid "Not found" -msgstr "" +msgstr "Ei löytynyt" #: lazarusidestrconsts.lisuereadonly msgid "%s/ReadOnly" @@ -12046,19 +12086,19 @@ msgstr "" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" -msgstr "" +msgstr "Korvataanko tässä esiintyvä %s%s%s%s tekstillä %s%s%s?" #: lazarusidestrconsts.lisuesearching msgid "Searching: %s" -msgstr "" +msgstr "Etsitään tiedostosta: %s" #: lazarusidestrconsts.lisuesearchstringnotfound msgid "Search string '%s' not found!" -msgstr "" +msgstr "Etsittyä merkkijonoa '%s' ei löydetty!" #: lazarusidestrconsts.lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." -msgstr "" +msgstr "Nykyinen editorin kirjaisin ei tue UTF-8 merkistöä, mutta käyttöjärjestelmä tukee sitä. %sTämä merkitsee sitä että ei ASCII merkit voivat näkyä väärin.%sSopivamman kirjaisimen voi valita editorin asetuksista." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" @@ -12066,11 +12106,11 @@ msgstr "" #: lazarusidestrconsts.lisuidbytes msgid "%s bytes" -msgstr "" +msgstr "%s tavua" #: lazarusidestrconsts.lisuidclear msgid "Clear" -msgstr "" +msgstr "Tyhjennä" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" @@ -12078,21 +12118,21 @@ msgstr "" #: lazarusidestrconsts.lisuidinproject msgid "in Project:" -msgstr "" +msgstr "Projektissa:" #: lazarusidestrconsts.lisuidlines msgctxt "lazarusidestrconsts.lisuidlines" msgid "Lines:" -msgstr "" +msgstr "Rivejä:" #: lazarusidestrconsts.lisuidname msgctxt "lazarusidestrconsts.lisuidname" msgid "Name:" -msgstr "" +msgstr "Nimi:" #: lazarusidestrconsts.lisuidno msgid "no" -msgstr "" +msgstr "ei" #: lazarusidestrconsts.lisuidok msgctxt "lazarusidestrconsts.lisuidok" @@ -12105,7 +12145,7 @@ msgstr "" #: lazarusidestrconsts.lisuidsize msgid "Size:" -msgstr "" +msgstr "Koko:" #: lazarusidestrconsts.lisuidsrc msgid "Src" @@ -12122,7 +12162,7 @@ msgstr "" #: lazarusidestrconsts.lisuidyes msgid "yes" -msgstr "" +msgstr "kyllä" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" @@ -12150,7 +12190,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" -msgstr "" +msgstr "Ei voida tehdä varmuuskopiota tiedostosta %s%s%s tiedostoon %s%s%s!" #: lazarusidestrconsts.lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" @@ -12182,15 +12222,15 @@ msgstr "" #: lazarusidestrconsts.lisunabletocopyfile msgid "Unable to copy file" -msgstr "" +msgstr "Tiedoston kopiointi ei onnistunut" #: lazarusidestrconsts.lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" -msgstr "" +msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s" #: lazarusidestrconsts.lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." -msgstr "" +msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s." #: lazarusidestrconsts.lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." @@ -12210,7 +12250,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletocreatefile2 msgid "Unable to create file %s%s%s" -msgstr "" +msgstr "Tiedostoa %s%s%s ei pystytä luomaan" #: lazarusidestrconsts.lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" @@ -12246,7 +12286,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletofindfile msgid "Unable to find file %s%s%s." -msgstr "" +msgstr "Ei löydetä tiedostoa %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test" @@ -12258,7 +12298,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage msgid "Unable to find method. Please fix the error shown in the message window." -msgstr "" +msgstr "Metodia ei löydetty. Ole hyvä ja korjaa kääntäjän viestin mukainen virhe." #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s" @@ -12278,7 +12318,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." -msgstr "" +msgstr "Resurssitiedoston lukeminen ei onnistunut.%sResurssitiedosto pitää olla ensimmäisenä tiedostona %sinitialization osassa.%sEli tämän kaltainen määrittely siellä pitäisi olla {$I %s.lrs}.%sTodennäköisesti kyseessä on syntaksivirhe." #: lazarusidestrconsts.lisunabletoloadpackage msgid "Unable to load package %s%s%s" @@ -12306,7 +12346,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" -msgstr "" +msgstr "Ei pystytä lukemaan tiedostoa %s%s%s!" #: lazarusidestrconsts.lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" @@ -12346,7 +12386,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." -msgstr "" +msgstr "Ei pystytä tekemään muutoksia lähdekoodiin." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" @@ -12362,7 +12402,7 @@ msgstr "" #: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage msgid "Unable to show method. Please fix the error shown in the message window." -msgstr "" +msgstr "Ei pystytä näyttämään metodia. Ole hyvä ja korjaa virhe joka näkyy kääntäjän viestit ikkunassa" #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" @@ -12402,23 +12442,23 @@ msgstr "" #: lazarusidestrconsts.lisunabletowritefile2 msgid "Unable to write file %s%s%s" -msgstr "" +msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut" #: lazarusidestrconsts.lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" -msgstr "" +msgstr "Tallentaminen ei onnistunut tiedostoon %s%s%s%sVirheenä oli: %s" #: lazarusidestrconsts.lisunabletowritefilename msgid "Unable to write file %s%s%s." -msgstr "" +msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut." #: lazarusidestrconsts.lisunabletowritetofile msgid "Unable to write to file %s%s%s!" -msgstr "" +msgstr "Ei pystytä tallettamaan tiedostoon %s%s%s!" #: lazarusidestrconsts.lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" -msgstr "" +msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut" #: lazarusidestrconsts.lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" @@ -12446,7 +12486,7 @@ msgstr "" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" -msgstr "" +msgstr "Tätä Käännösyksikön nimeä käytetään jo projektissa" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." @@ -12458,7 +12498,7 @@ msgstr "" #: lazarusidestrconsts.lisunitnotfound msgid "Unit not found" -msgstr "" +msgstr "Käännösyksikköä (unit) ei löydetty" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" @@ -12474,7 +12514,7 @@ msgstr "" #: lazarusidestrconsts.lisunitsnotfound2 msgid "Units not found" -msgstr "" +msgstr "Käännösyksikköjä (unit) ei löydetty" #: lazarusidestrconsts.lisunusedunits msgid "Unused units" @@ -12538,15 +12578,15 @@ msgstr "" #: lazarusidestrconsts.lisversion msgid "Version" -msgstr "" +msgstr "Versio" #: lazarusidestrconsts.lisvertical msgid "Vertical" -msgstr "" +msgstr "Pystysuunta" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" -msgstr "" +msgstr "Kopio versiotieto leikepöydälle" #: lazarusidestrconsts.lisviewbreakpointproperties msgid "View Breakpoint Properties" @@ -12558,11 +12598,11 @@ msgstr "" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" -msgstr "" +msgstr "Näytä lomakkeen koodi (.lfm)" #: lazarusidestrconsts.lisvsrforwardsearch msgid "Forward Search" -msgstr "" +msgstr "Eteenpäin" #: lazarusidestrconsts.lisvsrresetresultlist msgid "Reset Result List" @@ -12638,7 +12678,7 @@ msgstr "" #: lazarusidestrconsts.liswriteerror msgid "Write Error" -msgstr "" +msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.liswriteerrorfile msgid "Write error: %s%sFile: %s%s%s" @@ -12650,7 +12690,7 @@ msgstr "" #: lazarusidestrconsts.lisxmlfiles msgid "XML files" -msgstr "" +msgstr "XML tiedostot" #: lazarusidestrconsts.lisxmlparsererrorinfileerror msgid "XML parser error in file %s%sError: %s" @@ -12663,7 +12703,7 @@ msgstr "" #: lazarusidestrconsts.locwndsrceditor msgctxt "lazarusidestrconsts.locwndsrceditor" msgid "Source Editor" -msgstr "" +msgstr "Lähdekoodi editori" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" @@ -12695,7 +12735,7 @@ msgstr "" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page" -msgstr "" +msgstr "ulje käytössä oleva välilehti" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" @@ -12780,63 +12820,63 @@ msgstr "" #: lazarusidestrconsts.rslanguageafrikaans msgid "Afrikaans" -msgstr "" +msgstr "afrikaans" #: lazarusidestrconsts.rslanguagearabic msgid "Arabic" -msgstr "" +msgstr "arabia" #: lazarusidestrconsts.rslanguageautomatic msgid "Automatic (or english)" -msgstr "" +msgstr "oletuskieli (tai englanti)" #: lazarusidestrconsts.rslanguagecatalan