diff --git a/.gitattributes b/.gitattributes index 6d8a15ce36..ab6b8ca189 100644 --- a/.gitattributes +++ b/.gitattributes @@ -16,6 +16,7 @@ components/cgi/ide/cgilazide.pas svneol=native#text/plain components/cgi/ide/cgilazideintf.pas svneol=native#text/pascal components/cgi/ide/lib/README.txt svneol=native#text/plain components/cgi/languages/cgimodules.de.po svneol=native#text/plain +components/cgi/languages/cgimodules.lt.po svneol=native#text/plain components/cgi/languages/cgimodules.pb.po svneol=native#text/plain components/cgi/languages/cgimodules.pl.po svneol=native#text/plain components/cgi/languages/cgimodules.po svneol=native#text/plain @@ -133,6 +134,7 @@ components/codetools/languages/codetoolsstrconsts.fi.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.fr.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.id.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.it.po svneol=native#text/plain +components/codetools/languages/codetoolsstrconsts.lt.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.nl.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.pb.po svneol=native#text/plain components/codetools/languages/codetoolsstrconsts.pl.po svneol=native#text/plain @@ -237,6 +239,7 @@ components/h2pas/idetextconvlistedit.lfm svneol=native#text/plain components/h2pas/idetextconvlistedit.lrs svneol=native#text/plain components/h2pas/idetextconvlistedit.pas svneol=native#text/plain components/h2pas/languages/h2passtrconsts.de.po svneol=native#text/plain +components/h2pas/languages/h2passtrconsts.lt.po svneol=native#text/plain components/h2pas/languages/h2passtrconsts.pb.po svneol=native#text/plain components/h2pas/languages/h2passtrconsts.pl.po svneol=native#text/plain components/h2pas/languages/h2passtrconsts.po svneol=native#text/plain @@ -286,6 +289,7 @@ components/memds/frmselectdataset.lrs svneol=native#text/pascal components/memds/frmselectdataset.pp svneol=native#text/pascal components/memds/languages/frmselectdataset.de.po svneol=native#text/plain components/memds/languages/frmselectdataset.fr.po svneol=native#text/plain +components/memds/languages/frmselectdataset.lt.po svneol=native#text/plain components/memds/languages/frmselectdataset.pb.po svneol=native#text/plain components/memds/languages/frmselectdataset.pl.po svneol=native#text/plain components/memds/languages/frmselectdataset.po svneol=native#text/plain @@ -338,6 +342,7 @@ components/popupnotifier/popupnotifierlaz.lpk svneol=native#text/plain components/popupnotifier/popupnotifierlaz.pas svneol=native#text/plain components/prettyformat/languages/pfidesource.de.po svneol=native#text/plain components/prettyformat/languages/pfidesource.fr.po svneol=native#text/plain +components/prettyformat/languages/pfidesource.lt.po svneol=native#text/plain components/prettyformat/languages/pfidesource.pb.po svneol=native#text/plain components/prettyformat/languages/pfidesource.pl.po svneol=native#text/plain components/prettyformat/languages/pfidesource.po svneol=native#text/plain @@ -362,6 +367,7 @@ components/printers/design/ideprinting.pas svneol=native#text/plain components/printers/design/languages/ideprinting.de.po svneol=native#text/plain components/printers/design/languages/ideprinting.fi.po svneol=native#text/plain components/printers/design/languages/ideprinting.fr.po svneol=native#text/plain +components/printers/design/languages/ideprinting.lt.po svneol=native#text/plain components/printers/design/languages/ideprinting.pb.po svneol=native#text/plain components/printers/design/languages/ideprinting.pl.po svneol=native#text/plain components/printers/design/languages/ideprinting.po svneol=native#text/plain @@ -428,6 +434,7 @@ components/projecttemplates/idetemplateproject.pp svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.de.po svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.fr.po svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.it.po svneol=native#text/plain +components/projecttemplates/languages/frmtemplatevariables.lt.po svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.pb.po svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.pl.po svneol=native#text/plain components/projecttemplates/languages/frmtemplatevariables.po svneol=native#text/plain @@ -435,12 +442,14 @@ components/projecttemplates/languages/frmtemplatevariables.ru.po svneol=native#t components/projecttemplates/languages/idetemplateproject.de.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.fr.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.it.po svneol=native#text/plain +components/projecttemplates/languages/idetemplateproject.lt.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.pb.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.pl.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.po svneol=native#text/plain components/projecttemplates/languages/idetemplateproject.ru.po svneol=native#text/plain components/projecttemplates/languages/projecttemplates.de.po svneol=native#text/plain components/projecttemplates/languages/projecttemplates.it.po svneol=native#text/plain +components/projecttemplates/languages/projecttemplates.lt.po svneol=native#text/plain components/projecttemplates/languages/projecttemplates.pb.po svneol=native#text/plain components/projecttemplates/languages/projecttemplates.pl.po svneol=native#text/plain components/projecttemplates/languages/projecttemplates.po svneol=native#text/plain @@ -590,6 +599,7 @@ components/synedit/languages/synedit.fi.po svneol=native#text/plain components/synedit/languages/synedit.fr.po svneol=native#text/plain components/synedit/languages/synedit.id.po svneol=native#text/plain components/synedit/languages/synedit.it.po svneol=native#text/plain +components/synedit/languages/synedit.lt.po svneol=native#text/plain components/synedit/languages/synedit.nl.po svneol=native#text/plain components/synedit/languages/synedit.pb.po svneol=native#text/plain components/synedit/languages/synedit.pl.po svneol=native#text/plain @@ -604,6 +614,7 @@ components/synedit/languages/synmacrorecorder.de.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.fr.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.id.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.it.po svneol=native#text/plain +components/synedit/languages/synmacrorecorder.lt.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.pb.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.pl.po svneol=native#text/plain components/synedit/languages/synmacrorecorder.pliso.po svneol=native#text/plain @@ -653,10 +664,12 @@ components/synedit/synregexpr.pas svneol=native#text/pascal components/synedit/syntextdrawer.pp svneol=native#text/pascal components/synunihighlighter/README.txt svneol=native#text/plain components/synunihighlighter/languages/synunidesigner.de.po svneol=native#text/plain +components/synunihighlighter/languages/synunidesigner.lt.po svneol=native#text/plain components/synunihighlighter/languages/synunidesigner.pl.po svneol=native#text/plain components/synunihighlighter/languages/synunidesigner.po svneol=native#text/plain components/synunihighlighter/languages/synunidesigner.ru.po svneol=native#text/plain components/synunihighlighter/languages/synunireg.de.po svneol=native#text/plain +components/synunihighlighter/languages/synunireg.lt.po svneol=native#text/plain components/synunihighlighter/languages/synunireg.pl.po svneol=native#text/plain components/synunihighlighter/languages/synunireg.po svneol=native#text/plain components/synunihighlighter/languages/synunireg.ru.po svneol=native#text/plain @@ -685,6 +698,7 @@ components/tdbf/Makefile.fpc svneol=native#text/plain components/tdbf/dbflaz.lpk svneol=native#text/pascal components/tdbf/dbflaz.pas svneol=native#text/pascal components/tdbf/languages/registerdbf.de.po svneol=native#text/plain +components/tdbf/languages/registerdbf.lt.po svneol=native#text/plain components/tdbf/languages/registerdbf.pb.po svneol=native#text/plain components/tdbf/languages/registerdbf.pl.po svneol=native#text/plain components/tdbf/languages/registerdbf.po svneol=native#text/plain @@ -729,10 +743,12 @@ components/turbopower_ipro/ipmsg.pas svneol=native#text/pascal components/turbopower_ipro/ipstrms.pas svneol=native#text/pascal components/turbopower_ipro/iputils.pas svneol=native#text/pascal components/turbopower_ipro/languages/ipconst.de.po svneol=native#text/plain +components/turbopower_ipro/languages/ipconst.lt.po svneol=native#text/plain components/turbopower_ipro/languages/ipconst.pb.po svneol=native#text/plain components/turbopower_ipro/languages/ipconst.po svneol=native#text/plain components/turbopower_ipro/languages/ipconst.ru.po svneol=native#text/plain components/turbopower_ipro/languages/iputils.de.po svneol=native#text/plain +components/turbopower_ipro/languages/iputils.lt.po svneol=native#text/plain components/turbopower_ipro/languages/iputils.pl.po svneol=native#text/plain components/turbopower_ipro/languages/iputils.po svneol=native#text/plain components/turbopower_ipro/languages/iputils.ru.po svneol=native#text/plain @@ -1147,10 +1163,12 @@ examples/codepageconverter/filefind/filefindlaz.lpk svneol=native#text/pascal examples/codepageconverter/filefind/filefindlaz.pas svneol=native#text/pascal examples/codepageconverter/filefind/tfilesearch.xpm -text svneol=native#image/x-xpixmap examples/codepageconverter/languages/lazconverter.de.po svneol=native#text/plain +examples/codepageconverter/languages/lazconverter.lt.po svneol=native#text/plain examples/codepageconverter/languages/lazconverter.pb.po svneol=native#text/plain examples/codepageconverter/languages/lazconverter.po svneol=native#text/plain examples/codepageconverter/languages/lazconverter.ru.po svneol=native#text/plain examples/codepageconverter/languages/mainunit.de.po svneol=native#text/plain +examples/codepageconverter/languages/mainunit.lt.po svneol=native#text/plain examples/codepageconverter/languages/mainunit.pb.po svneol=native#text/plain examples/codepageconverter/languages/mainunit.po svneol=native#text/plain examples/codepageconverter/lazconverter.lpi svneol=native#text/plain @@ -1737,6 +1755,7 @@ ideintf/languages/objinspstrconsts.fr.po svneol=native#text/plain ideintf/languages/objinspstrconsts.id.po svneol=native#text/plain ideintf/languages/objinspstrconsts.it.po svneol=native#text/plain ideintf/languages/objinspstrconsts.ja.po svneol=native#text/plain +ideintf/languages/objinspstrconsts.lt.po svneol=native#text/plain ideintf/languages/objinspstrconsts.nl.po svneol=native#text/plain ideintf/languages/objinspstrconsts.pb.po svneol=native#text/plain ideintf/languages/objinspstrconsts.pl.po svneol=native#text/plain @@ -2253,6 +2272,7 @@ install/lazarus.desktop svneol=native#text/plain languages/README.txt svneol=native#text/plain languages/installerstrconsts.de.po svneol=native#text/plain languages/installerstrconsts.fr.po svneol=native#text/plain +languages/installerstrconsts.lt.po svneol=native#text/plain languages/installerstrconsts.nl.po svneol=native#text/plain languages/installerstrconsts.pb.po svneol=native#text/plain languages/installerstrconsts.pl.po svneol=native#text/plain @@ -2269,6 +2289,7 @@ languages/lazaruside.he.po svneol=native#text/plain languages/lazaruside.id.po svneol=native#text/plain languages/lazaruside.it.po svneol=native#text/plain languages/lazaruside.ja.po svneol=native#text/plain +languages/lazaruside.lt.po svneol=native#text/plain languages/lazaruside.nl.po svneol=native#text/plain languages/lazaruside.pb.po svneol=native#text/plain languages/lazaruside.pl.po svneol=native#text/plain @@ -2858,6 +2879,7 @@ lcl/languages/lclstrconsts.fi.po svneol=native#text/plain lcl/languages/lclstrconsts.fr.po svneol=native#text/plain lcl/languages/lclstrconsts.id.po svneol=native#text/plain lcl/languages/lclstrconsts.it.po svneol=native#text/plain +lcl/languages/lclstrconsts.lt.po svneol=native#text/plain lcl/languages/lclstrconsts.nl.po svneol=native#text/plain lcl/languages/lclstrconsts.pb.po svneol=native#text/plain lcl/languages/lclstrconsts.pl.po svneol=native#text/plain diff --git a/components/cgi/languages/cgimodules.lt.po b/components/cgi/languages/cgimodules.lt.po new file mode 100644 index 0000000000..f98685f172 --- /dev/null +++ b/components/cgi/languages/cgimodules.lt.po @@ -0,0 +1,21 @@ +# translation of cgimodules.po to Lithuanian +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 21:27+0300\n" +"Project-Id-Version: cgimodules\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" + +#: cgimodules:serrnorequesthandler +msgid "%s: No CGI request handler set." +msgstr "%s: nenurodyta CGI užklausų tvarkyklė" + +#: cgimodules:serrnomainmodule +msgid "No CGI datamodule to handle CGI request." +msgstr "Nėra CGI \"DataModule\" kad būtų galima apdoroti CGI užklausą." + diff --git a/components/codetools/languages/codetoolsstrconsts.lt.po b/components/codetools/languages/codetoolsstrconsts.lt.po new file mode 100644 index 0000000000..52d7a9b3f6 --- /dev/null +++ b/components/codetools/languages/codetoolsstrconsts.lt.po @@ -0,0 +1,773 @@ +# translation of codetoolsstrconsts.po to Lithuanian +# Header entry was created by KBabel! +# +#: codetoolsstrconsts:ctsothercompilerdefines +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 21:19+0300\n" +"Project-Id-Version: codetoolsstrconsts\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: codetoolsstrconsts:ctsothercompilerdefines +msgid "%s Compiler Defines" +msgstr "%s kompiliatoriaus apibrėžtys" + +#: codetoolsstrconsts:ctsnameddirectory +msgid "%s Directory" +msgstr "%s katalogas" + +#: codetoolsstrconsts:ctsnamedproject +msgid "%s Project" +msgstr "%s projektas" + +#: codetoolsstrconsts:ctsstrexpectedbutatomfound +msgid "%s expected, but %s found" +msgstr "%s tikėtasi, tačiau rasta %s" + +#: codetoolsstrconsts:ctsfilehascircularsymlink +msgid "%s has a circular symbolic link" +msgstr "%s turi uždarą simbolinį saitą" + +#: codetoolsstrconsts:ctsfileisnotexecutable +msgid "%s is not executable" +msgstr "%s nėra vykdomasis failas" + +#: codetoolsstrconsts:ctsawithoutb +msgid "%s without %s" +msgstr "%s be %s" + +#: codetoolsstrconsts:ctsunknownmainfilename +msgid "(unknown mainfilename)" +msgstr "(nežinomas pagrindinio failo vardas)" + +#: codetoolsstrconsts:ctsunknownsubdescriptor +msgid "(unknown subdescriptor %s)" +msgstr "(nežinomas vidinis deskriptorius %s)" + +#: codetoolsstrconsts:ctspointhintprocstartat +msgid ". Hint: proc start at " +msgstr ". Užuomina: procedūros pradžia ties " + +#: codetoolsstrconsts:ctspointstartat +msgid ". start at " +msgstr ". pradžia ties " + +#: codetoolsstrconsts:ctssemicolonafterpropspecmissing +msgid "; expected after \"%s\" property specifier, but %s found" +msgstr "; tikėtasi po \"%s\" savybės specifikatoriaus, tačiau rasta %s" + +#: codetoolsstrconsts:ctsanonymdefinitionsarenotallowed +msgid "Anonymous %s definitions are not allowed" +msgstr "Anoniminės %s apibrėžtys nėra leidžiamos" + +#: codetoolsstrconsts:ctscpudirectory +msgid "CPU directory" +msgstr "CPU katalogas" + +#: codetoolsstrconsts:ctsclasssnotfound +msgid "Class %s not found" +msgstr "Klasė %s nerasta" + +#: codetoolsstrconsts:ctscommandlineparameters +msgid "Command line parameters" +msgstr "Komandinės eilutės parametrai" + +#: codetoolsstrconsts:ctscommentendnotfound +msgid "Comment end not found" +msgstr "Nerastas komentaro galas" + +#: codetoolsstrconsts:ctscompiledsrcpath +msgid "Compiled SrcPath" +msgstr "Kompiliuotas \"SrcPath\"" + +#: codetoolsstrconsts:ctscompiler +msgid "Compiler" +msgstr "Kompiliatorius" + +#: codetoolsstrconsts:ctscomponentsdirectory +msgid "Components Directory" +msgstr "Komponenčių katalogas" + +#: codetoolsstrconsts:ctsconverterdirectory +msgid "Converter Directory" +msgstr "Konverterio katalogas" + +#: codetoolsstrconsts:ctscustomcomponentsdirectory +msgid "Custom Components Directory" +msgstr "Naudotojo komponenčių katalogas" + +#: codetoolsstrconsts:ctsdebuggerdirectory +msgid "Debugger Directory" +msgstr "Derintuvės katalogas" + +#: codetoolsstrconsts:ctsdefaultppc386sourceoperatingsystem +msgid "Default ppc386 source Operating System" +msgstr "Numatyta ppc386 pirminė operacinė sistema" + +#: codetoolsstrconsts:ctsdefaultppc386source2operatingsystem +msgid "Default ppc386 source Operating System 2" +msgstr "Numatyta ppc386 pirminė operacinė sistema 2" + +#: codetoolsstrconsts:ctsdefaultppc386symbol +msgid "Default ppc386 symbol" +msgstr "Numatytas ppc386 simbolis" + +#: codetoolsstrconsts:ctsdefaultppc386targetoperatingsystem +msgid "Default ppc386 target Operating System" +msgstr "Numatyta ppc386 paskirties operacinė sistema" + +#: codetoolsstrconsts:ctsdefaultppc386targetprocessor +msgid "Default ppc386 target processor" +msgstr "Numatytas ppc386 paskirties procesorius" + +#: codetoolsstrconsts:ctsdefine +msgid "Define " +msgstr "Apibrėžti " + +#: codetoolsstrconsts:ctsdefinemacroname +msgid "Define Macro %s" +msgstr "Apibrėžti makrokomandą %s" + +#: codetoolsstrconsts:ctsdefinemacrocarbon1 +msgid "Define macro carbon1" +msgstr "Apibrėžti makrokomandą carbon1" + +#: codetoolsstrconsts:ctsdefinemacrogtk1 +msgid "Define macro gtk1" +msgstr "Apibrėžti makrokomandą gtk1" + +#: codetoolsstrconsts:ctsdefinemacrogtk2 +msgid "Define macro gtk2" +msgstr "Apibrėžti makrokomandą gtk2" + +#: codetoolsstrconsts:ctsdefinemacroqt1 +msgid "Define macro qt1" +msgstr "Apibrėžti makrokomandą qt1" + +#: codetoolsstrconsts:ctsdefinemacrowince1 +msgid "Define macro wince1" +msgstr "Apibrėžti makrokomandą wince1" + +#: codetoolsstrconsts:ctsdefineprocessortype +msgid "Define processor type" +msgstr "Apibrėžti procesoriaus tipą" + +#: codetoolsstrconsts:ctsdefsforlazarussources +msgid "Definitions for the Lazarus Sources" +msgstr "Lazarus pirminio kodo apibrėžtys" + +#: codetoolsstrconsts:ctsdesignerdirectory +msgid "Designer Directory" +msgstr "Konstruktoriaus katalogas" + +#: codetoolsstrconsts:ctsdesignerunitsdirectory +msgid "Designer Units" +msgstr "Konstruktoriaus moduliai" + +#: codetoolsstrconsts:ctsdoceditordirectory +msgid "Doc Editor Directory" +msgstr "Dokumentacijos redaktoriaus katalogas" + +#: codetoolsstrconsts:ctsendofsourcenotfound +msgid "End of source not found" +msgstr "Nerasta pirminio kodo pabaiga" + +#: codetoolsstrconsts:ctsforward +msgid "Forward" +msgstr "Priešakis" + +#: codetoolsstrconsts:ctsforwardclassdefinitionnotresolved +msgid "Forward class definition not resolved: %s" +msgstr "Nenustatyta priešakinė klasės apibrėžtis: %s" + +#: codetoolsstrconsts:ctsfreepascalcompilerinitialmacros +msgid "Free Pascal Compiler initial macros" +msgstr "FreePascal kompiliatoriaus pradinės makrokomandos" + +#: codetoolsstrconsts:ctsfreepascalcomponentlibrary +msgid "Free Pascal Component Library" +msgstr "FreePascal komponentų biblioteka" + +#: codetoolsstrconsts:ctsfreepascalsourcedir +msgid "Free Pascal Source Directory" +msgstr "FreePascal pirminio kodo biblioteka" + +#: codetoolsstrconsts:ctsfreepascalsourcesplusdesc +msgid "Free Pascal Sources, %s" +msgstr "FreePascal pirminis kodas, %s" + +#: codetoolsstrconsts:ctsidedirectory +msgid "IDE Directory" +msgstr "IKA katalogas" + +#: codetoolsstrconsts:ctsideintfdirectory +msgid "IDEIntf Directory" +msgstr "IDEIntf katalogas" + +#: codetoolsstrconsts:ctsidentifieralreadydefined +msgid "Identifier %s already defined" +msgstr "Apibrėžtis %s jau yra apibrėžta" + +#: codetoolsstrconsts:ctsiflclwidgettypeequalsgtk2 +msgid "If LCLWidgetType=gtk2 then" +msgstr "Jei LCLWidgetType=gtk2, tada" + +#: codetoolsstrconsts:ctsiftargetosisnotsrcos +msgid "If TargetOS<>SrcOS" +msgstr "Jei paskirties OS <> pirminė OS" + +#: codetoolsstrconsts:ctsiftargetosisnotsrcos2 +msgid "If TargetOS<>SrcOS2" +msgstr "Jei paskirties OS <> pirminė OS2" + +#: codetoolsstrconsts:ctsiftargetosisnotwin32 +msgid "If TargetOS<>win32 then" +msgstr "Jei paskirties OS <> win32, tada" + +#: codetoolsstrconsts:ctsifdeflinux +msgid "IfDef Linux" +msgstr "IfDef Linux" + +#: codetoolsstrconsts:ctsifdefwindows +msgid "IfDef Windows" +msgstr "IfDef Windows" + +#: codetoolsstrconsts:ctsincludecircledetected +msgid "Include circle detected" +msgstr "Aptiktas įdėjimų žiedas" + +#: codetoolsstrconsts:ctsinstalldirectory +msgid "Install Directory" +msgstr "Diegimo katalogas" + +#: codetoolsstrconsts:ctsinstallerdirectories +msgid "Installer directories" +msgstr "Diegimo programos katalogai" + +#: codetoolsstrconsts:ctsjitformdirectory +msgid "JITForm Directory" +msgstr "JITForm katalogas" + +#: codetoolsstrconsts:ctslazarussources +msgid "Lazarus Sources" +msgstr "Lazarus pirminis kodas" + +#: codetoolsstrconsts:ctsnestedcommentson +msgid "Nested Comments On" +msgstr "Įdėtiniai komentarai įgalinti" + +#: codetoolsstrconsts:ctsnoscanneravailable +msgid "No scanner available" +msgstr "Nėra žvalgytuvo" + +#: codetoolsstrconsts:ctsnoscannerfound +msgid "No scanner found for \"%s\". If this is an include file, please open the main source first." +msgstr "\"%s\" skirtas žvalgytuvas nerastas. Jei tai įdedamasis failas, pirma atverkite pagrindinį pirminį kodą." + +#: codetoolsstrconsts:ctspackagedirectories +msgid "Package directories" +msgstr "Paketų katalogai" + +#: codetoolsstrconsts:ctspackagerdirectory +msgid "Packager Directory" +msgstr "Paketų kūrėjo katalogas" + +#: codetoolsstrconsts:ctspackagerregistrationdirectory +msgid "Packager Registration Directory" +msgstr "Paketų kūrėjo registravimo katalogas" + +#: codetoolsstrconsts:ctspackagerunitsdirectory +msgid "Packager Units Directory" +msgstr "Paketų kūrėjo modulių katalogas" + +#: codetoolsstrconsts:ctspositionnotinsource +msgid "Position not in source" +msgstr "Pozicija ne pirminiame kode" + +#: codetoolsstrconsts:ctsresetalldefines +msgid "Reset all defines" +msgstr "Atstatyti visas apibrėžtis" + +#: codetoolsstrconsts:ctsruntimelibrary +msgid "Runtime library" +msgstr "Veikos meto biblioteka" + +#: codetoolsstrconsts:ctssourcefilenamesforstandardfpcunits +msgid "Source filenames for the standard fpc units" +msgstr "Pirminiai failų vardai standartiniams FPC moduliams" + +#: codetoolsstrconsts:ctssrcpathinitialization +msgid "SrcPath Initialization" +msgstr "Pirminio kodo kelio inicializacija" + +#: codetoolsstrconsts:ctssyntaxerrorinexpr +msgid "Syntax Error in expression \"%s\"" +msgstr "Išraiškoje \"%s\" yra sintaksės klaida" + +#: codetoolsstrconsts:ctstcodetoolmanagerconsistencycheck +msgid "TCodeToolManager.ConsistencyCheck=%d" +msgstr "TCodeToolManager.ConsistencyCheck=%d" + +#: codetoolsstrconsts:ctstermnotsimple +msgid "Term has no simple type" +msgstr "Termas neturi paprasto tipo" + +#: codetoolsstrconsts:ctstoolsdirectory +msgid "Tools Directory" +msgstr "Įrankių katalogas" + +#: codetoolsstrconsts:ctsunitpathinitialization +msgid "UnitPath Initialization" +msgstr "Modulių kelio inicializacija" + +#: codetoolsstrconsts:ctsunknownfunction +msgid "Unknown function %s" +msgstr "Nežinoma funkcija %s" + +#: codetoolsstrconsts:ctsunparsed +msgid "Unparsed" +msgstr "Neanalizuotas" + +#: codetoolsstrconsts:ctsutilsdirectories +msgid "Utils directories" +msgstr "Paslaugų programų katalogai" + +#: codetoolsstrconsts:ctswidgetdirectory +msgid "Widget Directory" +msgstr "Valdiklių katalogas" + +#: codetoolsstrconsts:ctswordnotfound +msgid "\"%s\" not found" +msgstr "\"%s\" nerastas" + +#: codetoolsstrconsts:ctsclassofdefinitionnotresolved +msgid "\"class of\" definition not resolved: %s" +msgstr "\"class of\" apibrėžtis nenustatyta: %s" + +#: codetoolsstrconsts:ctsendforclassnotfound +msgid "\"end\" for class/object not found" +msgstr "Nerastas klasės/objekto \"end\"" + +#: codetoolsstrconsts:ctsdircomponentdoesnotexistsorisdanglingsymlink +msgid "a directory component in %s does not exist or is a dangling symlink" +msgstr "%s esantis katalogo komponentas neegzistuoja arba jis yra betikslis simbolinis saitas" + +#: codetoolsstrconsts:ctsdircomponentisnotdir +msgid "a directory component in %s is not a directory" +msgstr "%s esantis katalogo komponentas nėra katalogas" + +#: codetoolsstrconsts:ctsaddsdirtoincludepath +msgid "adds %s to IncPath" +msgstr "%s pridės prie įdedamųjų kelio" + +#: codetoolsstrconsts:ctsaddsdirtosourcepath +msgid "adds %s to SrcPath" +msgstr "%s pridės prie pirminio kodo kelio" + +#: codetoolsstrconsts:ctsanlclproject +msgid "an LCL project" +msgstr "LCL projektas" + +#: codetoolsstrconsts:ctsancestorisnotproperty +msgid "ancestor of untyped property is not a property" +msgstr "savybės be tipo protėvis nėra savybė" + +#: codetoolsstrconsts:ctsbasetypeofnotfound +msgid "base type of \"%s\" not found" +msgstr "nerastas \"%s\" bazinis tipas" + +#: codetoolsstrconsts:ctsbinaryoperator +msgid "binary operator" +msgstr "dvejetainis operatorius" + +#: codetoolsstrconsts:ctsbracketnotfound +msgid "bracket %s not found" +msgstr "%s skliaustas nerastas" + +#: codetoolsstrconsts:ctsbracketcloseexpectedbutatomfound +msgid "bracket close expected, but %s found" +msgstr "tikėtasi uždarančiojo skliausto, tačiau aptikta %s" + +#: codetoolsstrconsts:ctsbracketopenexpectedbutatomfound +msgid "bracket open expected, but %s found" +msgstr "tikėtasi atidarančiojo skliausto, tačiau aptikta %s" + +#: codetoolsstrconsts:ctscircleindefinitions +msgid "circle in definitions" +msgstr "žiedinė apibrėžtis" + +#: codetoolsstrconsts:ctsclassnotfound +msgid "class %s%s%s not found" +msgstr "klasė %s%s%s nerasta" + +#: codetoolsstrconsts:ctsclassidentifierexpected +msgid "class identifier expected" +msgstr "tikėtasi klasės identifikatoriaus" + +#: codetoolsstrconsts:ctsclassnodewithoutparentnode +msgid "class node without parent node" +msgstr "klasės mazgas neturi tėvinio mazgo" + +#: codetoolsstrconsts:ctsclasswithoutname +msgid "class without name" +msgstr "klasė be vardo" + +#: codetoolsstrconsts:ctsconstant +msgid "constant" +msgstr "konstanta" + +#: codetoolsstrconsts:ctscursorposoutsideofcode +msgid "cursor pos outside of code" +msgstr "žymeklis už kodo ribų" + +#: codetoolsstrconsts:ctsdefaultclassancestortobjectnotfound +msgid "default class ancestor TObject not found" +msgstr "nerastas klasės protėvis TObject" + +#: codetoolsstrconsts:ctsdefaultinterfaceancestoriinterfacenotfound +msgid "default interface ancestor IInterface not found" +msgstr "nerastas interfeiso protėvis IInterface" + +#: codetoolsstrconsts:ctsdefaultparameterexpectedbutatomfound +msgid "default parameter expected, but %s found" +msgstr "tikėtasi numatyto parametro, tačiau aptikta %s" + +#: codetoolsstrconsts:ctsdefaultpropertynotfound +msgid "default property not found" +msgstr "numatyta savybė nerasta" + +#: codetoolsstrconsts:ctsdefaultspecifierredefined +msgid "default specifier redefined" +msgstr "numatytas specifikatorius apibrėžtas pakartotinai" + +#: codetoolsstrconsts:ctsduplicateidentifier +msgid "duplicate identifier: %s" +msgstr "identifikatorius dubliuojasi: %s" + +#: codetoolsstrconsts:ctselse +msgid "else" +msgstr "kitaip" + +#: codetoolsstrconsts:ctsfpdocsystemon +msgid "enable FPDocSystem" +msgstr "įgalinti FPDocSystem" + +#: codetoolsstrconsts:ctsendforrecordnotfound +msgid "end for record not found" +msgstr "nerasta įrašo pabaiga" + +#: codetoolsstrconsts:ctserrorduringcreationofnewprocbodies +msgid "error during creation of new proc bodies" +msgstr "kuriant procedūrų pagrindines dalis įvyko klaida" + +#: codetoolsstrconsts:ctserrorduringinsertingnewclassparts +msgid "error during inserting new class parts" +msgstr "įterpiant naujas klasės dalis įvyko klaida" + +#: codetoolsstrconsts:ctserrorduringinsertingnewusessection +msgid "error during inserting new units to the main uses section" +msgstr "naujus modulius įterpiant į pagrindinio modulio naudojamų modulių sąrašą įvyko klaida" + +#: codetoolsstrconsts:ctserrorindirectiveexpression +msgid "error in directive expression" +msgstr "klaida direktyvos išraiškoje" + +#: codetoolsstrconsts:ctserrorinparamlist +msgid "error in paramlist" +msgstr "klaida parametrų sąraše" + +#: codetoolsstrconsts:ctsexecuteaccessdeniedforfile +msgid "execute access denied for %s" +msgstr "%s apibrėžtas leidimas startuoti" + +#: codetoolsstrconsts:ctsendofsourceexpectedbutatomfound +msgid "expected end., but %s found" +msgstr "tikėtasi \"end.\", tačiau aptikta %s" + +#: codetoolsstrconsts:ctsexportsclauseonlyallowedinlibraries +msgid "exports clause only allowed in libraries" +msgstr "eksporto sakinys galimas tik bibliotekose" + +#: codetoolsstrconsts:ctsexprtypemustbeclassorrecord +msgid "expression type must be class or record type" +msgstr "išraiškos tipas turi būti klasė arba įrašas" + +#: codetoolsstrconsts:ctsfiledoesnotexists +msgid "file \"%s\" does not exist" +msgstr "failas \"%s\" neegzistuoja" + +#: codetoolsstrconsts:ctsfileisreadonly +msgid "file is read only" +msgstr "failas tik skaitymui" + +#: codetoolsstrconsts:ctsgtk2intfdirectory +msgid "gtk2 interface directory" +msgstr "gtk2 interfeiso katalogas" + +#: codetoolsstrconsts:ctsidentifier +msgid "identifier" +msgstr "identifikatorius" + +#: codetoolsstrconsts:ctsidentexpectedbutatomfound +msgid "identifier expected, but %s found" +msgstr "tikėtasi identifikatoriaus, tačiau aptikta %s" + +#: codetoolsstrconsts:ctsidentexpectedbutkeywordfound +msgid "identifier expected, but keyword %s found" +msgstr "tikėtasi identifikatoriaus, tačiau aptiktas raktažodis %s" + +#: codetoolsstrconsts:ctsidentifiernotfound +msgid "identifier not found: %s" +msgstr "identifikatorius nerastas: %s" + +#: codetoolsstrconsts:ctsillegalcircleinusedunits +msgid "illegal circle using unit: %s" +msgstr "neleistinas naudojamų modulių žiedas" + +#: codetoolsstrconsts:ctsillegalqualifier +msgid "illegal qualifier %s found" +msgstr "rastas klaidinga patiksla %s" + +#: codetoolsstrconsts:ctsimplementationnodenotfound +msgid "implementation node not found" +msgstr "nerastas realizacijos mazgas" + +#: codetoolsstrconsts:įdėjimo +msgid "include directories: %s" +msgstr "įdėjimo katalogai: %s" + +#: codetoolsstrconsts:ctsincludefilenotfound +msgid "include file not found \"%s\"" +msgstr "įdedamasis failas \"%s\" nerastas" + +#: codetoolsstrconsts:ctsincompatibletypesgotexpected +msgid "incompatibles types: expected \"%s\" but got \"%s\"" +msgstr "nesuderinami tipai: tikėtasi \"%s\", tačiau gauta \"%s\"" + +#: codetoolsstrconsts:ctsindexparameterexpectedbutatomfound +msgid "index parameter expected, but %s found" +msgstr "tikėtasi indekso parametro, tačiau aptikta %s" + +#: codetoolsstrconsts:ctsindexspecifierredefined +msgid "index specifier redefined" +msgstr "indekso specifikatorius apibrėžtas pakartotinai" + +#: codetoolsstrconsts:ctsinheritedkeywordonlyallowedinmethods +msgid "inherited keyword only allowed in methods" +msgstr "paveldėti raktažodžiai galimi tik metoduose" + +#: codetoolsstrconsts:ctsinsufficientmemory +msgid "insufficient memory" +msgstr "trūksta atminties" + +#: codetoolsstrconsts:ctsintfdirectory +msgid "interface directory" +msgstr "interfeiso katalogas" + +#: codetoolsstrconsts:ctsinterfacesectionnotfound +msgid "interface section not found" +msgstr "nerasta interfeiso sekcija" + +#: codetoolsstrconsts:ctsinvalidclassname2 +msgid "invalid class name %s%s%s" +msgstr "klaidingas klasės vardas %s%s%s" + +#: codetoolsstrconsts:ctsinvalidclassname +msgid "invalid class name=%s%s%s" +msgstr "klaidingas klasės vardas=%s%s%s" + +#: codetoolsstrconsts:ctsinvalidflagvaluefordirective +msgid "invalid flag value \"%s\" for directive %s" +msgstr "klaidinga vėliavėlės reikšmė \"%s\" direktyvai %s" + +#: codetoolsstrconsts:ctsinvalidmode +msgid "invalid mode \"%s\"" +msgstr "klaidinga veiksena \"%s\"" + +#: codetoolsstrconsts:ctsinvalidsubrange +msgid "invalid subrange" +msgstr "klaidingas porėžis" + +#: codetoolsstrconsts:ctsinvalidtype +msgid "invalid type" +msgstr "klaidingas tipas" + +#: codetoolsstrconsts:ctsinvalidvariablename +msgid "invalid variable name %s%s%s" +msgstr "klaidingas kintamojo vardas %s%s%s" + +#: codetoolsstrconsts:ctsinvalidvariabletype +msgid "invalid variable type %s%s%s" +msgstr "klaidingas kintamojo tipas %s%s%s" + +#: codetoolsstrconsts:ctskeyword +msgid "keyword" +msgstr "raktažodis" + +#: codetoolsstrconsts:ctskeywordexampleexpectedbutatomfound +msgid "keyword (e.g. %s) expected, but %s found" +msgstr "tikėtasi raktažodžio (pvz.: %s), tačiau aptikta %s" + +#: codetoolsstrconsts:ctskeywordin +msgid "keyword \"in\"" +msgstr "raktažodis \"in\"" + +#: codetoolsstrconsts:ctslazarusmaindirectory +msgid "lazarus main directory" +msgstr "Lazarus pagrindinis katalogas" + +#: codetoolsstrconsts:ctsmethodname +msgid "method name" +msgstr "metodo vardas" + +#: codetoolsstrconsts:ctsmethodtypedefinitionnotfound +msgid "method type definition not found" +msgstr "nerasta metodo tipo apibrėžtis" + +#: codetoolsstrconsts:ctsmissingpointafterend +msgid "missing . after end" +msgstr "po \"end\" trūksta \".\"" + +#: codetoolsstrconsts:ctsmissingenumlist +msgid "missing enum list" +msgstr "trūksta enumeracijos sąrašo" + +#: codetoolsstrconsts:ctsmissingtypeidentifier +msgid "missing type identifier" +msgstr "trūksta tipo identifikatoriaus" + +#: codetoolsstrconsts:ctsnewprocbodynotfound +msgid "new proc body not found" +msgstr "nerasta naujos procedūros pagrindinė dalis" + +#: codetoolsstrconsts:ctsnocontextnodefoundatcursor +msgid "no context node found at cursor" +msgstr "ties žymekliu nerastas kontekstinis mazgas" + +#: codetoolsstrconsts:ctsnopascalcodefound +msgid "no pascal code found (first token is %s)" +msgstr "paskalio kodas nerastas (pirmoji leksema - %s)" + +#: codetoolsstrconsts:ctsnonodefoundatcursor +msgid "no pascal node found at cursor (i.e. in unparsed code)" +msgstr "ties žymekliu (t.y. neišanalizuotame kode) nerastas paskalio mazgas" + +#: codetoolsstrconsts:ctsnodefaultspecifierdefinedtwice +msgid "nodefault specifier defined twice" +msgstr "nenumatytas specifikatorius apibrėžtas dukart" + +#: codetoolsstrconsts:ctsoldmethodnotfound +msgid "old method not found: %s" +msgstr "nerastas senasis metodas: %s" + +#: codetoolsstrconsts:ctsprocedureorfunction +msgid "procedure or function" +msgstr "procedūra arba funkcija" + +#: codetoolsstrconsts:ctsprocessorspecific +msgid "processor specific" +msgstr "priklauso nuo procesorio" + +#: codetoolsstrconsts:ctspropertyspecifieralreadydefined +msgid "property specifier already defined: %s" +msgstr "savybės specifikatorius jau yra abibrėžtas: %s" + +#: codetoolsstrconsts:ctsproperttypeexpectedbutatomfound +msgid "property type expected, but %s found" +msgstr "tikėtasi savybės tipo, tačiau aptikta %s" + +#: codetoolsstrconsts:ctsqualifierexpectedbutatomfound +msgid "qualifier expected but %s found" +msgstr "tikėtasi patikslos, tačiau aptikta %s" + +#: codetoolsstrconsts:ctssemicolonnotfound +msgid "semicolon not found" +msgstr "neratas kablataškis" + +#: codetoolsstrconsts:ctssetsincpathto +msgid "sets IncPath to %s" +msgstr "įdedamųjų kelia nustato į %s" + +#: codetoolsstrconsts:ctssetssrcpathto +msgid "sets SrcPath to %s" +msgstr "pirminio kodo kelią nustato į %s" + +#: codetoolsstrconsts:ctssourceisnotunit +msgid "source is not unit" +msgstr "šaltinis nėra modulis" + +#: codetoolsstrconsts:ctssourcenotfoundunit +msgid "source not found: unit %s" +msgstr "pirminis kodas nerastas: modulis %s" + +#: codetoolsstrconsts:ctssrcpathforcompiledunits +msgid "src path for compiled units" +msgstr "pirminio kodo kelias kompiliuotiems moduliams" + +#: codetoolsstrconsts:ctsstringconstant +msgid "string constant" +msgstr "eilutės konstanta" + +#: codetoolsstrconsts:ctstypeidentifier +msgid "type identifier" +msgstr "tipo identifikatorius" + +#: codetoolsstrconsts:ctstypesectionofclassnotfound +msgid "type section of class not found" +msgstr "klasėje nerasta tipo sekcija" + +#: codetoolsstrconsts:ctsunabletoapplychanges +msgid "unable to apply changes" +msgstr "neina pritaikyti pakeitimus" + +#: codetoolsstrconsts:ctsunabletocompleteproperty +msgid "unable to complete property" +msgstr "neina užbaigti savybės" + +#: codetoolsstrconsts:ctsidentexpectedbuteoffound +msgid "unexpected end of file (identifier expected)" +msgstr "netikėta failo pabaiga (tikėtasi identifikatoriaus)" + +#: codetoolsstrconsts:ctsunexpectedendofsource +msgid "unexpected end of source" +msgstr "netikėta pirminio kodo pabaiga" + +#: codetoolsstrconsts:ctsunexpectedkeyword +msgid "unexpected keyword \"%s\"" +msgstr "netikėtas raktažodis \"%s\"" + +#: codetoolsstrconsts:ctsunexpectedkeywordwhilereadingbackwards +msgid "unexpected keyword \"%s\" found while reading blocks backwards" +msgstr "skaitant blokus atygaline tvarka aptiktas netikėtas raktažodis \"%s\"" + +#: codetoolsstrconsts:ctsunexpectedkeywordinasmblock +msgid "unexpected keyword \"%s\" in asm block found" +msgstr "asemblerio bloke aptiktas netikėtas raktažodis \"%s\"" + +#: codetoolsstrconsts:ctsunexpectedkeywordinbeginendblock +msgid "unexpected keyword \"%s\" in begin..end found" +msgstr "tarp \"begin\" ir \"end\" aptiktas netikėtas raktažodis \"%s\"" + +#: codetoolsstrconsts:ctsunexpectedsubrangeoperatorfound +msgid "unexpected subrange operator '..' found" +msgstr "aptiktas netikėtas poaibio operatorius \"..\"" + +#: codetoolsstrconsts:ctsunitnotfound +msgid "unit not found: %s" +msgstr "modulis nerastas: %s" + +#: codetoolsstrconsts:ctsunknownsectionkeyword +msgid "unknown section keyword %s found" +msgstr "aptiktas nežinomas sekcijos raktažodis %s" + +#: codetoolsstrconsts:ctsusedunitisnotapascalunit +msgid "used unit is not a pascal unit" +msgstr "naudojamas modulis n4ra paskalio modulis" + diff --git a/components/h2pas/languages/h2passtrconsts.lt.po b/components/h2pas/languages/h2passtrconsts.lt.po new file mode 100644 index 0000000000..f722387b78 --- /dev/null +++ b/components/h2pas/languages/h2passtrconsts.lt.po @@ -0,0 +1,30 @@ +# translation of h2passtrconsts.po to Lithuanian +#: h2passtrconsts:bla +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 19:01+0300\n" +"Project-Id-Version: h2passtrconsts\n" +"Language-Team: Lithuanian\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: h2passtrconsts:h2pcheaderfileconverter +msgid "C header file converter" +msgstr "C antraštės failo konverteris" + +#: h2passtrconsts:h2pcreateunitsfromcheaderfiles +msgid "Create units from C header files" +msgstr "Kurti modulius pagal C antraštės failus" + +#: h2passtrconsts:h2ph2pas +msgid "H2Pas" +msgstr "H2Pas" + +#: h2passtrconsts:h2ph2pastool +msgid "H2PasTool" +msgstr "H2PasTool" + diff --git a/components/memds/languages/frmselectdataset.lt.po b/components/memds/languages/frmselectdataset.lt.po new file mode 100644 index 0000000000..fbf5444c9d --- /dev/null +++ b/components/memds/languages/frmselectdataset.lt.po @@ -0,0 +1,33 @@ +# translation of frmselectdataset.po to Lithuanian +# Header entry was created by KBabel! +# +#: frmselectdataset:serrcomponentnotfound +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:57+0300\n" +"Project-Id-Version: frmselectdataset\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: frmselectdataset:serrcomponentnotfound +msgid "Error: Component \"%s\" not found" +msgstr "Klaida: nerastas komponentas \"%s\"" + +#: frmselectdataset:smenucreatedataset +msgid "Create dataset" +msgstr "Kurti duomenų aibę (DataSet)" + +#: frmselectdataset:smenucopydataset +msgid "Copy data from Dataset" +msgstr "Kopijuoti duomenis iš duomenų aibės (DataSet)" + +#: frmselectdataset:serrselectdataset +msgid "Please select a dataset first" +msgstr "Pirma išrinkite duomenų aibę (DataSet)" + diff --git a/components/prettyformat/languages/pfidesource.lt.po b/components/prettyformat/languages/pfidesource.lt.po new file mode 100644 index 0000000000..4d2c8d5dff --- /dev/null +++ b/components/prettyformat/languages/pfidesource.lt.po @@ -0,0 +1,29 @@ +# translation of pfidesource.po to Lithuanian +# Header entry was created by KBabel! +# +#: pfidesource:sdescrpfselection +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:47+0300\n" +"Project-Id-Version: pfidesource\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: pfidesource:sdescrpfselection +msgid "Pretty-Format Selection" +msgstr "Pretty-Format žymėjimas" + +#: pfidesource:sdescrpffile +msgid "Pretty-Format File" +msgstr "Pretty-Format failas" + +#: pfidesource:sdescrformatting +msgid "Formatting commands" +msgstr "Formatavimo komandos" + diff --git a/components/printers/design/languages/ideprinting.lt.po b/components/printers/design/languages/ideprinting.lt.po new file mode 100644 index 0000000000..074283fec0 --- /dev/null +++ b/components/printers/design/languages/ideprinting.lt.po @@ -0,0 +1,17 @@ +# translation of ideprinting.po to Lithuanian +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:44+0300\n" +"Project-Id-Version: ideprinting\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" + +#: ideprinting:sdescrpfselection +msgid "Print..." +msgstr "Spauzdinti..." + diff --git a/components/projecttemplates/languages/frmtemplatevariables.lt.po b/components/projecttemplates/languages/frmtemplatevariables.lt.po new file mode 100644 index 0000000000..a53bdb0515 --- /dev/null +++ b/components/projecttemplates/languages/frmtemplatevariables.lt.po @@ -0,0 +1,29 @@ +# translation of frmtemplatevariables.po to Lithuanian +# Header entry was created by KBabel! +# +#: frmtemplatevariables:svariable +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:42+0300\n" +"Project-Id-Version: frmtemplatevariables\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: frmtemplatevariables:svariable +msgid "Variable" +msgstr "Kintamasis" + +#: frmtemplatevariables:svalue +msgid "Value" +msgstr "Reikšmė" + +#: frmtemplatevariables:sdescription +msgid "Description" +msgstr "Aprašas" + diff --git a/components/projecttemplates/languages/idetemplateproject.lt.po b/components/projecttemplates/languages/idetemplateproject.lt.po new file mode 100644 index 0000000000..5884e13eaf --- /dev/null +++ b/components/projecttemplates/languages/idetemplateproject.lt.po @@ -0,0 +1,25 @@ +# translation of idetemplateproject.po to Lithuanian +# Header entry was created by KBabel! +# +#: idetemplateproject:sprojecttemplatesettings +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:40+0300\n" +"Project-Id-Version: idetemplateproject\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: idetemplateproject:sprojecttemplatesettings +msgid "Project templates options" +msgstr "Projekto šablono parinktys" + +#: idetemplateproject:snewfromtemplate +msgid "New project from template" +msgstr "Naujas projektas pagal šabloną" + diff --git a/components/projecttemplates/languages/projecttemplates.lt.po b/components/projecttemplates/languages/projecttemplates.lt.po new file mode 100644 index 0000000000..a3384bbf20 --- /dev/null +++ b/components/projecttemplates/languages/projecttemplates.lt.po @@ -0,0 +1,29 @@ +# translation of projecttemplates.po to Lithuanian +# Header entry was created by KBabel! +# +#: projecttemplates:serrnosuchtemplate +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:38+0300\n" +"Project-Id-Version: projecttemplates\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: projecttemplates:serrnosuchtemplate +msgid "\"%s\": No such template." +msgstr "\"%s\": nėra tokio šablono." + +#: projecttemplates:serrcouldnotcreatedir +msgid "Could not create directory \"%s\"" +msgstr "Nepavyko sukurti katalogą \"%s\"" + +#: projecttemplates:serrfailedtocopyfile +msgid "Failed to copy file \"%s\" to \"%s\"" +msgstr "Nepavyko failą \"%s\" kopijuoti į \"%s\"" + diff --git a/components/synedit/languages/synedit.lt.po b/components/synedit/languages/synedit.lt.po new file mode 100644 index 0000000000..06eb555efe --- /dev/null +++ b/components/synedit/languages/synedit.lt.po @@ -0,0 +1,229 @@ +# translation of synedit.po to Lithuanian +# Header entry was created by KBabel! +# +#: syneditstrconst:syns_exporterformathtml +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:34+0300\n" +"Project-Id-Version: synedit\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: syneditstrconst:syns_exporterformathtml +msgid "HTML" +msgstr "HTML" + +#: syneditstrconst:syns_exporterformatrtf +msgid "RTF" +msgstr "RTF" + +#: syneditstrconst:syns_scrollinfofmt +msgid "%d - %d" +msgstr "%d - %d" + +#: syneditstrconst:syns_scrollinfofmttop +msgid "Top Line: %d" +msgstr "Viršutinė eilutė: %d" + +#: syneditstrconst:syns_previewscrollinfofmt +msgid "Page: %d" +msgstr "Lapas: %d" + +#: syneditstrconst:syns_eduplicateshortcut +msgid "Shortcut already exists" +msgstr "Toks šaukinys jau yra" + +#: syneditstrconst:syns_shortcutnone +msgid "" +msgstr "" + +#: syneditstrconst:syns_duplicateshortcutmsg +msgid "The keystroke \"%s\" is already assigned to another editor command. (%s)" +msgstr "Klavišo paspaudimas \"%s\" jau yra priskirtas kitai redaktoriaus komandai. (%s)" + +#: syneditstrconst:syns_filterpascal +msgid "Pascal Files (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" +msgstr "Paskalio failai (*.pas,*.dpr,*.dpk,*.inc)|*.pas;*.dpr;*.dpk;*.inc" + +#: syneditstrconst:syns_filterhp48 +msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" +msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp" + +#: syneditstrconst:syns_filtercaclipper +msgid "CA-Clipper Files (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" +msgstr "CA-Clipper failai (*.prg,*.ch,*.inc)|*.prg;*.ch;*.inc" + +#: syneditstrconst:syns_filtercorbaidl +msgid "CORBA IDL files (*.idl)|*.idl" +msgstr "CORBA IDL failai (*.idl)|*.idl" + +#: syneditstrconst:syns_filtercpm +msgid "CPM reports (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" +msgstr "CPM ataskaitos (*.rdf,*.rif,*.rmf,*.rxf)|*.rdf;*.rif;*.rmf;*.rxf" + +#: syneditstrconst:syns_filtercpp +msgid "C++ Files (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" +msgstr "C++ failai (*.c,*.cpp,*.h,*.hpp,*.hh)|*.c;*.cpp;*.h;*.hpp;*.hh" + +#: syneditstrconst:syns_filterjava +msgid "Java Files (*.java)|*.java" +msgstr "Java failai (*.java)|*.java" + +#: syneditstrconst:syns_filterperl +msgid "Perl Files (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" +msgstr "Perl failai (*.pl,*.pm,*.cgi)|*.pl;*.pm;*.cgi" + +#: syneditstrconst:syns_filterawk +msgid "AWK Script (*.awk)|*.awk" +msgstr "AWK scenarijus (*.awk)|*.awk" + +#: syneditstrconst:syns_filterhtml +msgid "HTML Document (*.htm,*.html)|*.htm;*.html" +msgstr "HTML dokumentas (*.htm,*.html)|*.htm;*.html" + +#: syneditstrconst:syns_filtervbscript +msgid "VBScript Files (*.vbs)|*.vbs" +msgstr "VBScript failai (*.vbs)|*.vbs" + +#: syneditstrconst:syns_filtergalaxy +msgid "Galaxy Files (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" +msgstr "Galaxy failai (*.gtv,*.galrep,*.txt)|*.gtv;*.galrep;*.txt" + +#: syneditstrconst:syns_filterpython +msgid "Python Files (*.py)|*.py" +msgstr "Python failai (*.py)|*.py" + +#: syneditstrconst:syns_filtersql +msgid "SQL Files (*.sql)|*.sql" +msgstr "SQL failai (*.sql)|*.sql" + +#: syneditstrconst:syns_filterhp +msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" +msgstr "HP48 failai (*.s,*.sou,*.a,*.hp)|*.S;*.SOU;*.A;*.HP" + +#: syneditstrconst:syns_filtertcltk +msgid "Tcl/Tk Files (*.tcl)|*.tcl" +msgstr "Tcl/Tk failai (*.tcl)|*.tcl" + +#: syneditstrconst:syns_filterrtf +msgid "Rich Text Format (*.rtf)|*.rtf" +msgstr "Raiškiojo teksto formatas (*.rtf)|*.rtf" + +#: syneditstrconst:syns_filterbatch +msgid "MS-DOS Batch Files (*.bat;*.cmd)|*.bat;*.cmd" +msgstr "MS-DOS komandų failai (*.bat;*.cmd)|*.bat;*.cmd" + +#: syneditstrconst:syns_filterdfm +msgid "Borland Form Files (*.dfm;*.xfm)|*.dfm;*.xfm" +msgstr "Borland formos failai (*.dfm;*.xfm)|*.dfm;*.xfm" + +#: syneditstrconst:syns_filterlfm +msgid "Lazarus Form Files (*.lfm)|*.lfm" +msgstr "Lazarus formos failai (*.lfm)|*.lfm" + +#: syneditstrconst:syns_filterx86asm +msgid "x86 Assembly Files (*.asm)|*.ASM" +msgstr "x86 asemblerio failai (*.asm)|*.ASM" + +#: syneditstrconst:syns_filtergembase +msgid "GEMBASE Files (*.dml,*.gem)|*.DML;*.GEM" +msgstr "GEMBASE failai (*.dml,*.gem)|*.DML;*.GEM" + +#: syneditstrconst:syns_filterini +msgid "INI Files (*.ini)|*.ini" +msgstr "INI failai (*.ini)|*.ini" + +#: syneditstrconst:syns_filtersml +msgid "Standard ML Files (*.sml)|*.sml" +msgstr "Standard ML failai (*.sml)|*.sml" + +#: syneditstrconst:syns_filtervisualbasic +msgid "Visual Basic Files (*.bas)|*.bas" +msgstr "Visual Basic failai (*.bas)|*.bas" + +#: syneditstrconst:syns_filteradsp21xx +msgid "DSP Files (*.dsp,*.inc)|*.DSP;*.INC" +msgstr "DSP failai (*.dsp,*.inc)|*.DSP;*.INC" + +#: syneditstrconst:syns_filterphp +msgid "PHP Files (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" +msgstr "PHP failai (*.php,*.php3,*.phtml,*.inc)|*.php;*.php3;*.phtml;*.inc" + +#: syneditstrconst:syns_filtercache +msgid "Cache Files (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" +msgstr "Cache failai (*.mac,*.inc,*.int)|*.mac;*.inc;*.int" + +#: syneditstrconst:syns_filtercss +msgid "Cascading Stylesheets (*.css)|*.css" +msgstr "Pakopiniai stiliai (*.css)|*.css" + +#: syneditstrconst:syns_filterjscript +msgid "Javascript Files (*.js)|*.js" +msgstr "Javascript failai (*.js)|*.js" + +#: syneditstrconst:syns_filterkix +msgid "KiXtart scripts (*.kix)|*.kix" +msgstr "KiXtart scenarijai (*.kix)|*.kix" + +#: syneditstrconst:syns_filterbaan +msgid "Baan 4GL Files (*.cln)|*.cln" +msgstr "Baan 4GL failai (*.cln)|*.cln" + +#: syneditstrconst:syns_filterfoxpro +msgid "Foxpro Files (*.prg)|*.prg" +msgstr "Foxpro failai (*.prg)|*.prg" + +#: syneditstrconst:syns_filterfortran +msgid "Fortran Files (*.for)|*.for" +msgstr "Fortran failai (*.for)|*.for" + +#: syneditstrconst:syns_filterasm68hc11 +msgid "68HC11 Assembler Files (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" +msgstr "68HC11 asemblerio failai (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC" + +#: syneditstrconst:syns_filterprogress +msgid "Progress Files (*.w,*.p,*.i)|*.w;*.p;*.i" +msgstr "Progress failai (*.w,*.p,*.i)|*.w;*.p;*.i" + +#: syneditstrconst:syns_filterinno +msgid "Inno Setup Script Files (*.iss)|*.iss" +msgstr "Inno Setup scenarijaus failai (*.iss)|*.iss" + +#: syneditstrconst:syns_filtermodelica +msgid "Modelica Files (*.mo)|*.mo" +msgstr "Modelica failai (*.mo)|*.mo" + +#: syneditstrconst:syns_filtermodula3 +msgid "Modula-3 Files (*.m3)|*.m3" +msgstr "Modula-3 failai (*.m3)|*.m3" + +#: syneditstrconst:syns_filtersdd +msgid "Semanta DD files (*.sdd)|*.sdd" +msgstr "Semanta DD failai (*.sdd)|*.sdd" + +#: syneditstrconst:syns_filterxml +msgid "XML Document (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" +msgstr "XML dokumentas (*.xml,*.xsd,*.xsl,*.xslt,*.dtd)|*.xml;*.xsd;*.xsl;*.xslt;*.dtd" + +#: syneditstrconst:syns_filtergws +msgid "GW-TEL Script Files (*.gws)|*.gws" +msgstr "GW-TEL scenarijaus failai (*.gws)|*.gws" + +#: syneditstrconst:syns_filtersyngenmsgfiles +msgid "Msg files (*.msg)|*.msg" +msgstr "Msg failai (*.msg)|*.msg" + +#: syneditstrconst:syns_filterunixshellscript +msgid "UNIX Shell Scripts (*.sh)|*.sh" +msgstr "UNIX apvalkalo scenarijus (*.sh)|*.sh" + +#: syneditstrconst:syns_filtertex +msgid "TeX Files (*.tex)|*.tex" +msgstr "TeX failai (*.tex)|*.tex" + diff --git a/components/synedit/languages/synmacrorecorder.lt.po b/components/synedit/languages/synmacrorecorder.lt.po new file mode 100644 index 0000000000..4e330eb39b --- /dev/null +++ b/components/synedit/languages/synmacrorecorder.lt.po @@ -0,0 +1,33 @@ +# translation of synmacrorecorder.po to Lithuanian +# Header entry was created by KBabel! +# +#: synmacrorecorder:scannotrecord +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:15+0300\n" +"Project-Id-Version: synmacrorecorder\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: synmacrorecorder:scannotrecord +msgid "Cannot record macro when recording" +msgstr "Neina įrašyti makrokomandą kai įrašinėjama" + +#: synmacrorecorder:scannotplay +msgid "Cannot playback macro when recording" +msgstr "Neina paleisti makrokomandos įrašą kai įrašinėjama" + +#: synmacrorecorder:scannotpause +msgid "Can only pause when recording" +msgstr "Įrašinėjant galima tik pristabdyti" + +#: synmacrorecorder:scannotresume +msgid "Can only resume when paused" +msgstr "Pristabdžius galima tik tęsti" + diff --git a/components/synunihighlighter/languages/synunidesigner.lt.po b/components/synunihighlighter/languages/synunidesigner.lt.po new file mode 100644 index 0000000000..0cedc1d2e5 --- /dev/null +++ b/components/synunihighlighter/languages/synunidesigner.lt.po @@ -0,0 +1,21 @@ +# translation of synunidesigner.po to Lithuanian +# Header entry was created by KBabel! +# +#: synunidesigner:sunifiledescription +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:08+0300\n" +"Project-Id-Version: synunidesigner\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: synunidesigner:sunifiledescription +msgid "UniHighlighter Syntax" +msgstr "UniHighlighter sintaksė" + diff --git a/components/synunihighlighter/languages/synunireg.lt.po b/components/synunihighlighter/languages/synunireg.lt.po new file mode 100644 index 0000000000..c47e296472 --- /dev/null +++ b/components/synunihighlighter/languages/synunireg.lt.po @@ -0,0 +1,21 @@ +# translation of synunireg.po to Lithuanian +# Header entry was created by KBabel! +# +#: synunireg:sedituni +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:07+0300\n" +"Project-Id-Version: synunireg\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: synunireg:sedituni +msgid "Edit..." +msgstr "Keisti..." + diff --git a/components/tdbf/languages/registerdbf.lt.po b/components/tdbf/languages/registerdbf.lt.po new file mode 100644 index 0000000000..f466c805e8 --- /dev/null +++ b/components/tdbf/languages/registerdbf.lt.po @@ -0,0 +1,17 @@ +# translation of registerdbf.po to Lithuanian +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 18:04+0300\n" +"Project-Id-Version: registerdbf\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" + +#: registerdbf:dbfsalldbasefiles +msgid "DBase Files" +msgstr "DBase failai" + diff --git a/components/turbopower_ipro/languages/ipconst.lt.po b/components/turbopower_ipro/languages/ipconst.lt.po new file mode 100644 index 0000000000..5a52af012f --- /dev/null +++ b/components/turbopower_ipro/languages/ipconst.lt.po @@ -0,0 +1,2445 @@ +# translation of ipconst.po to Lithuanian +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-27 14:04+0300\n" +"Project-Id-Version: ipconst\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" + +#: ipconst:slognsarticle +msgid " (nsArticle)" +msgstr " (nsArticle)" + +#: ipconst:slognsauthpass +msgid " (nsAuthPass)" +msgstr " (nsAuthPass)" + +#: ipconst:slognsauthuser +msgid " (nsAuthUser)" +msgstr " (nsAuthUser)" + +#: ipconst:slognsbody +msgid " (nsBody)" +msgstr " (nsBody)" + +#: ipconst:slognsconnect +msgid " (nsConnect)" +msgstr " (nsConnect)" + +#: ipconst:slognsdate +msgid " (nsDate)" +msgstr " (nsDate)" + +#: ipconst:slognsgroup +msgid " (nsGroup)" +msgstr " (nsGroup)" + +#: ipconst:slognshead +msgid " (nsHead)" +msgstr " (nsHead)" + +#: ipconst:slognshelp +msgid " (nsHelp)" +msgstr " (nsHelp)" + +#: ipconst:slognslast +msgid " (nsLast)" +msgstr " (nsLast)" + +#: ipconst:slognslist +msgid " (nsList)" +msgstr " (nsList)" + +#: ipconst:slognslistactivetimes +msgid " (nsListActiveTimes)" +msgstr " (nsListActiveTimes)" + +#: ipconst:slognslistdistribpats +msgid " (nsListDistribPats)" +msgstr " (nsListDistribPats)" + +#: ipconst:slognslistdistributions +msgid " (nsListDistributions)" +msgstr " (nsListDistributions)" + +#: ipconst:slognslistext +msgid " (nsListExt)" +msgstr " (nsListExt)" + +#: ipconst:slognslistgroup +msgid " (nsListGroup)" +msgstr " (nsListGroup)" + +#: ipconst:slognslistnewsgroups +msgid " (nsListNewsGroups)" +msgstr " (nsListNewsGroups)" + +#: ipconst:slognslistoverviewfmt +msgid " (nsListOverviewFmt)" +msgstr " (nsListOverviewFmt)" + +#: ipconst:slognsnewgroups +msgid " (nsNewGroups)" +msgstr " (nsNewGroups)" + +#: ipconst:slognsnewnews +msgid " (nsNewNews)" +msgstr " (nsNewNews)" + +#: ipconst:slognsnext +msgid " (nsNext)" +msgstr " (nsNext)" + +#: ipconst:slognsnoop +msgid " (nsNoOp)" +msgstr " (nsNoOp)" + +#: ipconst:slognsover +msgid " (nsOver)" +msgstr " (nsOver)" + +#: ipconst:slognspat +msgid " (nsPat)" +msgstr " (nsPat)" + +#: ipconst:slognspost +msgid " (nsPost)" +msgstr " (nsPost)" + +#: ipconst:slognsprepost +msgid " (nsPrePost)" +msgstr " (nsPrePost)" + +#: ipconst:slognsquit +msgid " (nsQuit)" +msgstr " (nsQuit)" + +#: ipconst:slognsspecial +msgid " (nsSpecial)" +msgstr " (nsSpecial)" + +#: ipconst:slognsstat +msgid " (nsStat)" +msgstr " (nsStat)" + +#: ipconst:slogntauthenticate +msgid " (ntAuthenticate)" +msgstr " (ntAuthenticate)" + +#: ipconst:slogntnewnews +msgid " (ntNewNews)" +msgstr " (ntNewNews)" + +#: ipconst:slogntnotask +msgid " (ntNoTask)" +msgstr " (ntNoTask)" + +#: ipconst:slogntpostto +msgid " (ntPostTo)" +msgstr " (ntPostTo)" + +#: ipconst:slogntselectgroup +msgid " (ntSelectGroup)" +msgstr " (ntSelectGroup)" + +#: ipconst:slogpsapop +msgid " (psApop)" +msgstr " (psApop)" + +#: ipconst:slogpsconnect +msgid " (psConnect)" +msgstr " (psConnect)" + +#: ipconst:slogpsdele +msgid " (psDele)" +msgstr " (psDele)" + +#: ipconst:slogoslist +msgid " (psList)" +msgstr " (psList)" + +#: ipconst:slogpspass +msgid " (psPass)" +msgstr " (psPass)" + +#: ipconst:slogpsquit +msgid " (psQuit)" +msgstr " (psQuit)" + +#: ipconst:slogpsretr +msgid " (psRetr)" +msgstr " (psRetr)" + +#: ipconst:slogpsrset +msgid " (psRSet)" +msgstr " (psRSet)" + +#: ipconst:slogpsspecial +msgid " (psSpecial)" +msgstr " (psSpecial)" + +#: ipconst:slogpsstat +msgid " (psStat)" +msgstr " (psStat)" + +#: ipconst:slogpstop +msgid " (psTop)" +msgstr " (psTop)" + +#: ipconst:slogpsuidl +msgid " (psUidl)" +msgstr " (psUidl)" + +#: ipconst:slogpsuser +msgid " (psUser)" +msgstr " (psUser)" + +#: ipconst:slogptlist +msgid " (ptList)" +msgstr " (ptList)" + +#: ipconst:slogptlogon +msgid " (ptLogon)" +msgstr " (ptLogon)" + +#: ipconst:slogptnone +msgid " (ptNone)" +msgstr " (ptNone)" + +#: ipconst:slogptuidl +msgid " (ptUIDL)" +msgstr " (ptUIDL)" + +#: ipconst:slogauthlogin +msgid " (ssAuthLogin)" +msgstr " (ssAuthLogin)" + +#: ipconst:slogauthpass +msgid " (ssAuthPass)" +msgstr " (ssAuthPass)" + +#: ipconst:slogauthuser +msgid " (ssAuthUser)" +msgstr " (ssAuthUser)" + +#: ipconst:slogssconnect +msgid " (ssConnect)" +msgstr " (ssConnect)" + +#: ipconst:slogdata +msgid " (ssData)" +msgstr " (ssData)" + +#: ipconst:slogehlo +msgid " (ssEhlo)" +msgstr " (ssEhlo)" + +#: ipconst:slogexpand +msgid " (ssExpand)" +msgstr " (ssExpand)" + +#: ipconst:sloghelo +msgid " (ssHelo)" +msgstr " (ssHelo)" + +#: ipconst:sloghelp +msgid " (ssHelp)" +msgstr " (ssHelp)" + +#: ipconst:slogmailfrom +msgid " (ssMailFrom)" +msgstr " (ssMailFrom)" + +#: ipconst:slogssnoop +msgid " (ssNoOp)" +msgstr " (ssNoOp)" + +#: ipconst:slogquit +msgid " (ssQuit)" +msgstr " (ssQuit)" + +#: ipconst:slogrcptbcc +msgid " (ssRcptBcc)" +msgstr " (ssRcptBcc)" + +#: ipconst:slogrcptcc +msgid " (ssRcptCc)" +msgstr " (ssRcptCc)" + +#: ipconst:slogrcptto +msgid " (ssRcptTo)" +msgstr " (ssRcptTo)" + +#: ipconst:slogrset +msgid " (ssRSet)" +msgstr " (ssRSet)" + +#: ipconst:slogsaml +msgid " (ssSaml)" +msgstr " (ssSaml)" + +#: ipconst:slogsend +msgid " (ssSend)" +msgstr " (ssSend)" + +#: ipconst:slogsendenvelope +msgid " (ssSendEnvelope)" +msgstr " (ssSendEnvelope)" + +#: ipconst:slogsendmessage +msgid " (ssSendMessage)" +msgstr " (ssSendMessage)" + +#: ipconst:slogsoml +msgid " (ssSoml)" +msgstr " (ssSoml)" + +#: ipconst:slogspecial +msgid " (ssSpecial)" +msgstr " (ssSpecial)" + +#: ipconst:slogturn +msgid " (ssTurn)" +msgstr " (ssTurn)" + +#: ipconst:slogverify +msgid " (ssVerify)" +msgstr " (ssVerify)" + +#: ipconst:slogstlogon +msgid " (stLogon)" +msgstr " (stLogon)" + +#: ipconst:slogstnotask +msgid " (stNoTask)" +msgstr " (stNoTask)" + +#: ipconst:slogstsendmail +msgid " (stSendMail)" +msgstr " (stSendMail)" + +#: ipconst:sbytesfromstream +msgid " bytes from stream" +msgstr " baitų iš srauto" + +#: ipconst:sbytesreadfromstream +msgid " bytes read from stream" +msgstr " baitų skaityta iš srauto" + +#: ipconst:sbytestostream +msgid " bytes to stream" +msgstr " baitų į srautą" + +#: ipconst:sftpbytestransferred +msgid " bytes Transferred" +msgstr "baitų persiųsta" + +#: ipconst:sbyteswrittentostream +msgid " bytes written to stream" +msgstr " baitų rašyta į srautą" + +#: ipconst:shtmlencnotsupported +msgid " encoding not supported" +msgstr " koduotė nepalaikoma" + +#: ipconst:shtmlexp +msgid " expected" +msgstr " tikėtasi" + +#: ipconst:sfilename +msgid " Filename: " +msgstr " Failo vardas: " + +#: ipconst:sftplogin +msgid " logged in" +msgstr " prisiregistravęs" + +#: ipconst:sftplogout +msgid " logged out" +msgstr " išsiregistravęs" + +#: ipconst:slogpsnoop +msgid " {psNoOp)" +msgstr " {psNoOp)" + +#: ipconst:sbinhexcolonexpected +msgid "\":\" expected" +msgstr "\":\" tikėtasi" + +#: ipconst:spop3nottransacting +msgid "%s can not be called in authentication state" +msgstr "tapatybės nustatymo metu kreiptis į %s negalima" + +#: ipconst:spop3notauthenticating +msgid "%s can not be called in transaction state" +msgstr "transakcijos metu kreiptis į %s negalima" + +#: ipconst:snowinsock2err +msgid "%s requires WinSock 2, and this system only has WinSock 1" +msgstr "%s reikalauja WinSock2, tačiau šioje sistemoje yra tik WinSock1" + +#: ipconst:swebimagenotfound +msgid "%s was not found" +msgstr "%s nerastas" + +#: ipconst:sposreqd +msgid "%s: count must be positive" +msgstr "%s: kiekis turi būti teigiamas" + +#: ipconst:srowcoloor +msgid "%s: either row %d or col %d is out of range" +msgstr "%s: eilutė %d arba stulpelis %d peržengia ribas" + +#: ipconst:slesszero +msgid "%s: new col count %d is less than zero" +msgstr "%s: naujasis stulpelių kiekis %d mažesnis nei nulis" + +#: ipconst:scounttoosmall +msgid "%s: new count too small" +msgstr "%s: naujasis kiekis permažas" + +#: ipconst:srowoor +msgid "%s: row number is out of range" +msgstr "%s: eilutės skaičius peržengia ribas" + +#: ipconst:spngerrorconstant +msgid "**** ERROR ****" +msgstr "**** KLAIDA ****" + +#: ipconst:spngwarningconstant +msgid "**** WARNING ****" +msgstr "**** PERSPĖJIMAS ****" + +#: ipconst:swriteafterrename +msgid "***Write after rename" +msgstr "***Rašymas po pervardyjimo" + +#: ipconst:spop3okresp +msgid "+OK" +msgstr "+ OK" + +#: ipconst:shtmldashexp +msgid "- expected" +msgstr "- tikėtasi" + +#: ipconst:spop3errresp +msgid "-ERR" +msgstr "-ERR" + +#: ipconst:spngunsupportedfeature +msgid "A %s chunk was found in the PNG File. This feature is not supported in this version of the PNG decoder" +msgstr "PNG faile rasta %s dalis. Esamos versijos PNG dekoderis nepalaiko šios savybės" + +#: ipconst:swsaeaddrinuse +msgid "Address already in use" +msgstr "Adresas jau naudojamas" + +#: ipconst:swsaeafnosupport +msgid "Address family not supported by protocol family" +msgstr "Protokolo šeima nepalaiko adreso šeimos" + +#: ipconst:srasalldevicesconnected +msgid "All devices connected" +msgstr "Visi įrenginiai prisijungę" + +#: ipconst:ssterror +msgid "An error has occured during this task." +msgstr "Vykdant šią užduotį įvyko klaida." + +#: ipconst:spterror +msgid "An error occured with the last task." +msgstr "Vykdant paskutinę užduotį įvyko klaida." + +#: ipconst:spop3cmdapop +msgid "APOP" +msgstr "APOP" + +#: ipconst:snntpcmdarticle +msgid "ARTICLE" +msgstr "ARTICLE" + +#: ipconst:swsa_qos_senders +msgid "At least one Path has arrived" +msgstr "Atėjo bent vienas \"Path\"" + +#: ipconst:swsa_qos_receivers +msgid "At least one Reserve has arrived" +msgstr "Atėjo bent vienas \"Reserve\"" + +#: ipconst:sftprestart +msgid "Attempting to re-start transfer of " +msgstr "Mėginama pakartotinai siųsti " + +#: ipconst:sattemptingtoread +msgid "Attempting to read " +msgstr "Mėginama skaityti " + +#: ipconst:sattemptingtowrite +msgid "Attempting to write " +msgstr "Mėginama rašyti " + +#: ipconst:srasauthenticate +msgid "Authenticate" +msgstr "Nustatyti tapatybė" + +#: ipconst:srasauthack +msgid "Authenticate acknowledged" +msgstr "Nustatyti tapatybė - patvirtinta" + +#: ipconst:srasauthcallback +msgid "Authenticate callback" +msgstr "Nustatyti tapatybė - atgalinis skambinimas" + +#: ipconst:srasauthchangepassword +msgid "Authenticate change password" +msgstr "Nustatyti tapatybė - keisti slaptažodį" + +#: ipconst:srasauthlinkspeed +msgid "Authenticate link speed" +msgstr "Nustatyti tapatybė - saito sparta" + +#: ipconst:srasauthnotify +msgid "Authenticate notify" +msgstr "Nustatyti tapatybė - pranešti" + +#: ipconst:srasauthproject +msgid "Authenticate project" +msgstr "Nustatyti tapatybė - projektas" + +#: ipconst:srasauthretry +msgid "Authenticate retry" +msgstr "Nustatyti tapatybė - kartoti" + +#: ipconst:srasauthenticated +msgid "Authenticated" +msgstr "Tapatybė nustatyta" + +#: ipconst:sntauthenticate +msgid "Authenticating" +msgstr "Nustatoma tapatybė" + +#: ipconst:sssauthpass +msgid "Authenticating password" +msgstr "Nustatoma slaptažodžio tapatybė" + +#: ipconst:sssauthuser +msgid "Authenticating username" +msgstr "Nustatoma naudotojo vardo tapatybė" + +#: ipconst:snntpcmdauthpass +msgid "AUTHINFO PASS" +msgstr "AUTHINFO PASS" + +#: ipconst:snntpcmdauthuser +msgid "AUTHINFO USER" +msgstr "AUTHINFO USER" + +#: ipconst:snsauthpass +msgid "Authorizing password" +msgstr "Suteikiamas įgaliojimas slaptažodžiui" + +#: ipconst:snsauthuser +msgid "Authorizing user" +msgstr "Suteikiamas įgaliojimas naudotojo vardui" + +#: ipconst:swsaefault +msgid "Bad address" +msgstr "Blogas adresas" + +#: ipconst:ssslbadcertificate +msgid "Bad certificate." +msgstr "Blogas sertifikatas." + +#: ipconst:ssmtpresponse42 +msgid "Bad connection" +msgstr "Blogas ryšys" + +#: ipconst:sipicmp_bad_destination +msgid "Bad destination" +msgstr "Bloga paskirtis" + +#: ipconst:ssmtpresponse11 +msgid "Bad destination mailbox address" +msgstr "Blogas paskirties pašto dėžutės adresas" + +#: ipconst:ssmtpresponse13 +msgid "Bad destination mailbox address syntax" +msgstr "Bloga paskirties pašto dėžutės adreso sintaksė" + +#: ipconst:ssmtpresponse12 +msgid "Bad destination system address" +msgstr "Blogas paskirties sistemos adresas" + +#: ipconst:swsaebadf +msgid "Bad file descriptor" +msgstr "Blogas failo deskriptorius" + +#: ipconst:sbinhexbadheadercrc +msgid "Bad header CRC" +msgstr "Blogas antraštės CRC" + +#: ipconst:sipicmp_bad_option +msgid "Bad option" +msgstr "Bloga parinktis" + +#: ipconst:swsaenoprotoopt +msgid "Bad protocol option" +msgstr "Bloga protokolo parinktis" + +#: ipconst:ssslbadpublicencoding +msgid "Bad public encoding type." +msgstr "Blogas viešos koduotės tipas." + +#: ipconst:sipicmp_bad_req +msgid "Bad request" +msgstr "Bloga užklausa" + +#: ipconst:sipicmp_bad_route +msgid "Bad route" +msgstr "Blogas maršrutas" + +#: ipconst:ssmtpresponse17 +msgid "Bad sender's mailbox address syntax" +msgstr "Bloga siuntėjo pašto dėžutės adreso sintaksė" + +#: ipconst:ssmtpresponse18 +msgid "Bad sender's system address" +msgstr "Blogas siuntėjo sistemos adresas" + +#: ipconst:spngbitdepth +msgid "Bit Depth: %d" +msgstr "Gylis bitais: %d" + +#: ipconst:ssslblocksizeerror +msgid "Block size error" +msgstr "Klaidingas bloko dydis" + +#: ipconst:snntpcmdbody +msgid "BODY" +msgstr "BODY" + +#: ipconst:shtmldefbrowsecaption +msgid "Browse..." +msgstr "Naršyti..." + +#: ipconst:sbibuffernotassigned +msgid "Buffer not assigned" +msgstr "Buferis nepriskirtas" + +#: ipconst:ssslbufferoverflow +msgid "Buffer overflow error." +msgstr "Buferio perpildos klaida." + +#: ipconst:ssslbuffersizemissmatch +msgid "Buffer size miss-match." +msgstr "Buferio dydis nesiderina." + +#: ipconst:sipicmp_buf_too_small +msgid "Buffer too small" +msgstr "Buferis permažas" + +#: ipconst:cachedirnotexist +msgid "Cache directory %s does not exist." +msgstr "Podėlio katalogas %s neegzistuoja." + +#: ipconst:cacheadding +msgid "Caching item (%s = %s)" +msgstr "Elemntas dedamas į podėlį (%s = %s)" + +#: ipconst:srascallbackcomplete +msgid "Callback complete" +msgstr "Atgalinis skambinimas baigtas" + +#: ipconst:srascallbacksetbycaller +msgid "Callback set by caller" +msgstr "Atgalinį skambinimą parinko skambintojas" + +#: ipconst:ssslconnectchange +msgid "Can not change SSL status while connected." +msgstr "Prisijungus negalima keisti SSL būseną" + +#: ipconst:swrongstateerr +msgid "Can not comply, wrong state" +msgstr "Įvykdyti negalima, klaidinga būsena" + +#: ipconst:swsaecancelled +msgid "Cancelled" +msgstr "Atsisakyta" + +#: ipconst:swsaeaddrnotavail +msgid "Cannot assign requested address" +msgstr "Neina priskirti reikalaujamą adresą" + +#: ipconst:swebimagecannotload +msgid "Cannot load %s" +msgstr "Neina įkelti %s" + +#: ipconst:swebimagestreambad +msgid "Cannot load image from stream" +msgstr "Neina įkelti paveikslas iš srauto" + +#: ipconst:swsaeshutdown +msgid "Cannot send after socket shutdown" +msgstr "Išjungus jungtį, siųsti neis" + +#: ipconst:sactiveerr +msgid "Cannot set property on an active socket" +msgstr "Neina keisti aktyvios jungties savybę" + +#: ipconst:scannotwritetostream +msgid "Cannot write to stream" +msgstr "Neina rašyti srautan" + +#: ipconst:ssslbadcerttype +msgid "Cert type not found" +msgstr "Nerastas sertifikato tipas" + +#: ipconst:ssslnocertificate +msgid "Certificate is not available." +msgstr "Sertifikato nėra" + +#: ipconst:shtmlcharstackoverfl +msgid "Character stack overflow" +msgstr "Simbolių dėklo perpilda" + +#: ipconst:cachecheckfreshness +msgid "Checking Freshness (%s)" +msgstr "Tikrinamas naujumas (%s)" + +#: ipconst:spngtruncateddata +msgid "Chunk data is truncated" +msgstr "Dalies duomenys nukirsti" + +#: ipconst:seventdisconnect +msgid "Close: Loc: %s Rem: %s" +msgstr "Užverti: Loc: %s Rem: %s" + +#: ipconst:spngcolortype +msgid "Color Type: %d" +msgstr "Spalvos tipas: %d" + +#: ipconst:ssslcompressionfailure +msgid "Compression failure." +msgstr "Suglaudinti nepavyko." + +#: ipconst:spngcompressionmethod +msgid "Compression Method: %d" +msgstr "Glaudinimo metodas: %d" + +#: ipconst:ssslbadcompressionvalue +msgid "Compression value is wrong." +msgstr "Klaidinga glaudinimo reikšmė." + +#: ipconst:srasconnectdevice +msgid "Connect device" +msgstr "Prijungti įrenginį" + +#: ipconst:seventconnect +msgid "Connect: Loc: %s Rem: %s" +msgstr "Prijungti: Loc: %s Rem: %s" + +#: ipconst:srasconnected +msgid "Connected" +msgstr "Prijungta" + +#: ipconst:sftpopen +msgid "Connected to " +msgstr "Projungta prie" + +#: ipconst:httpconnect +msgid "Connected: (%s)" +msgstr "Prijungta: (%s)" + +#: ipconst:sssconnect +msgid "Connecting" +msgstr "Jungiama" + +#: ipconst:spsconnect +msgid "Connecting to server" +msgstr "Jungiama prie serverio" + +#: ipconst:swsaeconnrefused +msgid "Connection refused" +msgstr "Prisijungimo atsisakyta" + +#: ipconst:swsaeconnreset +msgid "Connection reset by peer" +msgstr "Klientas ryšį atstatė į pradinę būseną" + +#: ipconst:swsaetimedout +msgid "Connection timed out" +msgstr "Ryšio laikas baigėsi" + +#: ipconst:ssmtpresponse65 +msgid "Conversion failed" +msgstr "Konversija nepavyko" + +#: ipconst:ssmtpresponse62 +msgid "Conversion required and prohibited" +msgstr "Konversija, reikalinga ir uždrausta" + +#: ipconst:ssmtpresponse63 +msgid "Conversion required but not supported" +msgstr "Konversija reikalinga, bet nepalaikoma" + +#: ipconst:ssmtpresponse64 +msgid "Conversion with loss performed" +msgstr "Atlikta koversija su praradimais" + +#: ipconst:suuencodecounterr +msgid "Count <> Len or Count > 63" +msgstr "Kiekis <> Ilgis arba Kiekis > 63" + +#: ipconst:spngtruncatedcrc +msgid "CRC Code is truncated" +msgstr "CRC kodas nukirstas" + +#: ipconst:ssmtpresponse76 +msgid "Cryptographic algorithm not supported" +msgstr "Kriptografijos arlgoritmas nepalaikomas" + +#: ipconst:ssmtpresponse75 +msgid "Cryptographic failure" +msgstr "Kriptografija nepavyko" + +#: ipconst:snntpcmddate +msgid "DATE" +msgstr "DATE" + +#: ipconst:spop3cmddele +msgid "DELE" +msgstr "DELE" + +#: ipconst:sftpdelete +msgid "Deleting " +msgstr "Šalinama " + +#: ipconst:ssmtpresponse71 +msgid "Delivery not authorized, message refused" +msgstr "Nėra įgaliojimų siuntimui, pranešimo atsisakyta" + +#: ipconst:ssmtpresponse47 +msgid "Delivery time expired" +msgstr "Siuntimo laikas baigėsi" + +#: ipconst:swsaedestaddrreq +msgid "Destination address required" +msgstr "Reikalingas paskirties adresas" + +#: ipconst:sipicmp_no_resources +msgid "Destination does not have resources to complete" +msgstr "Paskirtis negali baigti dėl resursų trūkumo" + +#: ipconst:sipicmp_dest_host_unreachable +msgid "Destination host unreachable" +msgstr "Paskirties mazgas nepasiekiamas" + +#: ipconst:sipicmp_source_quench +msgid "Destination is busy" +msgstr "Paskirtis užimta" + +#: ipconst:ssmtpresponse14 +msgid "Destination mailbox address ambiguous" +msgstr "Neaiškus paskirties pašto dėžutės adresas" + +#: ipconst:ssmtpresponse15 +msgid "Destination mailbox address valid" +msgstr "Paskirties pašto dėžutės adresas geras" + +#: ipconst:sipicmp_dest_net_unreachable +msgid "Destination network unreachable" +msgstr "Paskirties tinklas nepasiekiamas" + +#: ipconst:sipicmp_dest_port_unreachable +msgid "Destination port unreachable" +msgstr "Paskirites prievadas