msgid "Catalan" -msgstr "" +msgstr "katalaani" #: lazarusidestrconsts.rslanguagechinese msgid "Chinese" -msgstr "" +msgstr "kiina" #: lazarusidestrconsts.rslanguagedutch msgid "Dutch" -msgstr "" +msgstr "hollanti" #: lazarusidestrconsts.rslanguageenglish msgid "English" -msgstr "" +msgstr "englanti" #: lazarusidestrconsts.rslanguagefinnish msgid "Finnish" -msgstr "" +msgstr "suomi" #: lazarusidestrconsts.rslanguagefrench msgid "French" -msgstr "" +msgstr "ranska" #: lazarusidestrconsts.rslanguagegerman msgid "German" -msgstr "" +msgstr "saksa" #: lazarusidestrconsts.rslanguagehebrew msgid "Hebrew" -msgstr "" +msgstr "heprea" #: lazarusidestrconsts.rslanguageindonesian msgid "Indonesian" -msgstr "" +msgstr "indonesia" #: lazarusidestrconsts.rslanguageitalian msgid "Italian" -msgstr "" +msgstr "italia" #: lazarusidestrconsts.rslanguagejapanese msgid "Japanese" -msgstr "" +msgstr "japani" #: lazarusidestrconsts.rslanguagelithuanian msgid "Lithuanian" -msgstr "" +msgstr "liettua" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" @@ -12844,15 +12884,15 @@ msgstr "" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" -msgstr "" +msgstr "puola" #: lazarusidestrconsts.rslanguageportugues msgid "Portuguese" -msgstr "" +msgstr "portugali" #: lazarusidestrconsts.rslanguagerussian msgid "Russian" -msgstr "" +msgstr "venäjä" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" @@ -12860,19 +12900,19 @@ msgstr "" #: lazarusidestrconsts.rslanguageslovak msgid "Slovak" -msgstr "" +msgstr "slovakki" #: lazarusidestrconsts.rslanguagespanish msgid "Spanish" -msgstr "" +msgstr "espanja" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" -msgstr "" +msgstr "turkki" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" -msgstr "" +msgstr "ukraina" #: lazarusidestrconsts.rsmajorrevision msgid "Major revision:" @@ -12896,7 +12936,7 @@ msgstr "" #: lazarusidestrconsts.rsremove msgid "&Remove" -msgstr "" +msgstr "Poista" #: lazarusidestrconsts.rsresetfilter msgid "Reset filter" @@ -12912,7 +12952,7 @@ msgstr "" #: lazarusidestrconsts.rsstartanewsearch msgid "Start a new search" -msgstr "" +msgstr "Aloita uusi etsintä" #: lazarusidestrconsts.rsversion msgid "Version:" @@ -12932,11 +12972,11 @@ msgstr "" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" -msgstr "" +msgstr "Ohjevalikon komennot" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" -msgstr "" +msgstr "Komentojen komennot" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" @@ -12948,19 +12988,19 @@ msgstr "" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" -msgstr "" +msgstr "Kursorin siirtokomennot" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" -msgstr "" +msgstr "Tekstin muokkauskomennot" #: lazarusidestrconsts.srkmcatenvmenu msgid "Environment menu commands" -msgstr "" +msgstr "Käyttöliittymä valikon komennot" #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" -msgstr "" +msgstr "Tiedostovalikon komennot" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" @@ -12968,31 +13008,31 @@ msgstr "" #: lazarusidestrconsts.srkmcatmarker msgid "Text marker commands" -msgstr "" +msgstr "Tekstin merkkauskomennot" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" -msgstr "" +msgstr "Komponenttipakettivalikon komennot" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" -msgstr "" +msgstr "Projektivalikon komennot" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" -msgstr "" +msgstr "Suoritavalikon komennot" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" -msgstr "" +msgstr "Tekstin etsintä- ja korvauskomennot" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" -msgstr "" +msgstr "Tekstin valintakomennot" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" -msgstr "" +msgstr "Lähdekoodieditorin komennot" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" @@ -13016,16 +13056,16 @@ msgstr "" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" -msgstr "" +msgstr "Työkalutvalikon komennot" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" -msgstr "" +msgstr "Näytä valikon komennot" #: lazarusidestrconsts.srkmcommand