nepasiekiamas" + +#: ipconst:sipicmp_dest_prot_unreachable +msgid "Destination protocol unreachable" +msgstr "Paskirties protokolas nepasiekiamas" + +#: ipconst:sdestroying +msgid "Destroying" +msgstr "Naikinama" + +#: ipconst:srasdeviceconnected +msgid "Device connected" +msgstr "Įrenginys prijungtas" + +#: ipconst:ssslfailedhelloparse +msgid "Did not parse server hello correctly." +msgstr "Klaidingai išnagrinėjau serverio hello." + +#: ipconst:swsaenotempty +msgid "Directory not empty" +msgstr "Katalogas nėra tuščias" + +#: ipconst:srasdisconnected +msgid "Disconnected" +msgstr "Atsijungta" + +#: ipconst:httpdisconnect +msgid "Disconnected: (%s), %s Total bytes received" +msgstr "Atsijungta: (%s), viso %s bitų priimta" + +#: ipconst:spsquit +msgid "Disconnecting" +msgstr "Atsijungiama" + +#: ipconst:swsaedquot +msgid "Disk quota exceeded" +msgstr "Viršyta disko kvota" + +#: ipconst:providerunknownformat +msgid "Don't know how to handle %s" +msgstr "Nežinau kaip atdoroti %s" + +#: ipconst:sbrokerdownloadreq +msgid "Download %s?" +msgstr "Atsiųsti %s?" + +#: ipconst:httpdownload +msgid "Download: (%s), Error downloading" +msgstr "Atsiųsti: (%s), klaida atsiunčiant" + +#: ipconst:httpgotheader +msgid "Download: (%s), Got Header Data" +msgstr "Atsiųsti: (%s), gauti antraštės duomenys" + +#: ipconst:httpsizemismatch +msgid "Download: (%s), Size Mismatch expecting %s , got %s" +msgstr "Atsiųsti: (%s), neatitinka dydis, tikėtasi %s, gauta %s" + +#: ipconst:sbrokerdownloadtitle +msgid "Download?" +msgstr "Atsiųsti?" + +#: ipconst:sicmpecho +msgid "Echo reply (Hop number: %d)\015\n Status = %d\015\n RTTime = %d\015\n Ttl = %d\015\n Tos = %d\015\n IpFlags = %d" +msgstr "Atsakymo aidas (Hop numeris: %d)\015\n Būsena = %d\015\n RTTime = %d\015\n Ttl = %d\015\n Tos = %d\015\n IpFlags = %d" + +#: ipconst:sicmpechostring +msgid "Echo string: %s" +msgstr "Aido eilutė: %s" + +#: ipconst:spngeffectivefilter +msgid "Effective filter is %s" +msgstr "Efektyvus filtras yra %s" + +#: ipconst:sunsupportedencoding +msgid "Encoding method not supported" +msgstr "Kodavimo metodas nepalaikomas" + +#: ipconst:ssslencryptbuf2small +msgid "Encrypt buffer to small." +msgstr "Šifravimo buferis permažas." + +#: ipconst:ssslencryptiontype +msgid "Encryption type not defined." +msgstr "Nenurodytas šifravimo tipas." + +#: ipconst:spngmissingiend +msgid "End of PNG found with no IEND chunk" +msgstr "PNG gale nerasta IEND dalis" + +#: ipconst:shtmllineerror +msgid "Error \"%s\" at line %d, position %d" +msgstr "Klaida \"%s\" eilutėje %d, pozicijoje %d" + +#: ipconst:swsa_qos_admission_failure +msgid "Error due to lack of resources" +msgstr "Dėl resursų trūkumo įvyko klaida" + +#: ipconst:sssexpand +msgid "Expanding" +msgstr "Plečiama" + +#: ipconst:ssslexpiredcertificate +msgid "Expired Certificate." +msgstr "Sertifikatas nebegalioja." + +#: ipconst:swsaenametoolong +msgid "File name too long" +msgstr "Failo vardas perilgas" + +#: ipconst:spngfilterchange +msgid "Filter changed on Row %d to %x" +msgstr "%d eilutėje esantis filtras pakeistas į %x" + +#: ipconst:spngfiltermethod +msgid "Filter Method: %d" +msgstr "Filtro metodas: %d" + +#: ipconst:spnggamatoolong +msgid "gAMA chunk is long" +msgstr "Perilga gAMA dalis" + +#: ipconst:spnggamatooshort +msgid "gAMA chunk is short" +msgstr "Pertrumpa gAMA dalis" + +#: ipconst:spnggammacorrection +msgid "Gamma Correction: %f" +msgstr "Gama korekcija: %f" + +#: ipconst:swsa_qos_generic_error +msgid "General error" +msgstr "Bendra klaida" + +#: ipconst:slogarticle +msgid "Generating OnArticle event" +msgstr "Generuojamas OnArticle įvykis" + +#: ipconst:slogencodeactionstart +msgid "Generating OnEncodeAction(Start)" +msgstr "Generuojamas OnEncodeAction(Start) įvykis" + +#: ipconst:slogencodeactionstop +msgid "Generating OnEncodeAction(Stop)" +msgstr "Generuojamas OnEncodeAction(Stop) įvykis" + +#: ipconst:slogpop3message +msgid "Generating OnMessage event" +msgstr "Generuojamas OnMessage įvykis" + +#: ipconst:slogmultiline +msgid "Generating OnMultiLineResponse event" +msgstr "Generuojamas OnMultiLineResponse įvykis" + +#: ipconst:slogsmtpnextmessage +msgid "Generating OnNextMessage event" +msgstr "Generuojamas OnNextMessage įvykis" + +#: ipconst:slogresponse +msgid "Generating OnResponse event, Code = " +msgstr "Generating OnResponse event, kodas = " + +#: ipconst:slogtaskcomplete +msgid "Generating OnTaskComplete event " +msgstr "Generuojamas OnTaskComplete įvykis" + +#: ipconst:slogpop3top +msgid "Generating OnTop event" +msgstr "Generuojamas OnTop įvykis" + +#: ipconst:httpget +msgid "GET: (%s)" +msgstr "GET: (%s)" + +#: ipconst:httpgeterror +msgid "GET: (%s) FAILED" +msgstr "GET: (%s) NEPAVYKO" + +#: ipconst:snsnewnews +msgid "Getting new articles" +msgstr "Gaunami nauji straipsniai" + +#: ipconst:snsnewgroups +msgid "Getting new news groups" +msgstr "Gaunamos naujos naujienų grupės" + +#: ipconst:swsaediscon +msgid "Graceful shutdown in progress" +msgstr "Vyksta grakštus išjungimas" + +#: ipconst:snntpcmdgroup +msgid "GROUP" +msgstr "GROUP" + +#: ipconst:ssslhandshakefailure +msgid "Handshake failure." +msgstr "Nepavyko patrvirtinti ryšio užmezgimo." + +#: ipconst:sipicmp_hw_error +msgid "Hardware error" +msgstr "Aparatūros klaida" + +#: ipconst:snntpcmdhead +msgid "HEAD" +msgstr "HEAD" + +#: ipconst:httphead +msgid "HEAD: (%s)" +msgstr "HEAD: (%s)" + +#: ipconst:httpheaderror +msgid "HEAD: (%s) FAILED" +msgstr "HEAD: (%s) NEPAVYKO" + +#: ipconst:ssshelp +msgid "Help" +msgstr "Žinynas" + +#: ipconst:swsaehostdown +msgid "Host is down" +msgstr "Mazgas nusprogo" + +#: ipconst:swsahost_not_found +msgid "Host not found" +msgstr "Mazgas nerastas" + +#: ipconst:spngihdrtoolong +msgid "IHDR chunk is long." +msgstr "Perilga IHDR dalis." + +#: ipconst:spngmissingihdr +msgid "IHDR Chunk is missing" +msgstr "Nėra IHDR dalies" + +#: ipconst:spngihdrtooshort +msgid "IHDR chunk is short." +msgstr "Pertrumpa IHDR dalis." + +#: ipconst:ssslillegalparameter +msgid "Illegal Parameter." +msgstr "Neleistinas parametras." + +#: ipconst:spngimagesize +msgid "Image size is %dx%d pixels" +msgstr "Paveikslo dydis pikseliais yra %dx%d" + +#: ipconst:sbadimagelibstream +msgid "ImageLib must use TMemoryStreams" +msgstr "\"ImageLib\" turi naudoti \"TMemoryStreams\"" + +#: ipconst:sindexerr +msgid "Index out of range" +msgstr "Indeksas peržengia ribas" + +#: ipconst:srasinteractive +msgid "Interactive" +msgstr "Interaktyvus" + +#: ipconst:spnginterlacemethod +msgid "Interlace Method: %d" +msgstr "Progresinis metodas: %d" + +#: ipconst:shtmlinternal +msgid "Internal error" +msgstr "Vidinė klaida" + +#: ipconst:swsaeintr +msgid "Interrupted function call" +msgstr "Pertrauktas kreipimasis į funkciją" + +#: ipconst:shtmlinvalign +msgid "Invalid alignment specified" +msgstr "Nurodyta klaidinga lygiuotė" + +#: ipconst:swsaeinval +msgid "Invalid argument" +msgstr "Klaidingas argumentas" + +#: ipconst:sbinhexbadchar +msgid "Invalid BinHex character" +msgstr "Klaidingas BinHex simbolis" + +#: ipconst:sbinhexbadformat +msgid "Invalid BinHex format" +msgstr "Klaidingas BinHex formatas" + +#: ipconst:ssslinvalidcipher +msgid "Invalid cipher." +msgstr "Klaidingas šifras." + +#: ipconst:shtmlinvcolor +msgid "Invalid color constant:" +msgstr "Klaidinga spalvos konstanta:" + +#: ipconst:ssmtpresponse51 +msgid "Invalid command" +msgstr "Klaidinga komanda" + +#: ipconst:ssmtpresponse54 +msgid "Invalid command arguments" +msgstr "Klaidingi komandos argumentai" + +#: ipconst:sbinhexlengtherr +msgid "Invalid data length" +msgstr "Klaidingas duomenų ilgis" + +#: ipconst:shtmlinvdir +msgid "Invalid dir value specified" +msgstr "Nurodyta klaidinga dir reikšmė" + +#: ipconst:shtmlinvframe +msgid "Invalid frame specified" +msgstr "Nurodytas klaidingas kadras" + +#: ipconst:shtmlinvgraphic +msgid "Invalid graphic returned" +msgstr "Grąžinta klaidinga grafika" + +#: ipconst:shtmlinvint +msgid "Invalid integer constant" +msgstr "Klaidinga sveikojo skaičiaus konstanta" + +#: ipconst:sbadlinelength +msgid "Invalid line length" +msgstr "Klaidingas eilutės ilgis" + +#: ipconst:slinelengtherr +msgid "Invalid line length for encoded text" +msgstr "Eilutės, skirtos užkoduotam tekstui, ilgis klaidingas" + +#: ipconst:sbadlineterminator +msgid "Invalid line terminator" +msgstr "Klaidingas eilutės terminatorius" + +#: ipconst:shtmlinvmethod +msgid "Invalid method specified" +msgstr "Nurodytas klaidingas metodas" + +#: ipconst:spngbadmodificationtime +msgid "Invalid Modification Time" +msgstr "Klaidingas modifikavimo laikas" + +#: ipconst:spngbadpalettelength +msgid "Invalid Palette Length" +msgstr "Klaidingas paletės ilgis" + +#: ipconst:providerunknownpicture +msgid "Invalid picture format" +msgstr "Klaidingas paveikslo formatas" + +#: ipconst:shtmlinvpicture +msgid "Invalid picture returned" +msgstr "Grąžintas klaidingas paveikslas" + +#: ipconst:spngbadsignature +msgid "Invalid PNG Signature" +msgstr "Klaidingas PNG parašas" + +#: ipconst:swsaeinvalidproctable +msgid "Invalid procedure table from service provider" +msgstr "Klaidinga paslaugos teikėjo procedurų lentelė" + +#: ipconst:sinvalrespcode +msgid "Invalid response code" +msgstr "Klaidingas atsako kodas" + +#: ipconst:shtmlinvrule +msgid "Invalid rule specified" +msgstr "Nurodyta klaidinga taisyklė" + +#: ipconst:shtmlinvscope +msgid "Invalid scope specified" +msgstr "Nurodyta klaidinga sritis" + +#: ipconst:shtmlinvscroll +msgid "Invalid scrolling specified" +msgstr "Nurodyta klaidinga slinktis" + +#: ipconst:sbadseekorigin +msgid "Invalid seek origin" +msgstr "Klaidinga peršokimo atskaita" + +#: ipconst:swsaeinvalidprovider +msgid "Invalid service provider version number" +msgstr "Klaidingas paslaugos teikėjo versijos numeris" + +#: ipconst:shtmlinvshape +msgid "Invalid shape specified" +msgstr "Nurodytas klaidingas pavidalas" + +#: ipconst:sbadoffset +msgid "Invalid stream offset" +msgstr "Klaidingas srauto poslinkis" + +#: ipconst:shtmlinvtype +msgid "Invalid type specified" +msgstr "Nurodytas klaidingas tipas" + +#: ipconst:shtmlinvvaltype +msgid "Invalid value type specified" +msgstr "Nurodytas klaidingas reikšmės tipas" + +#: ipconst:ssslbadkeyexchangetype +msgid "Key exchange message expected but not received" +msgstr "Tikėtasi klavišo mainų pranešimo, tačiau jis negautas" + +#: ipconst:snntpcmdlast +msgid "LAST" +msgstr "LAST" + +#: ipconst:spop3cmdlist +msgid "LIST" +msgstr "LIST" + +#: ipconst:snntpcmdlistacttimes +msgid "LIST ACTIVE.TIMES" +msgstr "LIST ACTIVE.TIMES" + +#: ipconst:snntpcmdlistdistribpats +msgid "LIST DISTRIB.PATS" +msgstr "LIST DISTRIB.PATS" + +#: ipconst:snntpcmdlistdistrib +msgid "LIST DISTRIBUTIONS" +msgstr "LIST DISTRIBUTIONS" + +#: ipconst:snntpcmdlistext +msgid "LIST EXTENSIONS" +msgstr "LIST EXTENSIONS" + +#: ipconst:snntpcmdlistnewsgroups +msgid "LIST NEWSGROUPS" +msgstr "LIST NEWSGROUPS" + +#: ipconst:slistnotassigned +msgid "List not assigned" +msgstr "Sąrašas nepriskirtas" + +#: ipconst:snntpcmdlistoverfmt +msgid "LIST OVERVIEW.FMT" +msgstr "LIST OVERVIEW.FMT" + +#: ipconst:snntpcmdlistgroup +msgid "LISTGROUP" +msgstr "LISTGROUP" + +#: ipconst:cacheretrieving +msgid "Loading from Cache (%s = %s)" +msgstr "Įkeliama iš podėlio (%s = %s)" + +#: ipconst:sstlogon +msgid "Logging on" +msgstr "Registruojamasi" + +#: ipconst:spsapop +msgid "Logging on with APOP" +msgstr "Registruojamasi su APOP" + +#: ipconst:sssehlo +msgid "Logging on with EHLO" +msgstr "Registruojamasi su EHLO" + +#: ipconst:ssshelo +msgid "Logging on with HELO" +msgstr "Registruojamasi su HELO" + +#: ipconst:spspass +msgid "Logging on with Password" +msgstr "Registruojamasi su slaptažodžiu" + +#: ipconst:spsuser +msgid "Logging on with User" +msgstr "Registruojamasi su naudotoju" + +#: ipconst:sraslogonnetwork +msgid "Logon network" +msgstr "Registravimosi tinklas" + +#: ipconst:swsa_e_cancelled +msgid "Lookup cancelled" +msgstr "Paieška nutraukta" + +#: ipconst:ssslbadmac +msgid "MAC did not match." +msgstr "Neatitinka MAC" + +#: ipconst:ssmtpresponse31 +msgid "Mail system full" +msgstr "Pašto sistema pilna" + +#: ipconst:ssmtpresponse21 +msgid "Mailbox disabled, not accepting messages" +msgstr "Pašto dėžutė neveiksni, pranešimai nepriimami" + +#: ipconst:ssmtpresponse22 +msgid "Mailbox full" +msgstr "Pašto dėžutė pilna" + +#: ipconst:ssmtpresponse16 +msgid "Mailbox has moved" +msgstr "Pašto dėžutė persikėlusi" + +#: ipconst:ssmtpresponse24 +msgid "Mailing list expansion problem" +msgstr "Adresatų sąrašo išplėtimo problema" + +#: ipconst:ssmtpresponse72 +msgid "Mailing list expansion prohibited" +msgstr "Uždrausta plėsti adresatų sąrašą" + +#: ipconst:spsdele +msgid "Marking message for deletion" +msgstr "Pranešimai žymimi trynimui" + +#: ipconst:ssslbadmd5hash +msgid "MD5 hash did not match." +msgstr "Neatitinka MD5 maišos reikšmė." + +#: ipconst:ssmtpresponse61 +msgid "Media not supported" +msgstr "Medija nepalaikoma" + +#: ipconst:spngmemoryrequired +msgid "Memory required for image: %d bytes" +msgstr "Paveikslui reikia atminties: %d baitų" + +#: ipconst:ssmtpresponse77 +msgid "Message integrity failure" +msgstr "Pranešimas prarado vientisumą" + +#: ipconst:ssmtpresponse23 +msgid "Message length exceeds administrative limit." +msgstr "Pranešimas ilgesnis nei nustatytas administratoriaus." + +#: ipconst:ssmtpresponse34 +msgid "Message too big for system" +msgstr "Pranešimas perdidelis sistemai" + +#: ipconst:swsaemsgsize +msgid "Message too long" +msgstr "Pranešimas perilgas" + +#: ipconst:spngmodificationdate +msgid "Modification Date: %s" +msgstr "Modifikavimo data: %s" + +#: ipconst:ssmtpresponse45 +msgid "Network congestion" +msgstr "Tinklas užkimštas" + +#: ipconst:swsaenetreset +msgid "Network dropped connection on reset" +msgstr "Tinklas, pasileisdamas iš naujo, nutraukė ryšį" + +#: ipconst:swsaenetdown +msgid "Network is down" +msgstr "Tinklas nusprogo" + +#: ipconst:swsaenetunreach +msgid "Network is unreachable" +msgstr "Tinklas nepasiekiamas" + +#: ipconst:swsasysnotready +msgid "Network subsystem is unavailable" +msgstr "Nėra tinklo posistemės" + +#: ipconst:snntpcmdnewgroups +msgid "NEWGROUPS" +msgstr "NEWGROUPS" + +#: ipconst:snntpcmdnewnews +msgid "NEWNEWS" +msgstr "NEWNEWS" + +#: ipconst:snntpcmdnext +msgid "NEXT" +msgstr "NEXT" + +#: ipconst:slognextmessagenotready +msgid "Next message not ready" +msgstr "Tolesnis pranešimas neparengtas" + +#: ipconst:slognextmessageready +msgid "Next message ready" +msgstr "Tolesnis pranešimas neparengtas" + +#: ipconst:ssmtpresponse41 +msgid "No answer from host" +msgstr "Mazgo atsakymas negautas" + +#: ipconst:swsaenobufs +msgid "No buffer space available" +msgstr "Buferyje nebėra vietos" + +#: ipconst:shtmlnodataprovider +msgid "No data provider assigned" +msgstr "Nepriskirtas duomenų teikėjas" + +#: ipconst:ssslnohashtype +msgid "No hash type selected." +msgstr "Nenurodytas maišos tipas" + +#: ipconst:httpnoheaderdata +msgid "No Header Data for Entity" +msgstr "Esybėje nėra antraštės duomenų" + +#: ipconst:snomemorystreamerr +msgid "No Memory Stream assigned" +msgstr "Nepriskirtas atminties srautas" + +#: ipconst:ssslnomessageencslected +msgid "No message encoding type selected." +msgstr "Nenurodytas pranešimo koduotės tipas" + +#: ipconst:snoboundary +msgid "No Mime boundary" +msgstr "Nėra MIME rėžio" + +#: ipconst:swsaenomore +msgid "No more data available" +msgstr "Duomenys baigėsi" + +#: ipconst:shtmlnogetimage +msgid "No OnGetImage event handler assigned" +msgstr "Nepriskirta OnGetImage įvykio tvarkyklė" + +#: ipconst:sssnoop +msgid "No operation" +msgstr "Nėra operacijos" + +#: ipconst:sslnopremastersecret +msgid "No pre-master secret." +msgstr "Nėra \"pre-master secret\"." + +#: ipconst:snorecipients +msgid "No recipients specified" +msgstr "Nenurodyti gavėjai" + +#: ipconst:swsaehostunreach +msgid "No route to host" +msgstr "Nėra maršruto iki mazgo" + +#: ipconst:snoseekforread +msgid "No seek for read" +msgstr "Nei peršokimų, nei skaitymų" + +#: ipconst:snoseekforwrite +msgid "No seek for write" +msgstr "Nei peršokimų, nei rašymų" + +#: ipconst:sptnone +msgid "No task" +msgstr "Nėra užduočių" + +#: ipconst:swsatry_again +msgid "Nonauthoritative host not found" +msgstr "Nepatikimų mazgų nerasta" + +#: ipconst:sstnotask +msgid "None" +msgstr "Joks" + +#: ipconst:spop3cmdnoop +msgid "NOOP" +msgstr "NOOP" + +#: ipconst:snotenoughdata +msgid "Not enough data in queue (%s bytes) to satisfy read request (%s bytes)" +msgstr "Eilėje (%s baitų) trūksta duomenų skaitymo užklausų (%s baitų) įvykdymui" + +#: ipconst:ssslnotenoughkeymaterail +msgid "Not enough key material." +msgstr "Nepakanka rakto medžiagos." + +#: ipconst:ssslnoroom +msgid "Not enough memory available to read SSL record." +msgstr "Norint nuskaityti SSL įrašą, reikia daugiau atminties." + +#: ipconst:snotimererr +msgid "Not enough system timers available" +msgstr "Permažai sisteminių laikmačių" + +#: ipconst:sbinhexoddchar +msgid "One odd character" +msgstr "Vienas nelyginis simbolis" + +#: ipconst:srasopenport +msgid "Open port" +msgstr "Vienas prievadas" + +#: ipconst:swsaealready +msgid "Operation already in progress" +msgstr "Operacija jau yra vykdoma" + +#: ipconst:swsaeopnotsupp +msgid "Operation not supported" +msgstr "Operacija nepalaikoma" + +#: ipconst:swsaeinprogress +msgid "Operation now in progress" +msgstr "Operacija vykdoma dabar" + +#: ipconst:sipicmp_option_too_big +msgid "Option too large" +msgstr "Parinktis perdidelė" + +#: ipconst:ssmtpresponse10 +msgid "Other address status" +msgstr "Kita adreso būsena" + +#: ipconst:ssmtpresponse30 +msgid "Other or undefined mail system status" +msgstr "Kita arba neapibrėžta pašto sistemos būsena" + +#: ipconst:ssmtpresponse20 +msgid "Other or undefined mailbox status" +msgstr "Kita arba neapibrėžta pašto dėžutės būsena" + +#: ipconst:ssmtpresponse60 +msgid "Other or undefined media error" +msgstr "Kita arba neapibrėžta medijos klaida" + +#: ipconst:ssmtpresponse40 +msgid "Other or undefined network or routing status" +msgstr "Kita arba neapibrėžta tinklo ar maršruto parinkimo būsena" + +#: ipconst:ssmtpresponse50 +msgid "Other or undefined protocol status" +msgstr "Kita arba neapibrėžta protokolo būsena" + +#: ipconst:ssmtpresponse70 +msgid "Other or undefined security status" +msgstr "Kita