msgctxt "lazarusidestrconsts.srkmcommand" msgid "Command:" -msgstr "" +msgstr "Komento:" #: lazarusidestrconsts.srkmcommand1 msgid " command1 \"" @@ -13205,7 +13245,7 @@ msgstr "" #: lazarusidestrconsts.srkmeccompletecode msgid "Complete code" -msgstr "" +msgstr "Täydennä koodia" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" @@ -13213,7 +13253,7 @@ msgstr "" #: lazarusidestrconsts.srkmeccopy msgid "Copy selection to clipboard" -msgstr "" +msgstr "Kopio valittu leikepöydälle" #: lazarusidestrconsts.srkmeccustomtool msgid "Custom tool %d" @@ -13221,7 +13261,7 @@ msgstr "" #: lazarusidestrconsts.srkmeccut msgid "Cut selection to clipboard" -msgstr "" +msgstr "Leikkaa valittu leikepöydälle" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" @@ -13229,19 +13269,19 @@ msgstr "" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" -msgstr "" +msgstr "Poista kursorin osoittama kirjain" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" -msgstr "" +msgstr "Poista kirjaimet kursorin osoittamasta paikasta rivin loppuun asti" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" -msgstr "" +msgstr "Poista edellinen kirjain" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" -msgstr "" +msgstr "Poista edellinen sana" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" @@ -13249,12 +13289,12 @@ msgstr "" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" -msgstr "" +msgstr "Poista seuraava sana" #: lazarusidestrconsts.srkmecdiff msgctxt "lazarusidestrconsts.srkmecdiff" msgid "Diff" -msgstr "" +msgstr "Eroavuudet" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" @@ -13274,7 +13314,7 @@ msgstr "" #: lazarusidestrconsts.srkmecextractproc msgid "Extract procedure" -msgstr "" +msgstr "Tee valitusta lohkosta aliohjelma" #: lazarusidestrconsts.srkmecexttool msgid "External tool %d" @@ -13298,23 +13338,23 @@ msgstr "" #: lazarusidestrconsts.srkmecfinddeclaration msgid "Find declaration" -msgstr "" +msgstr "Etsi määrittely" #: lazarusidestrconsts.srkmecfindidentifierrefs msgid "Find identifier references" -msgstr "" +msgstr "Etsi tunnisteiden nimiä" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in files" -msgstr "" +msgstr "Etsi tiedostoista" #: lazarusidestrconsts.srkmecfindnext msgid "Find next" -msgstr "" +msgstr "Etsi seuraava" #: lazarusidestrconsts.srkmecfindnextwordoccurrence msgid "Find next word occurrence" -msgstr "" +msgstr "Etsi sanan seuraava esiintymiskohta" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find overloads" @@ -13322,11 +13362,11 @@ msgstr "" #: lazarusidestrconsts.srkmecfindprevious msgid "Find previous" -msgstr "" +msgstr "Etsi edellinen" #: lazarusidestrconsts.srkmecfindprevwordoccurrence msgid "Find previous word occurrence" -msgstr "" +msgstr "Etsi sanan edellinen esiintymiskohta" #: lazarusidestrconsts.srkmecfindproceduredefinition msgid "Find procedure definiton" @@ -13354,7 +13394,7 @@ msgstr "" #: lazarusidestrconsts.srkmecgotolinenumber msgid "Go to line number" -msgstr "" +msgstr "Siirry riville" #: lazarusidestrconsts.srkmecgotomarker msgid "Go to Marker %d" @@ -13382,35 +13422,35 @@ msgstr "" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" -msgstr "" +msgstr "Aseta CVS:n avainsana Author" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" -msgstr "" +msgstr "Aseta CVS:n avainsana Date" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" -msgstr "" +msgstr "Aseta CVS:n avainsana Header" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" -msgstr "" +msgstr "Aseta CVS:n avainsana ID" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" -msgstr "" +msgstr "Aseta CVS:n avainsana Log" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" -msgstr "" +msgstr "Aseta CVS:n avainsana Name" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" -msgstr "" +msgstr "Aseta CVS:n avainsana Revision" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" -msgstr "" +msgstr "Aseta CVS:n avainsana Source" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" @@ -13430,7 +13470,7 @@ msgstr "" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" -msgstr "" +msgstr "Rivinvaihto ilman kursorinsiirtoa" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" @@ -13454,11 +13494,11 @@ msgstr "" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" -msgstr "" +msgstr "Rivinvaihto" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" -msgstr "" +msgstr "Siirrä kursori rivin loppuun" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" @@ -13466,7 +13506,7 @@ msgstr "" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" -msgstr "" +msgstr "Siirrä kursori rivin alkuun" #: lazarusidestrconsts.srkmecmakeresourcestring msgid "Make resource string" @@ -13478,7 +13518,7 @@ msgstr "" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" -msgstr "" +msgstr "Siirry vasemmalla olevalle välilehdelle" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" @@ -13486,7 +13526,7 @@ msgstr "" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" -msgstr "" +msgstr "Siirry oikealla olevalle välilehdelle" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" @@ -13498,7 +13538,7 @@ msgstr "" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" -msgstr "" +msgstr "Mene seuraavalle välilehdelle" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" @@ -13506,7 +13546,7 @@ msgstr "" #: lazarusidestrconsts.srkmecopenfileatcursor msgid "Open file at cursor" -msgstr "" +msgstr "Avaa kohdistimen osoittama tiedosto" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" @@ -13538,7 +13578,7 @@ msgstr "" #: lazarusidestrconsts.srkmecpaste msgid "Paste clipboard to current position" -msgstr "" +msgstr "Liitä leikepöydältä" #: lazarusidestrconsts.srkmecpause msgid "pause program" @@ -13550,11 +13590,11 @@ msgstr "" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" -msgstr "" +msgstr "Mene edelliselle välilehdelle" #: lazarusidestrconsts.srkmecprocedurelist msgid "Procedure List ..." -msgstr "" +msgstr "Aliohjelmien ja funktioiden luettelo ..." #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" @@ -13566,7 +13606,7 @@ msgstr "" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove empty methods" -msgstr "" +msgstr "Poista tyhjät metodit" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove unused units" @@ -13574,7 +13614,7 @@ msgstr "" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename identifier" -msgstr "" +msgstr "Vaihda tunnisteiden nimiä" #: lazarusidestrconsts.srkmecreplace msgid "Replace text" @@ -13619,7 +13659,7 @@ msgstr "" #: lazarusidestrconsts.srkmecselectall msgctxt "lazarusidestrconsts.srkmecselectall" msgid "Select All" -msgstr "" +msgstr "Valitse kaikki" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" @@ -13875,7 +13915,7 @@ msgstr "" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" -msgstr "" +msgstr "Näytä komponenttimuokkain" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" @@ -13923,7 +13963,7 @@ msgstr "" #: lazarusidestrconsts.srkmecviewtodolist msgid "View todo list" -msgstr "" +msgstr "Näytä tehtävälista (ToDo List)" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" @@ -13943,11 +13983,11 @@ msgstr "" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" -msgstr "" +msgstr "Siirrä kursori sanan vasemmalle puolelle (eteen)" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" -msgstr "" +msgstr "Siirrä kursori sanan oikealle puolelle (loppuun)" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" @@ -13955,7 +13995,7 @@ msgstr "" #: lazarusidestrconsts.srkmeditkeys msgid "Edit Keys" -msgstr "" +msgstr "Muokkaa näppäinten merkityksiä" #: lazarusidestrconsts.srkmgrabkey msgid "Grab key" @@ -13967,7 +14007,7 @@ msgstr "" #: lazarusidestrconsts.srkmkey msgid "Key (or 2 keys combination)" -msgstr "" +msgstr "Näppäin (tai näppäinpainallusten yhdistelmä)" #: lazarusidestrconsts.srkmpresskey msgid "Please press a key ..." @@ -13975,15 +14015,15 @@ msgstr "" #: lazarusidestrconsts.uefilerocap msgid "File is readonly" -msgstr "" +msgstr "Tiedosto on vain luettavissa" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" -msgstr "" +msgstr "Tiedosto \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." -msgstr "" +msgstr "\" ei voida tallentaa." #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" @@ -13991,7 +14031,7 @@ msgstr "" #: lazarusidestrconsts.uembookmarkn msgid "Bookmark" -msgstr "" +msgstr "Kirjainmerkki" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" @@ -13999,72 +14039,74 @@ msgstr "" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" -msgstr "" +msgstr "Sulje välilehti" #: lazarusidestrconsts.uemcompletecode msgctxt "lazarusidestrconsts.uemcompletecode" msgid "Complete Code" -msgstr "" +msgstr "Täydennä koodia" #: lazarusidestrconsts.uemcopy msgctxt "lazarusidestrconsts.uemcopy" msgid "Copy" -msgstr "" +msgstr "Kopioi" #: lazarusidestrconsts.uemcopyfilename +#, fuzzy +#| msgid "Copy filename" msgid "Copy Filename" -msgstr "" +msgstr "Kopio tiedoston nimi leikepöydälle" #: lazarusidestrconsts.uemcut msgctxt "lazarusidestrconsts.uemcut" msgid "Cut" -msgstr "" +msgstr "Leikkaa" #: lazarusidestrconsts.uemdebugword msgid "Debug" -msgstr "" +msgstr "Virheenjäljitys" #: lazarusidestrconsts.uemeditorproperties msgid "Editor properties" -msgstr "" +msgstr "Editorin asetukset" #: lazarusidestrconsts.uemencloseselection msgctxt "lazarusidestrconsts.uemencloseselection" msgid "Enclose Selection" -msgstr "" +msgstr "Lauserakenteen lisäys" #: lazarusidestrconsts.uemencoding msgid "Encoding" -msgstr "" +msgstr "Merkistön koodaus" #: lazarusidestrconsts.uemextractproc msgctxt "lazarusidestrconsts.uemextractproc" msgid "Extract Procedure" -msgstr "" +msgstr "Tee valitusta lohkosta aliohjelma" #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" -msgstr "" +msgstr "&Etsi määrittely" #: lazarusidestrconsts.uemfindidentifierreferences msgid "Find Identifier References" -msgstr "" +msgstr "Etsi tunnisteiden nimiä" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" -msgstr "" +msgstr "&Siirry kirjaimerkkiin" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" -msgstr "" +msgstr "Syntaksin korostus" #: lazarusidestrconsts.ueminserttodo msgid "Insert Todo" -msgstr "" +msgstr "Lisää tehtävälista merkintä (ToDo)" #: lazarusidestrconsts.ueminvertassignment msgid "Invert Assignment" -msgstr "" +msgstr "Käännä sijoitus päinvastaiseksi" #: lazarusidestrconsts.uemmovepageleft msgid "Move page left" @@ -14088,16 +14130,16 @@ msgstr "" #: lazarusidestrconsts.uemodified msgid "Modified" -msgstr "" +msgstr "Muutettu" #: lazarusidestrconsts.uemopenfileatcursor msgid "&Open file at cursor" -msgstr "" +msgstr "&Avaa kohdistimen osoittama tiedosto" #: lazarusidestrconsts.uempaste msgctxt "lazarusidestrconsts.uempaste" msgid "Paste" -msgstr "" +msgstr "Liitä" #: lazarusidestrconsts.uemprevbookmark msgid "Goto previous Bookmark" @@ -14105,19 +14147,19 @@ msgstr "" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" -msgstr "" +msgstr "Siirry aliohjelman tai funktion esittelyn ja toteuksen välillä" #: lazarusidestrconsts.uemreadonly msgid "Read Only" -msgstr "" +msgstr "Vain luettavissa" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" -msgstr "" +msgstr "Koodin uudelleen muokkaus" #: lazarusidestrconsts.uemrenameidentifier msgid "Rename Identifier" -msgstr "" +msgstr "Vaihda tunnisteen nimeä" #: lazarusidestrconsts.uemruntocursor msgid "&Run to Cursor" @@ -14125,7 +14167,7 @@ msgstr "" #: lazarusidestrconsts.uemsetbookmark msgid "&Set Bookmark" -msgstr "" +msgstr "&Merkitse kirjainmerkiksi" #: lazarusidestrconsts.uemsetfreebookmark msgctxt "lazarusidestrconsts.uemsetfreebookmark" @@ -14134,11 +14176,11 @@ msgstr "" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" -msgstr "" +msgstr "Näytä rivinumerot" #: lazarusidestrconsts.uemshowunitinfo msgid "Unit Info" -msgstr "" +msgstr "Käännösyksikön tiedot" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" @@ -14166,17 +14208,17 @@ msgstr "" #: lazarusidestrconsts.uepins msgid "INS" -msgstr "" +msgstr "Lisää" #: lazarusidestrconsts.uepovr msgid "OVR" -msgstr "" +msgstr "Korvaa" #: lazarusidestrconsts.uepreadonly msgid "Readonly" -msgstr "" +msgstr "Vain luettavissa" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" -msgstr "" +msgstr "Versiotiedot"