arba neapibrėžta saugumo būsena" + +#: ipconst:sipicmp_packet_too_big +msgid "Packet too large" +msgstr "Paketas perdidelis" + +#: ipconst:ssslpaddingerror +msgid "Padding error." +msgstr "Užpildymo klaida." + +#: ipconst:spngpaletteentry +msgid "Palette Entry %d - Red: %d Green: %d Blue: %d" +msgstr "Paletės %d įrašas: Raudona = %d, Žalia = %d, Mėlyna = %d" + +#: ipconst:spngpalettetransparency +msgid "Palette Transparency: %d Alpha %d" +msgstr "Paletės skaidrumas: %d alfa %d" + +#: ipconst:sipicmp_param_problem +msgid "Parameter problem" +msgstr "Parametro problema" + +#: ipconst:shtmlnotcontainer +msgid "Parent is not a container" +msgstr "Tėvas nėra sudėtinis rodinys" + +#: ipconst:ssslparsererror +msgid "Parsing error." +msgstr "Analizės klaida." + +#: ipconst:spop3cmdpass +msgid "PASS" +msgstr "PASS" + +#: ipconst:sraspasswordexpired +msgid "Password expired" +msgstr "Slaptažodis nebegalioja" + +#: ipconst:snntpcmdpat +msgid "PAT" +msgstr "PAT" + +#: ipconst:sbadpath +msgid "Path does not exist" +msgstr "Kelias neegzistuoja" + +#: ipconst:sraspaused +msgid "Paused" +msgstr "Pristabdyta" + +#: ipconst:swsaeacces +msgid "Permission denied" +msgstr "Neleidžiama" + +#: ipconst:ssmtpresponse05 +msgid "Persistent, " +msgstr "Nuolatinis, " + +#: ipconst:shtmlnographic +msgid "Picture object contains no graphic object" +msgstr "Paveikslo objekte nėra grafinio objektio" + +#: ipconst:sicmppingstart +msgid "Pinging %s with %d bytes data" +msgstr "Skimbetelėjamas %s su %d baitų duomenų" + +#: ipconst:spngbuffertoosmall +msgid "PNG Buffer too small." +msgstr "PNG buferis permažas." + +#: ipconst:spngchunkidandlength +msgid "PNG Chunk: %s Length: %d" +msgstr "PNG dalis: %s ilgis: %d" + +#: ipconst:spngnoclipboard +msgid "PNG Clipboard support is not supported." +msgstr "Iškarpinė nepalaiko PNG." + +#: ipconst:spngcannotsave +msgid "PNG Saving is not supported" +msgstr "PNG išsaugojimas nepalaikomas" + +#: ipconst:ssslpointernotassigned +msgid "Pointer not assigned." +msgstr "Rodyklė nepriskirta." + +#: ipconst:srasportopened +msgid "Port opened" +msgstr "Prievadas atvertas" + +#: ipconst:snntpcmdpost +msgid "POST" +msgstr "POST" + +#: ipconst:httppost +msgid "POST: (%s)" +msgstr "POST: (%s)" + +#: ipconst:httpposterror +msgid "POST: (%s) FAILED" +msgstr "POST: (%s) NEPAVYKO" + +#: ipconst:snspost +msgid "Posting article" +msgstr "Starpsnis siunčiamas" + +#: ipconst:srasprepareforcallback +msgid "Prepare for callback" +msgstr "Ruošiamasi atgaliniam skambučiui" + +#: ipconst:snsprepost +msgid "Preparing to post article" +msgstr "Ruošiamasi siųsti straipstį" + +#: ipconst:swsa_qos_bad_object +msgid "Problem filterspec or providerspecific buffer" +msgstr "\"filterspec\" arba specifinio tiekėjo buferio problema" + +#: ipconst:swsa_qos_traffic_ctrl_error +msgid "Problem with some part of the flowspec" +msgstr "Kažkurios \"flowspec\" dalies problema" + +#: ipconst:httpprogress +msgid "Progress Made: (%s), %s bytes received" +msgstr "Eiga: (%s), %s baitų parsiųsta" + +#: ipconst:srasprojected +msgid "Projected" +msgstr "Suprojektuota" + +#: ipconst:swsaepfnosupport +msgid "Protocol family not supported" +msgstr "Protokolo šeima nepalaikoma" + +#: ipconst:swsaeprotonosupport +msgid "Protocol not supported" +msgstr "Protokolas nepalaikomas" + +#: ipconst:swsaeprototype +msgid "Protocol wrong type for socket" +msgstr "Protokolo tipas netinka jungčiai" + +#: ipconst:sssquit +msgid "Quit" +msgstr "Baigti" + +#: ipconst:sraserr +msgid "Ras Error (%d): on API '%s'" +msgstr "\"Ras\" klaida (%d): iššaukė API '%s'" + +#: ipconst:srasreauthenticate +msgid "Re-authenticate" +msgstr "Vėl nustatyti tapatybę" + +#: ipconst:ssslreaderror +msgid "Read error." +msgstr "Klaida skaitant." + +#: ipconst:ssslreadsizemissmatch +msgid "Read size miss-match." +msgstr "Perskaitytas kiekis nesiderina." + +#: ipconst:sreadlineerr +msgid "Received line too long, exceeds MaxLineBuf" +msgstr "Priimta eilutė perilga, ilgis viršija MaxLineBuf" + +#: ipconst:swsaerefused +msgid "Refused" +msgstr "Atsisakyta" + +#: ipconst:swsa_qos_policy_failure +msgid "Rejected for administrative reasons - bad credentials" +msgstr "Atmesta dėl administravimo priežasčių - blogi įgaliojamieji raštai" + +#: ipconst:srenameddiskfileto +msgid "Renamed disk file to " +msgstr "Diske failas pervardytas į " + +#: ipconst:sftprename +msgid "Renaming " +msgstr "Pervardyjama " + +#: ipconst:sipicmp_req_timed_out +msgid "Request timed out" +msgstr "Baigėsi užklausos laikas" + +#: ipconst:sssauthlogin +msgid "Requesting authentication" +msgstr "Reikalaujama nustatyti tapatumą" + +#: ipconst:swsa_qos_request_confirmed +msgid "Reserve has been confirmed" +msgstr "\"Reserve\" patvirtintas" + +#: ipconst:shtmldefresetcaption +msgid "Reset" +msgstr "Perkrauti" + +#: ipconst:spsrset +msgid "Resetting messages" +msgstr "Perkraunami pranešimai" + +#: ipconst:sssrset +msgid "Resetting server" +msgstr "Perkraunamas serveris" + +#: ipconst:sbinhexresourceforkerr +msgid "Resource fork present" +msgstr "Resursų šakos dovanėlė" + +#: ipconst:swsaewouldblock +msgid "Resource temporarily unavailable" +msgstr "Resursas laikinai neprieinamas" + +#: ipconst:shtmlresunavail +msgid "Resource unavailable:" +msgstr "Resurso nėra:" + +#: ipconst:spop3cmdretr +msgid "RETR" +msgstr "RETR" + +#: ipconst:sftpretrieve +msgid "Retrieving " +msgstr "Gaunama " + +#: ipconst:snslistactivetimes +msgid "Retrieving active times" +msgstr "Gaunami aktyvūs laikai" + +#: ipconst:snsarticle +msgid "Retrieving article" +msgstr "Gaunamas straipsnis" + +#: ipconst:snslistgroup +msgid "Retrieving article numbers" +msgstr "Gaunami straipsnio numeriai" + +#: ipconst:snsbody +msgid "Retrieving body" +msgstr "Gaunama pagrindinė dalis" + +#: ipconst:snslistdistribpats +msgid "Retrieving distribution patterns" +msgstr "Gaunamas pasiskirstymo deriniai" + +#: ipconst:snshead +msgid "Retrieving heading" +msgstr "Gaunama antraštė" + +#: ipconst:snshelp +msgid "Retrieving help" +msgstr "Gaunamas žinynas" + +#: ipconst:snslist +msgid "Retrieving list" +msgstr "Gaunamas sąrašas" + +#: ipconst:snslistnewsgroups +msgid "Retrieving list of available news groups" +msgstr "Gaunamas esamų naujienų grupių sąrašas" + +#: ipconst:snslistdistributions +msgid "Retrieving list of distributions" +msgstr "Ganamas platinamųjų sąrašas" + +#: ipconst:snslistext +msgid "Retrieving list of extended commands" +msgstr "Gaunamas indeksuotų komandų sąrašas" + +#: ipconst:spslist +msgid "Retrieving mailbox list" +msgstr "Gaunamas pašto dėžutės sąrašas" + +#: ipconst:spsstat +msgid "Retrieving mailbox status" +msgstr "Gaunama pašto dėžutės būsena" + +#: ipconst:spsuidl +msgid "Retrieving mailbox UID list" +msgstr "Gaunamas pašto dėžutės UID sąrašas" + +#: ipconst:spsretr +msgid "Retrieving message" +msgstr "Gaunamas pranešimas" + +#: ipconst:sntnewnews +msgid "Retrieving new news" +msgstr "Gaunamos naujos naujienos" + +#: ipconst:snsover +msgid "Retrieving overview" +msgstr "Gaunama apžvalga" + +#: ipconst:snslistoverviewfmt +msgid "Retrieving overview format" +msgstr "Ganamas apžvalgos formatas" + +#: ipconst:snspat +msgid "Retrieving patterns" +msgstr "Gaunamas deriniai" + +#: ipconst:snsdate +msgid "Retrieving server date" +msgstr "Gaunama serverio data" + +#: ipconst:snsstat +msgid "Retrieving status" +msgstr "Gaunama būsena" + +#: ipconst:spstop +msgid "Retrieving top of message" +msgstr "Gaunamas pranešimo viršus" + +#: ipconst:srasretryauthentication +msgid "Retry authentication" +msgstr "Kartojamas tapatybės nustatymas" + +#: ipconst:ssslrevokedcertificate +msgid "Revoked Certificate." +msgstr "Panaikintas sertifikatas." + +#: ipconst:ssmtpresponse46 +msgid "Routing loop detected" +msgstr "Aptiktas uždaras maršrutas" + +#: ipconst:ssmtpresponse43 +msgid "Routing server failure" +msgstr "Maršruto parinkimo serverio gedimas" + +#: ipconst:spop3cmdrset +msgid "RSET" +msgstr "RSET" + +#: ipconst:ssmtpresponse73 +msgid "Security conversion required but not possible" +msgstr "Būtinas saugumo konvertavimas, tačiau neįmanomas" + +#: ipconst:ssmtpresponse74 +msgid "Security features not supported" +msgstr "Saugumo funkcijos nepalaikomos" + +#: ipconst:sseekingdiskfileto +msgid "Seeking disk file to " +msgstr "Disko faile peršokama į " + +#: ipconst:snsgroup +msgid "Selecting group" +msgstr "Žymima grupė" + +#: ipconst:snsnext +msgid "Selecting next article" +msgstr "Žymimas tolesnis straipsnis" + +#: ipconst:snslast +msgid "Selecting previous article" +msgstr "Žymimas ankstesnis straipsnis" + +#: ipconst:sssrcptbcc +msgid "Sending BCC info" +msgstr "Siunčiama BCC informacija" + +#: ipconst:sssrcptcc +msgid "Sending CC info" +msgstr "Siunčiama CC informacija" + +#: ipconst:sssdata +msgid "Sending Data" +msgstr "Siunčiami duomenys" + +#: ipconst:ssssendenvelope +msgid "Sending Envelope" +msgstr "Siunčiamas vokas" + +#: ipconst:sstsendmail +msgid "Sending mail" +msgstr "Siunčiamas laiškas" + +#: ipconst:sssrcptto +msgid "Sending MailTo info" +msgstr "Siunčiama MailTo informacija" + +#: ipconst:ssssendmessage +msgid "Sending Message" +msgstr "Siunčiamas pranešimas" + +#: ipconst:sssmailfrom +msgid "Sending sender's info" +msgstr "Siunčiama informacija apie siuntėją" + +#: ipconst:sssspecial +msgid "Sending special command" +msgstr "Siunčiama speciali komanda" + +#: ipconst:ssslservernohandshake +msgid "Server cid not return a handshake message." +msgstr "Serverio \"cid\" negrąžino ryšio užmezgimo pranešimo." + +#: ipconst:ssslservernoserverhello +msgid "Server cid not return a server hello message." +msgstr "serverio \"cid\" negrąžino serverio hello pranešimo." + +#: ipconst:ssslbadrecordmac +msgid "Server received a bad record MAC." +msgstr "Serveris gavo bloga įrašo MAC." + +#: ipconst:ssslunexpectedmessage +msgid "Server received an unexpected message." +msgstr "Serveris gavo nelauktą pranešimą." + +#: ipconst:ssslclosenotify +msgid "Server sent close notify." +msgstr "Serveris nusiuntė pranešimą apie užvėrimą." + +#: ipconst:swsaservice_not_found +msgid "Service not found" +msgstr "Paslauga nerasta" + +#: ipconst:ssslsessidtolong +msgid "Session ID is longer than 32 bytes." +msgstr "Seanso ID ilgesnis nei 32 baitai." + +#: ipconst:ssslshabuf2small +msgid "SHA1 buffer to small." +msgstr "Permažas SHA1 buferis." + +#: ipconst:ssslbadsha1hash +msgid "SHA1 hash did not match." +msgstr "Neatitinka SHA1 maišos reikšmė." + +#: ipconst:swsaeisconn +msgid "Socket is already connected" +msgstr "Jungtis jau yra prijungta" + +#: ipconst:swsaenotconn +msgid "Socket is not connected" +msgstr "Jungtis neprijungta" + +#: ipconst:snosockerr +msgid "Socket not assigned" +msgstr "Jungtis nepriskirta" + +#: ipconst:swsaenotsock +msgid "Socket operation on nonsocket" +msgstr "Jungties operacija pritaikyta ne jungčiai" + +#: ipconst:swsaesocktnosupport +msgid "Socket type not supported" +msgstr "Jungties tipas nepalaikomas" + +#: ipconst:ssockserr +msgid "SOCKS request refused - %d" +msgstr "Atsisakyta SOCKS užklausos - %d" + +#: ipconst:swsaeconnaborted +msgid "Software caused connection abort" +msgstr "Programa nutraukė ryšį" + +#: ipconst:spsspecial +msgid "Special command" +msgstr "Speciali komanda" + +#: ipconst:ssslunprocesseddata +msgid "SSL data processing error." +msgstr "SSL duomenų apdorojimo klaida" + +#: ipconst:ssssaml +msgid "ssSaml" +msgstr "ssSaml" + +#: ipconst:ssssend +msgid "ssSend" +msgstr "ssSend" + +#: ipconst:ssssoml +msgid "ssSoml" +msgstr "ssSoml" + +#: ipconst:sssturn +msgid "ssTurn" +msgstr "ssTurn" + +#: ipconst:swsaestale +msgid "Stale NFS file handle" +msgstr "Pasenusi NFS failo rodyklė" + +#: ipconst:srasstartauthentication +msgid "Start authentication" +msgstr "Pradėti tapatybės nustatymą" + +#: ipconst:slogtaskstart +msgid "Starting task: " +msgstr "Startuojama užduotis: " + +#: ipconst:spop3cmdstat +msgid "STAT" +msgstr "STAT" + +#: ipconst:slogstate +msgid "State change: " +msgstr "Būsenos keitimas: " + +#: ipconst:sftpstore +msgid "Storing " +msgstr "Kaupiama " + +#: ipconst:sstreamcreateerror +msgid "Stream create error " +msgstr "Klaida kuriant srautą " + +#: ipconst:snostreamerr +msgid "Stream not assigned" +msgstr "Srautas nepriskirtas" + +#: ipconst:srassubentryconnected +msgid "Sub-entry connected" +msgstr "Poelementis prijungtas" + +#: ipconst:srassubentrydisconnected +msgid "Sub-entry disconnected" +msgstr "Polelementis atjungtas" + +#: ipconst:shtmldefsubmitcaption +msgid "Submit" +msgstr "Išsiųsti" + +#: ipconst:ssmtpresponse02 +msgid "Success, " +msgstr "Sėkmė, " + +#: ipconst:sipicmp_success +msgid "Successful" +msgstr "Sėkmingas" + +#: ipconst:swsanotinitialised +msgid "Successful WSAStartup not yet performed" +msgstr "Sėkmingas WSAStartup dar neįvykdytas" + +#: ipconst:sstreamcreated +msgid "Successfully created " +msgstr "Sėkmingai sukurta " + +#: ipconst:ssmtpresponse52 +msgid "Syntax error" +msgstr "Sintaksės klaida" + +#: ipconst:swsasyscallfailure +msgid "System call failure" +msgstr "Nepavyko kreiptis į sistemą" + +#: ipconst:ssmtpresponse32 +msgid "System not accepting network messages" +msgstr "Sistema nepriima tinklo pranešimų" + +#: ipconst:ssmtpresponse33 +msgid "System not capable of selected features" +msgstr "Sistema nesugeba pažymėtųjų funkcijų" + +#: ipconst:smemmapmustbeclosed +msgid "The %s method requires the TIpMemMapStream instance to be closed" +msgstr "%s metodas reikalauja kad TIpMemMapStream objektas būtų užvertas" + +#: ipconst:smemmapmustbeopen +msgid "The %s method requires the TIpMemMapStream instance to be opened" +msgstr "%s metodas reikalauja kad TIpMemMapStream objektas būtų atvertas" + +#: ipconst:swsa_qos_no_receivers +msgid "There are no receivers" +msgstr "Imtuvų nėra" + +#: ipconst:swsa_qos_no_senders +msgid "There are no senders" +msgstr "Siųstuvų nėra" + +#: ipconst:swsano_recovery +msgid "This is a nonrecoverable error" +msgstr "Tai neatkuriama klaida" + +#: ipconst:sicmpthreadexecute +msgid "Thread %d executing (Hop number = %d)" +msgstr "Gija %d vykdoma (Hop numeris = %d)" + +#: ipconst:sicmpthreadterminate +msgid "Thread %d terminating (Hop number = %d)" +msgstr "Gija %d baigia darbą (Hop numeris = %d)" + +#: ipconst:spngtimetoolong +msgid "tIME chunk is long." +msgstr "tIME dalis ilga." + +#: ipconst:spngtimetooshort +msgid "tIME chunk is short." +msgstr "tIME dalis trumpa." + +#: ipconst:sipicmp_ttl_expired_reassem +msgid "Time to live expired during reassembly" +msgstr "Surenkant pakartotinai, gyvavimo laikas baigėsi" + +#: ipconst:sipicmp_ttl_expired_transit +msgid "Time to live expired during transmit" +msgstr "Siunčiant, gyvavimo laikas baigėsi" + +#: ipconst:sinvitemsize +msgid "TIpTerminalArray.GetItemPtr: invalid item size" +msgstr "TIpTerminalArray.GetItemPtr: klaidingas elemento dydis" + +#: ipconst:srowrowoor +msgid "TIpTerminalArray.ScrollRows: either start row %d or end row %d is out of range" +msgstr "TIpTerminalArray.ScrollRows: pradžios eilutė %d arba galo eilutė %d peržengia ribas" + +#: ipconst:sinvscrollrow +msgid "TIpTerminalBuffer.SetScrollRegion: invalid row number(s)" +msgstr "TIpTerminalBuffer.SetScrollRegion: klaidingas eilutės numerias(-iai)" + +#: ipconst:shtmltokenstackoverfl +msgid "Token stack overflow" +msgstr "Leksemų dėklo perpilda" + +#: ipconst:swsaeremote +msgid "Too many levels of remote in path" +msgstr "Kelyje perdaug nuotolinio lygių" + +#: ipconst:swsaeloop +msgid "Too many levels of symbolic links" +msgstr "Perdaug simbolinių saitų" + +#: ipconst:swsaemfile +msgid "Too many open files" +msgstr "Perdaug atvertų failų" + +#: ipconst:spngpalettetoolong +msgid "Too many palette entries" +msgstr "Perdaug paletės įrašų" + +#: ipconst:swsaeproclim +msgid "Too many processes" +msgstr "Perdaug procesų" + +#: ipconst:ssmtpresponse53 +msgid "Too many recipients" +msgstr "Perdaug gavėjų" + +#: ipconst:swsaetoomanyrefs +msgid "Too many references; cannot splice" +msgstr "Perdaug atskaitų; neina sujungti" + +#: ipconst:swsaeusers +msgid "Too many users" +msgstr "Perdaug naudotojų" + +#: ipconst:spop3cmdtop +msgid "TOP" +msgstr "TOP" + +#: ipconst:sicmptracecomplete +msgid "Trace complete (%s), %d hops" +msgstr "Sekimas baigtas (%s), %s Hop'sų" + +#: ipconst:sicmptracestart +msgid "Trace to %s started" +msgstr "Pradėtas %s sekimas" + +#: ipconst:sftpuserabort +msgid "Transfer aborted by user" +msgstr "Siuntimą nutraukė naudotojas" + +#: ipconst:sftpcomplete +msgid "Transfer complete. " +msgstr "Siuntimas baigtas. " + +#: ipconst:sftptimeout +msgid "Transfer timed out" +msgstr "Siuntimo laikas baigėsi" + +#: ipconst:ssmtpresponse04 +msgid "Transient, " +msgstr "Trumpalaikis, " + +#: ipconst:spngtransparentcolor +msgid "Transparent Color: %x" +msgstr "Permatoma spalva: %x" + +#: ipconst:swsatype_not_found +msgid "Type not found" +msgstr "Tipas nerastas" + +#: ipconst:spop3cmduidl +msgid "UIDL" +msgstr "UIDL" + +#: ipconst:swsaeproviderfailedinit +msgid "Unable to initialize a service provider" +msgstr "Neina inicializuoti paslaugos teikėjo" + +#: ipconst:httpcantloadgraphic +msgid "Unable to load graphic %s" +msgstr "Neina įkelti grafiką %s" + +#: ipconst:ssmtpresponse44 +msgid "Unable to route" +msgstr "Neina parinkti maršrutą" + +#: ipconst:spngdefilterpass +msgid "Unfiltering Pass %d Size: %dx%d From: %dx%d" +msgstr "Pass nefiltruojamas %d Dydis: %dx%d Nuo: %dx%d" + +#: ipconst:ssslunknowncertificate +msgid "Unknown Certificate." +msgstr "Nežinomas sertifikatas." + +#: ipconst:swsa_qos_bad_style +msgid "Unknown or conflicting style" +msgstr "Nežinomas arba konfliktinis stilius" + +#: ipconst:providerunknownrequest +msgid "Unknown request type \"%s\"" +msgstr "Nežinomas užklausos tipas \"%s\"" + +#: ipconst:ssmtpresponseunknown +msgid "Unknown response code" +msgstr "Nežinomas atsako kodas" + +#: ipconst:spsunknown +msgid "Unknown state" +msgstr "Nežinoma būsena" + +#: ipconst:sipicmp_unknown +msgid "Unknown status" +msgstr "Nežinomas statusas" + +#: ipconst:ssmtpresponsesubunknown +msgid "Unknown subcode" +msgstr "Nežinoma kodo dalis" + +#: ipconst:sptunknown +msgid "Unknown task" +msgstr "Nežinoma užduotis" + +#: ipconst:shtmlunknowntok +msgid "Unknown token" +msgstr "Nežinoma leksema" + +#: ipconst:spngbadchunktype +msgid "Unrecognized Chunk Type: %s" +msgstr "Neatpažintas dalies tipas: %s" + +#: ipconst:spngbadcolortype +msgid "Unrecognized color type of %d" +msgstr "Neatpažintas %d spalvos tipas" + +#: ipconst:sbadimagelibfileformat +msgid "Unrecognized file format" +msgstr "Neatpažintas failo formatas" + +#: ipconst:spngbadinterlacemethod +msgid "Unrecognized Interlace Method" +msgstr "Neatpažintas progresinis metodas" + +#: ipconst:sbadframelistobject +msgid "Unrecognized object of class %s in GIF Frame List" +msgstr "GIF kadrų sąraše neatpažintas %s klasės objektas" + +#: ipconst:spngbadpixeldepth +msgid "Unrecognized pixel depth of %d" +msgstr "Neatpažintas %d pikselių gylis" + +#: ipconst:spngbadbitdepth +msgid "Unsupported Bit Depth of %d" +msgstr "Nepalaikomas %d bitų gylis" + +#: ipconst:ssslunsupportedcertificate +msgid "Unsupported Certificate." +msgstr "Nepalaikomas sertifikatas." + +#: ipconst:ssslunsupportedchiper +msgid "Unsupported cipher chosen." +msgstr "Nurodytas nepalaikomas šifras." + +#: ipconst:shtmlunsupprotocol +msgid "Unsupported protocol in URL:%s" +msgstr "URL nurodytas nepalaikomas protokolas:%s" + +#: ipconst:ssslunsupportedencoding +msgid "Unsupported public encoding." +msgstr "Nepalaikoma vieša koduotė." + +#: ipconst:spop3cmduser +msgid "USER" +msgstr "USER" + +#: ipconst:swsano_data +msgid "Valid name, no data record of requested type" +msgstr "Teisingas vardas, užklausto tipo duomenų įrašo nėra" + +#: ipconst:sssverify +msgid "Verifying" +msgstr "Tikrinama" + +#: ipconst:sraswaitforcallback +msgid "Wait for callback" +msgstr "Lauk atgalinio skambučio" + +#: ipconst:sraswaitformodemreset +msgid "Wait for modem reset" +msgstr "Lauk kol modemas startuos išnaujo" + +#: ipconst:soriginfrombegin +msgid "When origin is soFromBeginning, Offset must be >= 0" +msgstr "Kai pradžia yra soFromBeginning, Offset turi būti >= 0" + +#: ipconst:soriginfromend +msgid "When origin is soFromEnd, Offset must be <= 0" +msgstr "Kai pradžia yra soFromEnd, Offset turi būti <= 0" + +#: ipconst:saccessprocerr +msgid "Win32 error loading '%s' pointer: %s" +msgstr "Įkeliant '%s' įvyko Win32 klaida: %s" + +#: ipconst:swsavernotsupported +msgid "WinSock DLL version not supported" +msgstr "Nepalaikoma WinSock DLL versija" + +#: ipconst:swinsockerr +msgid "WinSock Error (%d): %s, on API '%s'" +msgstr "WinSock klaida (%d): %s, iššaukta API '%s'" + +#: ipconst:ssmtpresponse55 +msgid "Wrong protocol version" +msgstr "Klaidinga protokolo versija" + +#: ipconst:snntpcmdxover +msgid "XOVER" +msgstr "XOVER" + +#: ipconst:smemmapfilenamerequired +msgid "You must specify a file name for TIpMemMapStream" +msgstr "\"TIpMemMapStream\" reikalauja kad nurodytumėt failo vardą" + +#: ipconst:slogicmpclass +msgid "[ICMP] " +msgstr "[ICMP] " + +#: ipconst:slognntpclass +msgid "[NNTP] " +msgstr "[NNTP] " + +#: ipconst:slogpop3class +msgid "[POP3] " +msgstr "[POP3] " + +#: ipconst:slogsmtpclass +msgid "[SMTP] " +msgstr "[SMTP] " + diff --git a/components/turbopower_ipro/languages/iputils.lt.po b/components/turbopower_ipro/languages/iputils.lt.po new file mode 100644 index 0000000000..36779b71d3 --- /dev/null +++ b/components/turbopower_ipro/languages/iputils.lt.po @@ -0,0 +1,21 @@ +# translation of iputils.po to Lithuanian +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 00:31+0300\n" +"Project-Id-Version: iputils\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" + +#: iputils:sshortversion +msgid "v%.2f" +msgstr "v%.2f" + +#: iputils:slongversion +msgid "Version %.2f" +msgstr "Versaja %.2f" + diff --git a/examples/codepageconverter/languages/lazconverter.lt.po b/examples/codepageconverter/languages/lazconverter.lt.po new file mode 100644 index 0000000000..7ac2166ab2 --- /dev/null +++ b/examples/codepageconverter/languages/lazconverter.lt.po @@ -0,0 +1,77 @@ +# translation of mainunit.po to Lithuanian +# Header entry was created by KBabel! +# +# +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 13:55+0300\n" +"Project-Id-Version: mainunit\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" +"Last-Translator: Valdas Jankūnas \n" + +# +msgid "Codepage LazConverter for PAS, LFM, LRS & INC files v0.0.4" +msgstr "Koduotės konverteris LazConverter (PAS, LFM, LRS ir INC failams) v0.0.4" + +# +msgid "Path to your project:" +msgstr "Kelias iki jūsų projekto:" + +# +msgid "Path" +msgstr "Kelias" + +# +msgid "Convert From:" +msgstr "Konvertuoti iš:" + +# +msgid "Convert To:" +msgstr "Konvertuoti į:" + +# +msgid "Include subdirectories" +msgstr "Ir pokatalogiuose" + +# +msgid "Search" +msgstr "Ieškoti" + +# +msgid "Convert" +msgstr "Konvertuoti" + +# +msgid "Directory:" +msgstr "Katalogas:" + +# +msgid "Ready..." +msgstr "Parengtyje..." + +# +msgid "Remove from conversion" +msgstr "Nekonvertuoti" + +# +msgid "View" +msgstr "Peržiūrėti" + +# +msgid "View File" +msgstr "Peržiūrėti failą" + +# +msgid "-" +msgstr "-" + +# +msgid "Remove From Conversion" +msgstr "Nekonvertuoti" + diff --git a/examples/codepageconverter/languages/mainunit.lt.po b/examples/codepageconverter/languages/mainunit.lt.po new file mode 100644 index 0000000000..7ac2166ab2 --- /dev/null +++ b/examples/codepageconverter/languages/mainunit.lt.po @@ -0,0 +1,77 @@ +# translation of mainunit.po to Lithuanian +# Header entry was created by KBabel! +# +# +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 13:55+0300\n" +"Project-Id-Version: mainunit\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" +"Last-Translator: Valdas Jankūnas \n" + +# +msgid "Codepage LazConverter for PAS, LFM, LRS & INC files v0.0.4" +msgstr "Koduotės konverteris LazConverter (PAS, LFM, LRS ir INC failams) v0.0.4" + +# +msgid "Path to your project:" +msgstr "Kelias iki jūsų projekto:" + +# +msgid "Path" +msgstr "Kelias" + +# +msgid "Convert From:" +msgstr "Konvertuoti iš:" + +# +msgid "Convert To:" +msgstr "Konvertuoti į:" + +# +msgid "Include subdirectories" +msgstr "Ir pokatalogiuose" + +# +msgid "Search" +msgstr "Ieškoti" + +# +msgid "Convert" +msgstr "Konvertuoti" + +# +msgid "Directory:" +msgstr "Katalogas:" + +# +msgid "Ready..." +msgstr "Parengtyje..." + +# +msgid "Remove from conversion" +msgstr "Nekonvertuoti" + +# +msgid "View" +msgstr "Peržiūrėti" + +# +msgid "View File" +msgstr "Peržiūrėti failą" + +# +msgid "-" +msgstr "-" + +# +msgid "Remove From Conversion" +msgstr "Nekonvertuoti" + diff --git a/ideintf/languages/objinspstrconsts.lt.po b/ideintf/languages/objinspstrconsts.lt.po new file mode 100644 index 0000000000..fa72f0916c --- /dev/null +++ b/ideintf/languages/objinspstrconsts.lt.po @@ -0,0 +1,1041 @@ +# translation of objinspstrconsts.po to Lithuanian +# Header entry was created by KBabel! +# +#: objinspstrconsts:oisobjectinspector +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 14:50+0300\n" +"Project-Id-Version: objinspstrconsts\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" +"Last-Translator: Valdas Jankūnas \n" + +#: objinspstrconsts:oisobjectinspector +msgid "Object Inspector" +msgstr "Objektų inspektorius" + +#: objinspstrconsts:oisall +msgid "All" +msgstr "Visus" + +#: objinspstrconsts:oiserror +msgid "Error" +msgstr "Klaida" + +#: objinspstrconsts:oisitemsselected +msgid "%u items selected" +msgstr "pažymėta %u elementų" + +#: objinspstrconsts:oiscadd +msgid "&Add" +msgstr "Pri&dėti" + +#: objinspstrconsts:oiscdelete +msgid "&Delete" +msgstr "Paša&linti" + +#: objinspstrconsts:oisconfirmdelete +msgid "Confirm delete" +msgstr "Patvirtinimas šalinant" + +#: objinspstrconsts:oisdeleteitem +msgid "Delete item %s%s%s?" +msgstr "Pašalinti elementą %s%s%s?" + +#: objinspstrconsts:oisunknown +msgid "Unknown" +msgstr "Nežinoma" + +#: objinspstrconsts:oisobject +msgid "Object" +msgstr "Objektas" + +#: objinspstrconsts:oisclass +msgid "Class" +msgstr "Klasė" + +#: objinspstrconsts:oisword +msgid "Word" +msgstr "Word tipo sveikasis skaičius" + +#: objinspstrconsts:oisstring +msgid "String" +msgstr "Tekstas" + +#: objinspstrconsts:oisfloat +msgid "Float" +msgstr "Realusis skaičius" + +#: objinspstrconsts:oisset +msgid "Set" +msgstr "Aibė" + +#: objinspstrconsts:oismethod +msgid "Method" +msgstr "Metodas" + +#: objinspstrconsts:oisvariant +msgid "Variant" +msgstr "Įvairaus tipo" + +#: objinspstrconsts:oisarray +msgid "Array" +msgstr "Masyvas" + +#: objinspstrconsts:oisrecord +msgid "Record" +msgstr "Įrašas" + +#: objinspstrconsts:oisinterface +msgid "Interface" +msgstr "Interfeisas" + +#: objinspstrconsts:oisproperties +msgid "Properties" +msgstr "Savybės" + +#: objinspstrconsts:oisevents +msgid "Events" +msgstr "Įvykiai" + +#: objinspstrconsts:oisfavorites +msgid "Favorites" +msgstr "Mėgstamiausi" + +#: objinspstrconsts:oissettodefault +msgid "Set to default: %s" +msgstr "Keisti į numatytą: %s" + +#: objinspstrconsts:oissettodefaultvalue +msgid "Set to default value" +msgstr "Keisti į numatytą reikšmę" + +#: objinspstrconsts:oisaddtofavorites +msgid "Add to Favorites" +msgstr "Įdėti į mėgstamiausiųjų sąrašą" + +#: objinspstrconsts:oisremovefromfavorites +msgid "Remove from Favorites" +msgstr "Išmesti iš mėgstamiausiųjų sąrašo" + +#: objinspstrconsts:oisundo +msgid "Undo" +msgstr "Grąžinti" + +#: objinspstrconsts:oisfinddeclaration +msgid "Jump to declaration" +msgstr "Rodyti kur paskelbta" + +#: objinspstrconsts:oiscutcomponents +msgid "Cut components" +msgstr "Iškirpti komponentą" + +#: objinspstrconsts:oiscopycomponents +msgid "Copy components" +msgstr "Kopijuoti komponentą" + +#: objinspstrconsts:oispastecomponents +msgid "Paste components" +msgstr "Įterpti komponentą" + +#: objinspstrconsts:oisdeletecomponents +msgid "Delete components" +msgstr "Pašalinti komponentą" + +#: objinspstrconsts:oisdelete +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:rscdmoveup +msgid "Move up" +msgstr "Perkelti viršun" + +#: objinspstrconsts:rscdmovedown +msgid "Move down" +msgstr "Perkelti žemyn" + +#: objinspstrconsts:rscdok +msgid "OK" +msgstr "Tinka" + +#: objinspstrconsts:oisshowhints +msgid "Show Hints" +msgstr "Rodyti suflerius" + +#: objinspstrconsts:oisshowcomponenttree +msgid "Show Component Tree" +msgstr "Rodyti komponentų medį" + +#: objinspstrconsts:oisoptions +msgid "Options" +msgstr "Parinktys" + +#: objinspstrconsts:oisvalue +msgid "Value:" +msgstr "Reikšmė:" + +#: objinspstrconsts:oisinteger +msgid "Integer" +msgstr "Integer tipo sveikasis skaičius" + +#: objinspstrconsts:oisint64 +msgid "Int64" +msgstr "Int64 tipo sveikasis skaičius" + +#: objinspstrconsts:oisboolean +msgid "Boolean" +msgstr "Loginis tipas" + +#: objinspstrconsts:oisenumeration +msgid "Enumeration" +msgstr "Vardinis tipas" + +#: objinspstrconsts:oischar +msgid "Char" +msgstr "Simbolis" + +#: objinspstrconsts:sccstredtcaption +msgid "TreeView Items Editor" +msgstr "TreeView elementų redaktorius" + +#: objinspstrconsts:sccstredt +msgid "Edit TreeView Items..." +msgstr "Keisti TreeView elementus..." + +#: objinspstrconsts:sccstredtgrplcaption +msgid "Items" +msgstr "Elementai" + +#: objinspstrconsts:sccstredtgrprcaption +msgid "Item Properties" +msgstr "Elemento savybės" + +#: objinspstrconsts:sccstredtnewitem +msgid "New Item" +msgstr "Naujas elementas" + +#: objinspstrconsts:sccstredtnewsubitem +msgid "New SubItem" +msgstr "Naujas poelementis" + +#: objinspstrconsts:sccstredtdelete +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:sccstredtapply +msgid "Apply" +msgstr "Pritaikyti" + +#: objinspstrconsts:sccstredtload +msgid "Load" +msgstr "Įkelti" + +#: objinspstrconsts:sccstredtsave +msgid "Save" +msgstr "Išsaugoti" + +#: objinspstrconsts:sccstredtlabeltext +msgid "Text:" +msgstr "Tekstas:" + +#: objinspstrconsts:sccstredtlabelimageindex +msgid "Image Index:" +msgstr "Įprastas pav.:" + +#: objinspstrconsts:sccstredtlabelselindex +msgid "Selected Index:" +msgstr "Pav. pažymėjus:" + +#: objinspstrconsts:sccstredtlabelstateindex +msgid "State Index:" +msgstr "Būsenos pav.:" + +#: objinspstrconsts:sccstredtitem +msgid "Item" +msgstr "Elementas" + +#: objinspstrconsts:sccstredtopendialog +msgid "Open" +msgstr "Įkelti" + +#: objinspstrconsts:sccstredtsavedialog +msgid "Save" +msgstr "Išsaugoti" + +#: objinspstrconsts:sccslvedtcaption +msgid "ListView Items Editor" +msgstr "ListView elementų redaktorius" + +#: objinspstrconsts:sccslvedt +msgid "Edit ListView Items..." +msgstr "Keisti ListView elementus..." + +#: objinspstrconsts:sccslvedtgrplcaption +msgid "Items" +msgstr "Elementai" + +#: objinspstrconsts:sccslvedtgrprcaption +msgid "Item Properties" +msgstr "Elemento savybės" + +#: objinspstrconsts:sccslvedtnewitem +msgid "New Item" +msgstr "Naujas elementas" + +#: objinspstrconsts:sccslvedtnewsubitem +msgid "New SubItem" +msgstr "Naujas poelementis" + +#: objinspstrconsts:sccslvedtapply +msgid "Apply" +msgstr "Pritaikyti" + +#: objinspstrconsts:sccslvedtdelete +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:sccslvedtlabelcaption +msgid "Caption:" +msgstr "Užrašas:" + +#: objinspstrconsts:sccslvedtlabelimageindex +msgid "Image Index:" +msgstr "Įprastas pav.:" + +#: objinspstrconsts:sccslvedtlabelstateindex +msgid "State Index:" +msgstr "Būsenos pav.:" + +#: objinspstrconsts:sccslvedtitem +msgid "Item" +msgstr "Elementas" + +#: objinspstrconsts:sccsiledtcaption +msgid "ImageList Editor" +msgstr "ImageList redaktorius" + +#: objinspstrconsts:sccsiledtgrplcaption +msgid "Images" +msgstr "Paveikslai" + +#: objinspstrconsts:sccsiledtgrprcaption +msgid "Selected Image" +msgstr "Pažymėtas paveikslas" + +#: objinspstrconsts:sccsiledtadd +msgid "Add..." +msgstr "Pridėti" + +#: objinspstrconsts:sccsiledtdelete +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:sccsiledtapply +msgid "Apply" +msgstr "Pritaikyti" + +#: objinspstrconsts:sccsiledtclear +msgid "Clear" +msgstr "Išvalyti" + +#: objinspstrconsts:sccsiledtmoveup +msgid "Move Up" +msgstr "Perkelti aukštyn" + +#: objinspstrconsts:sccsiledtmovedown +msgid "Move Down" +msgstr "Perkelti žemyn" + +#: objinspstrconsts:sccsiledtsave +msgid "Save..." +msgstr "Išsaugoti..." + +#: objinspstrconsts:sccsiledtransparentcolor +msgid "Transparent Color:" +msgstr "Permatoma spalva:" + +#: objinspstrconsts:sccsiledtadjustment +msgid "Adjustment" +msgstr "Korekcija" + +#: objinspstrconsts:sccsiledtnone +msgid "None" +msgstr "Jiokios" + +#: objinspstrconsts:sccsiledtstretch +msgid "Stretch" +msgstr "Ištempti" + +#: objinspstrconsts:sccsiledtcrop +msgid "Crop" +msgstr "Apkirtpti" + +#: objinspstrconsts:sccsiledtcenter +msgid "Center" +msgstr "Centruoti" + +#: objinspstrconsts:rscdright +msgid "Right" +msgstr "Dešinė" + +#: objinspstrconsts:rscdvisible +msgid "Visible" +msgstr "Matoma" + +#: objinspstrconsts:rscdautosize +msgid "Auto Size" +msgstr "Dydis adaptyvus" + +#: objinspstrconsts:sccsiledtopendialog +msgid "Add Images" +msgstr "Pridėti paveikslų" + +#: objinspstrconsts:sccsiledtsavedialog +msgid "Save Image" +msgstr "Išsaugoti paveikslą" + +#: objinspstrconsts:sccssgedt +msgid "Edit StringGrid..." +msgstr "Keisti StringGrid..." + +#: objinspstrconsts:sccssgedtcaption +msgid "StringGrid Editor" +msgstr "StringGrid redaktorius" + +#: objinspstrconsts:sccssgedtgrp +msgid "String Grid" +msgstr "Teksto lentelė" + +#: objinspstrconsts:sccssgedtapply +msgid "Apply" +msgstr "Pritaikyti" + +#: objinspstrconsts:sccssgedtclean +msgid "Clean" +msgstr "Išvalyti" + +#: objinspstrconsts:sccssgedtload +msgid "Load..." +msgstr "Įkelti..." + +#: objinspstrconsts:sccssgedtsave +msgid "Save..." +msgstr "Išsaugoti..." + +#: objinspstrconsts:sccssgedtopendialog +msgid "Open" +msgstr "Įkelti" + +#: objinspstrconsts:sccssgedtsavedialog +msgid "Save" +msgstr "Išsaugoti" + +#: objinspstrconsts:sccssgedtmoverowscols +msgid "Move Rows/Cols" +msgstr "Perkelti\neilutes/\nstulpelius" + +#: objinspstrconsts:nbcesaddpage +msgid "Add page" +msgstr "Pridėti lapą" + +#: objinspstrconsts:nbcesinsertpage +msgid "Insert page" +msgstr "Įterpti lapą" + +#: objinspstrconsts:nbcesdeletepage +msgid "Delete page" +msgstr "Pašalinti lapą" + +#: objinspstrconsts:nbcesmovepageleft +msgid "Move page left" +msgstr "Lapą perkelti kairėn" + +#: objinspstrconsts:nbcesmovepageright +msgid "Move page right" +msgstr "Lapą perkelti dešinėn" + +#: objinspstrconsts:nbcesshowpage +msgid "Show page ..." +msgstr "Rodyti lapą..." + +#: objinspstrconsts:oiscreatedefaultevent +msgid "Create default event" +msgstr "Kurti numatytą įvykį" + +#: objinspstrconsts:tccesaddtab +msgid "Add tab" +msgstr "Pridėti kortelę" + +#: objinspstrconsts:tccesinserttab +msgid "Insert tab" +msgstr "Įterpti kortelę" + +#: objinspstrconsts:tccesdeletetab +msgid "Delete tab" +msgstr "Pašalinti kortelę" + +#: objinspstrconsts:tccesmovetableft +msgid "Move tab left" +msgstr "Kortelę perkelti kairėn" + +#: objinspstrconsts:tccesmovetabright +msgid "Move tab right" +msgstr "Kortelę perkelti dešinėn" + +#: objinspstrconsts:clbchecklistboxeditor +msgid "CheckListBox Editor" +msgstr "CheckListBox redaktorius" + +#: objinspstrconsts:clbup +msgid "&Up" +msgstr "&Viršun" + +#: objinspstrconsts:clbdown +msgid "Do&wn" +msgstr "&Apačion" + +#: objinspstrconsts:clbmodify +msgid "Modify the Item" +msgstr "Keisti elementą" + +#: objinspstrconsts:clbadd +msgid "Add new Item" +msgstr "Pridėti elementą" + +#: objinspstrconsts:clbdelete +msgid "Delete the Item %d \"%s\"?" +msgstr "Pašalinti elementą %d \"%s\"?" + +#: objinspstrconsts:clbcheckgroupeditor +msgid "CheckGroup Editor" +msgstr "CheckGroup redaktorius" + +#: objinspstrconsts:clbdisable +msgid "Popup to disable/enable items" +msgstr "Prieinamumą keisk per kontekstinį menių" + +#: objinspstrconsts:clbcolumns +msgid "n. columns" +msgstr "Stulpelių skaičius" + +#: objinspstrconsts:clbcheckduplicate +msgid "On Add, Check for Duplicate in Items" +msgstr "Tikrinti ar įdedamas elementas unikalus" + +#: objinspstrconsts:clbcheckduplicatemsg +msgid "The \"%s\" Item is already listed. Add it anyway? " +msgstr "Elementas \"%s\" jau egzistuoja. Vistiek jį įdėti?" + +#: objinspstrconsts:oicoleditadd +msgid "Add" +msgstr "Pridėti" + +#: objinspstrconsts:oicoleditdelete +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:oicoleditup +msgid "Up" +msgstr "Viršun" + +#: objinspstrconsts:oicoleditdown +msgid "Down" +msgstr "Žemyn" + +#: objinspstrconsts:oicoleditediting +msgid "Editing" +msgstr "Keičiama" + +#: objinspstrconsts:cactionlisteditorunknowncategory +msgid "(Unknown)" +msgstr "(Nežinoma)" + +#: objinspstrconsts:cactionlisteditorallcategory +msgid "(All)" +msgstr "(Visos)" + +#: objinspstrconsts:cactionlisteditoreditcategory +msgid "Edit" +msgstr "Keitimas" + +#: objinspstrconsts:cactionlisteditorhelpcategory +msgid "Help" +msgstr "Žinynas" + +#: objinspstrconsts:oiscategory +msgid "Category" +msgstr "Kategorija" + +#: objinspstrconsts:oisaction +msgid "Action" +msgstr "Veiksmas" + +#: objinspstrconsts:oismasks +msgid "Masks..." +msgstr "Kaukės..." + +#: objinspstrconsts:oissaveliteralcharacters +msgid "Save Literal Characters" +msgstr "Išsaugoti literalinius simbolius" + +#: objinspstrconsts:oisinputmask +msgid "Input Mask:" +msgstr "Įvedimo kaukė:" + +#: objinspstrconsts:oissamplemasks +msgid "Sample Masks:" +msgstr "Kaukių pavyzdžiai:" + +#: objinspstrconsts:oischaractersforblanks +msgid "Characters for Blanks" +msgstr "Tarpo simboliai" + +#: objinspstrconsts:oistestinput +msgid "Test Input" +msgstr "Testas" + +#: objinspstrconsts:oisopenmaskfile +msgid "Open masks file (*.dem)" +msgstr "Įkelti kaukes iš failo (*.dem)" + +#: objinspstrconsts:cactionlisteditordialogcategory +msgid "Dialog" +msgstr "Dialogas" + +#: objinspstrconsts:cactionlisteditorfilecategory +msgid "File" +msgstr "Failas" + +#: objinspstrconsts:cactionlisteditordatabasecategory +msgid "Database" +msgstr "Duomenų bazė" + +#: objinspstrconsts:oiseditactionlist +msgid "Edit action list..." +msgstr "Keisti ActionList..." + +#: objinspstrconsts:oisactionlisteditor +msgid "Action List Editor" +msgstr "ActionList redaktorius" + +#: objinspstrconsts:cactionlisteditornewaction +msgid "New Action" +msgstr "Naujas veiksmas" + +#: objinspstrconsts:cactionlisteditornewstdaction +msgid "New Standard Action" +msgstr "Naujas standartinis veiksmas" + +#: objinspstrconsts:cactionlisteditormovedownaction +msgid "Move Down" +msgstr "Perkelti žemyn" + +#: objinspstrconsts:ilesadd +msgid "Add" +msgstr "Pridėti" + +#: objinspstrconsts:cactionlisteditormoveupaction +msgid "Move Up" +msgstr "Perkelti žemyn" + +#: objinspstrconsts:cactionlisteditordeleteactionhint +msgid "Delete Action" +msgstr "Pašalinti veiksmą" + +#: objinspstrconsts:cactionlisteditordeleteaction +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:cactionlisteditorpaneldescrriptions +msgid "Panel Descriptions" +msgstr "Panelių aprašymai" + +#: objinspstrconsts:cactionlisteditorpaneltoolbar +msgid "Toolbar" +msgstr "Įrankių juosta" + +#: objinspstrconsts:oistdacteditcutheadline +msgid "Cu&t" +msgstr "&Iškirpti" + +#: objinspstrconsts:oistdacteditcopyheadline +msgid "&Copy" +msgstr "&Kopijuoti" + +#: objinspstrconsts:oistdacteditpasteheadline +msgid "&Paste" +msgstr "Į&dėti" + +#: objinspstrconsts:oistdacteditselectallheadline +msgid "Select &All" +msgstr "Pažymėti &viską" + +#: objinspstrconsts:oistdacteditundoheadline +msgid "&Undo" +msgstr "&Grąžinti" + +#: objinspstrconsts:oistdacteditdeleteheadline +msgid "&Delete" +msgstr "&Pašalinti" + +#: objinspstrconsts:oistdacthelpcontentsheadline +msgid "&Contents" +msgstr "Turin&ys" + +#: objinspstrconsts:oistdacthelptopicsearchheadline +msgid "&Topic Search" +msgstr "&Rodyklė" + +#: objinspstrconsts:oistdacthelphelphelpheadline +msgid "&Help on Help" +msgstr "Apie ži&nyną" + +#: objinspstrconsts:oistdactfileopenheadline +msgid "&Open..." +msgstr "At&verti..." + +#: objinspstrconsts:oistdactfilesaveasheadline +msgid "Save &As..." +msgstr "Įrašyti &kaip..." + +#: objinspstrconsts:oistdactfileexitheadline +msgid "E&xit" +msgstr "&Baigti darbą" + +#: objinspstrconsts:oistdactcolorselect1headline +msgid "Select &Color..." +msgstr "Išrinkti &spalvą.." + +#: objinspstrconsts:oistdactfonteditheadline +msgid "Select &Font..." +msgstr "Išrinkti šri&ftą" + +#: objinspstrconsts:oistdactdatasetfirstheadline +msgid "&First" +msgstr "&Pirmasis" + +#: objinspstrconsts:oistdactdatasetpriorheadline +msgid "&Prior" +msgstr "Ank&stesnis" + +#: objinspstrconsts:oistdactdatasetnextheadline +msgid "&Next" +msgstr "&Kitas" + +#: objinspstrconsts:oistdactdatasetlastheadline +msgid "&Last" +msgstr "Pasku&tinis" + +#: objinspstrconsts:oistdactdatasetinsertheadline +msgid "&Insert" +msgstr "Į&terpti" + +#: objinspstrconsts:oistdactdatasetdeleteheadline +msgid "&Delete" +msgstr "Paša&linti" + +#: objinspstrconsts:oistdactdataseteditheadline +msgid "&Edit" +msgstr "&Taisa" + +#: objinspstrconsts:oistdactdatasetpostheadline +msgid "P&ost" +msgstr "&Siųsti" + +#: objinspstrconsts:oistdactdatasetcancelheadline +msgid "&Cancel" +msgstr "&Atsisakyti" + +#: objinspstrconsts:oistdactdatasetrefreshheadline +msgid "&Refresh" +msgstr "Atnau&jinti" + +#: objinspstrconsts:oistdacteditcutshortcut +msgid "Ctrl+X" +msgstr "Ctrl+X" + +#: objinspstrconsts:oistdacteditcopyshortcut +msgid "Ctrl+C" +msgstr "Ctrl+C" + +#: objinspstrconsts:oistdacteditpasteshortcut +msgid "Ctrl+V" +msgstr "Ctrl+V" + +#: objinspstrconsts:oistdacteditselectallshortcut +msgid "Ctrl+A" +msgstr "Ctrl+A" + +#: objinspstrconsts:oistdacteditundoshortcut +msgid "Ctrl+Z" +msgstr "Ctrl+Z" + +#: objinspstrconsts:oistdacteditdeleteshortcut +msgid "Del" +msgstr "Del" + +#: objinspstrconsts:oistdactfileopenshortcut +msgid "Ctrl+O" +msgstr "Ctrl+O" + +#: objinspstrconsts:oistdacteditcutshorthint +msgid "Cut" +msgstr "Iškirpti" + +#: objinspstrconsts:oistdacteditcopyshorthint +msgid "Copy" +msgstr "Kopijuoti" + +#: objinspstrconsts:oistdacteditpasteshorthint +msgid "Paste" +msgstr "Įdėti" + +#: objinspstrconsts:oistdacteditselectallshorthint +msgid "Select All" +msgstr "Pažymėti viską" + +#: objinspstrconsts:oistdacteditundoshorthint +msgid "Undo" +msgstr "Grąžinti" + +#: objinspstrconsts:oistdacteditdeleteshorthint +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:oistdacthelpcontentshint +msgid "Help Contents" +msgstr "Žinyno turinys" + +#: objinspstrconsts:oistdacthelptopicsearchhint +msgid "Topic Search" +msgstr "Paieška rodyklėje" + +#: objinspstrconsts:oistdacthelphelphelphint +msgid "Help on help" +msgstr "Apie žinyną" + +#: objinspstrconsts:oistdactfileopenhint +msgid "Open" +msgstr "Atverti" + +#: objinspstrconsts:oistdactfilesaveashint +msgid "Save As" +msgstr "Išsaugoti kaip" + +#: objinspstrconsts:oistdactfileexithint +msgid "Exit" +msgstr "Baigti darbą" + +#: objinspstrconsts:oistdactcolorselecthint +msgid "Color Select" +msgstr "Išrinkti spalvą" + +#: objinspstrconsts:oistdactfontedithint +msgid "Font Select" +msgstr "Išrinkti šriftą" + +#: objinspstrconsts:oistdactdatasetfirsthint +msgid "First" +msgstr "Pirmasis" + +#: objinspstrconsts:oistdactdatasetpriorhint +msgid "Prior" +msgstr "Ankstesnis" + +#: objinspstrconsts:oistdactdatasetnexthint +msgid "Next" +msgstr "Kitas" + +#: objinspstrconsts:oistdactdatasetlasthint +msgid "Last" +msgstr "Paskutinis" + +#: objinspstrconsts:oistdactdatasetinserthint +msgid "Insert" +msgstr "Įterpti" + +#: objinspstrconsts:oistdactdatasetdeletehint +msgid "Delete" +msgstr "Pašalinti" + +#: objinspstrconsts:oistdactdatasetedithint +msgid "Edit" +msgstr "Taisa" + +#: objinspstrconsts:oistdactdatasetposthint +msgid "Post" +msgstr "Siūsti" + +#: objinspstrconsts:oistdactdatasetcancel1hint +msgid "Cancel" +msgstr "Atsisakyti" + +#: objinspstrconsts:oiscomponents +msgid "Components" +msgstr "Komponentai" + +#: objinspstrconsts:oistdactdatasetrefreshhint +msgid "Refresh" +msgstr "Atnaujinti" + +#: objinspstrconsts:oisstdactionlisteditor +msgid "Standard Action Classes" +msgstr "Standartinių veiksmų klasės:" + +#: objinspstrconsts:oisstdactionlisteditorclass +msgid "Available Action Classes:" +msgstr "Galimų veiksmų klasės:" + +#: objinspstrconsts:oisselectafile +msgid "Select a file" +msgstr "Išrink failą" + +#: objinspstrconsts:oispropertiesof +msgid "Properties of %s" +msgstr "%s savybės" + +#: objinspstrconsts:oisallfiles +msgid "All files" +msgstr "Visi failai" + +#: objinspstrconsts:oistestdialog +msgid "Test dialog..." +msgstr "Išbandyti dialogą..." + +#: objinspstrconsts:oissort +msgid "Sort" +msgstr "Rūšiuoti" + +#: objinspstrconsts:oisdlinesdchars +msgid "%d lines, %d chars" +msgstr "%d eilučių, %d simbolių" + +#: objinspstrconsts:ois1linedchars +msgid "1 line, %d chars" +msgstr "1 eilutė, %d simbolių" + +#: objinspstrconsts:oisstringseditordialog +msgid "Strings Editor Dialog" +msgstr "Teksto redaktorius" + +#: objinspstrconsts:ois0lines0chars +msgid "0 lines, 0 chars" +msgstr "0 eilučių, 0 simbolių" + +#: objinspstrconsts:oisinvalidpropertyvalue +msgid "Invalid property value" +msgstr "Klaidinga savybės reikšmė" + +#: objinspstrconsts:oisnone +msgid "(none)" +msgstr "(jokia)" + +#: objinspstrconsts:oiscomponentnameisnotavalididentifier +msgid "Component name %s%s%s is not a valid identifier" +msgstr "Komponentės vardas %s%s%s nėra teisingas identifikatorius" + +#: objinspstrconsts:oisloadimagedialog +msgid "Load Image Dialog" +msgstr "Įkelti paveikslą" + +#: objinspstrconsts:oisok +msgid "&OK" +msgstr "&Tinka" + +#: objinspstrconsts:oispepicture +msgid "Picture" +msgstr "Paveikslas" + +#: objinspstrconsts:oiscancel +msgid "&Cancel" +msgstr "&Atsisakyti" + +#: objinspstrconsts:oisloadpicture +msgid "Load picture" +msgstr "Įkelti paveikslą" + +#: objinspstrconsts:oissavepicture +msgid "Save picture" +msgstr "Išsaugoti paveikslą" + +#: objinspstrconsts:oisclearpicture +msgid "Clear picture" +msgstr "Išvalyti paveikslą" + +#: objinspstrconsts:oisload +msgid "&Load" +msgstr "Į&kelti" + +#: objinspstrconsts:oissave +msgid "&Save" +msgstr "&Išsaugoti" + +#: objinspstrconsts:oisclear +msgid "C&lear" +msgstr "Iš&valyti" + +#: objinspstrconsts:oispeopenimagefile +msgid "Open image file" +msgstr "Atverti paveikslo failą" + +#: objinspstrconsts:oispesaveimageas +msgid "Save image as" +msgstr "Išsaugoti paveikslą kaip" + +#: objinspstrconsts:oiserrorloadingimage +msgid "Error loading image" +msgstr "Klaida įkeliant paveikslą" + +#: objinspstrconsts:oiserrorloadingimage2 +msgid "Error loading image %s%s%s:%s%s" +msgstr "Įkeliant paveikslą įvyko klaida %s%s%s:%s%s" + +#: objinspstrconsts:oisok2 +msgid "Ok" +msgstr "Tinka" + +#: objinspstrconsts:oiscreateanewpascalunit +msgid "Create a new pascal unit." +msgstr "Kurti naują Paskalio modulį." + +#: objinspstrconsts:rscdcolumneditor +msgid "Column Editor" +msgstr "Stulpelių redaktorius" + +#: objinspstrconsts:rscdcaption +msgid "Caption" +msgstr "Užrašas" + +#: objinspstrconsts:rscdinvalidnumericvalue +msgid "Invalid numeric Value" +msgstr "Klaidingas numeris" + +#: objinspstrconsts:rscdwidth +msgid "Width" +msgstr "Plotis" + +#: objinspstrconsts:rscdalignment +msgid "Alignment" +msgstr "Lygiuotė" + +#: objinspstrconsts:rscdleft +msgid "Left" +msgstr "Kairė" + +#: objinspstrconsts:s_suggestsplitimage +msgid "Do you want to split the image?" +msgstr "Ar norite perskelti paveikslą?" + +#: objinspstrconsts:s_addassingle +msgid "Add as single" +msgstr "Pridėti vientisą" + +#: objinspstrconsts:s_splitimage +msgid "Split image" +msgstr "Perskelti paveikslą" + diff --git a/languages/installerstrconsts.lt.po b/languages/installerstrconsts.lt.po new file mode 100644 index 0000000000..2f81c901f5 --- /dev/null +++ b/languages/installerstrconsts.lt.po @@ -0,0 +1,33 @@ +# translation of installerstrconsts.po to Lithuanian +# Header entry was created by KBabel! +# +#: installerstrconsts:wiseditsource +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0" +"Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-18 13:09+0300\n" +"Project-Id-Version: installerstrconsts\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" + +#: installerstrconsts:wiseditsource +msgid "&Edit source" +msgstr "&Keisti išeities kodą" + +#: installerstrconsts:wiseditform +msgid "&Edit form" +msgstr "&Keisti formą" + +#: installerstrconsts:wisopenproject +msgid "&Open project" +msgstr "&Atverti projektą" + +#: installerstrconsts:wisopenpackage +msgid "&Open package" +msgstr "&Atverti paketą" + diff --git a/languages/lazaruside.lt.po b/languages/lazaruside.lt.po new file mode 100644 index 0000000000..0692ff8099 --- /dev/null +++ b/languages/lazaruside.lt.po @@ -0,0 +1,10293 @@ +# translation of lazaruside.po to Lithuanian +# Header entry was created by KBabel! +# +#: lazarusidestrconsts:liserrinvalidoption +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 14:56+0300\n" +"Project-Id-Version: lazaruside\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" +"Last-Translator: Valdas Jankūnas \n" + +#: lazarusidestrconsts:liserrinvalidoption +msgid "Invalid option at position %d: \"%s\"" +msgstr "Klaidinga parinktis ties pozicija %d: \"%s\"" + +#: lazarusidestrconsts:liserrnooptionallowed +msgid "Option at position %d does not allow an argument: %s" +msgstr "Parinkčiai ties pozicija %s argumentai nepriimtini: %s" + +#: lazarusidestrconsts:liserroptionneeded +msgid "Option at position %d needs an argument : %s" +msgstr "Parinkčiai ties pozicija %d reikia nurodyti argumentą: %s" + +#: lazarusidestrconsts:lisentertransla +msgid "Enter translation language" +msgstr "Įveskite vertimo kalbą" + +#: lazarusidestrconsts:lislazarusversionstring +msgid "%s beta" +msgstr "%s beta" + +#: lazarusidestrconsts:lisleaveemptyfo +msgid "Leave empty for default .po file" +msgstr "Palikite tuščią jei naudosite numatytąjį .po failą" + +#: lazarusidestrconsts:lismenucollectpofil +msgid "Collect .po files" +msgstr "Surinkti .po failus" + +#: lazarusidestrconsts:lismenucreatepofile +msgid "Create .po files" +msgstr "Kurti .po failus" + +#: lazarusidestrconsts:listhishelpmessage +msgid "this help message" +msgstr "Tai žinyno pranešimas" + +#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig +msgid "primary config directory, where Lazarus stores its config files. Default is " +msgstr "Pirminis katalogas nustatymamų failams, kuriame Lazarus laikys savo nustatymų failus. Numatytasis yra" + +#: lazarusidestrconsts:lislazarusoptionsprojectfilename +msgid "lazarus [options] " +msgstr "lazarus [parinktys] " + +#: lazarusidestrconsts:lisideoptions +msgid "IDE Options:" +msgstr "IKA parinktys:" + +#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions +msgid "LCL Interface specific options:" +msgstr "LCL interfeiso specifinės parinktys:" + +#: lazarusidestrconsts:lisdonotshowsplashscreen +msgid "Do not show splash screen" +msgstr "Nerodyti prisistatymo langelio" + +#: lazarusidestrconsts:lisskiploadinglastproject +msgid "Skip loading last project" +msgstr "Neįkelti paskutinio naudoto projekto" + +#: lazarusidestrconsts:lisoverridelanguage +msgid "Override language. For example --language=de. For possible values see files in the languages directory." +msgstr "Viršesnė kalba. Pavyzdžiui: --language=de. Galimas reikšmes galite sužinoti žvilgterėje į kalbų katalogą." + +#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor +msgid "secondary config directory, where Lazarus searches for config template files. Default is " +msgstr "Antrinis katalogas nustatymų failams, kuriame Lazarus ieškos nustatymų šablonų failų. Numatytasis yra" + +#: lazarusidestrconsts:lisfilewheredebugoutputiswritten +msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." +msgstr "Failas, į kurį bus rašoma derinimo išvestis. Jei jis nenurodytas, tai derinimo išvestis bus spauzdinama konsolėje." + +#: lazarusidestrconsts:lisselectiontool +msgid "Selection tool" +msgstr "Žymėjimo įrankis" + +#: lazarusidestrconsts:liscursorcolumnincurrenteditor +msgid "Cursor column in current editor" +msgstr "Žymeklio stulpelis veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:liscursorrowincurrenteditor +msgid "Cursor row in current editor" +msgstr "Žymeklio eilutė veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:liscompilerfilename +msgid "Compiler filename" +msgstr "Kompiliatoriaus failo vardas" + +#: lazarusidestrconsts:liswordatcursorincurrenteditor +msgid "Word at cursor in current editor" +msgstr "Žodis ties žymekliu veikiamąjame redaktoriuje" + +#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor +msgid "Expanded filename of current editor file" +msgstr "Veikiamojo redaktoriaus failo vardas su pilnu keliu iki jo" + +#: lazarusidestrconsts:lisfreepascalsourcedirectory +msgid "Freepascal source directory" +msgstr "FreePascal pirminio kodo katalogas" + +#: lazarusidestrconsts:lislazarusdirectory +msgid "Lazarus directory" +msgstr "Lazarus katalogas" + +#: lazarusidestrconsts:lislazaruslanguageid +msgid "Lazarus language ID (e.g. en, de, br, fi)" +msgstr "Lazarus kalbos ID (t.y. en, de, lt, ...)" + +#: lazarusidestrconsts:lislazaruslanguagename +msgid "Lazarus language name (e.g. english, deutsch)" +msgstr "Lazarus kalbos vardas (t.y. anglų, vokiečių, lietuvių, ...)" + +#: lazarusidestrconsts:lislclwidgettype +msgid "LCL Widget Type" +msgstr "LCL valdiklių tipas" + +#: lazarusidestrconsts:liscovarious +msgid "%s (various)" +msgstr "%s (įvairūs)" + +#: lazarusidestrconsts:listargetcpu +msgid "Target CPU" +msgstr "Paskirties procesorius" + +#: lazarusidestrconsts:listargetos +msgid "Target OS" +msgstr "Paskirties OS" + +#: lazarusidestrconsts:liscommandlineparamsofprogram +msgid "Command line parameters of program" +msgstr "Programos komandinės eilutės parametrai" + +#: lazarusidestrconsts:lispromptforvalue +msgid "Prompt for value" +msgstr "Kvietimas įvesti reikšmę" + +#: lazarusidestrconsts:lisprojectfilename +msgid "Project filename" +msgstr "Projekto failo vardas" + +#: lazarusidestrconsts:lisprojectdirectory +msgid "Project directory" +msgstr "Projekto katalogas" + +#: lazarusidestrconsts:lissavecurrenteditorfile +msgid "save current editor file" +msgstr "Išsaugoti dabartinį redaktoriaus failą" + +#: lazarusidestrconsts:lissaveallmodified +msgid "save all modified files" +msgstr "Išsaugoti visus pakeistus failus" + +#: lazarusidestrconsts:listargetfilenameofproject +msgid "Target filename of project" +msgstr "Projekto būsimo failo vardas" + +#: lazarusidestrconsts:listargetfilenameplusparams +msgid "Target filename + params" +msgstr "Būsimo failo vardas + parametrai" + +#: lazarusidestrconsts:listestdirectory +msgid "Test directory" +msgstr "Testo katalogas" + +#: lazarusidestrconsts:lislaunchingcmdline +msgid "Launching target command line" +msgstr "Startuojamos paskirties komandinė eilutė" + +#: lazarusidestrconsts:lispublishprojdir +msgid "Publish project directory" +msgstr "Skelbiamo projekto katalogas" + +#: lazarusidestrconsts:lisprojectunitpath +msgid "Project Unit Path" +msgstr "Kelias iki projekto modulių" + +#: lazarusidestrconsts:lisprojectincpath +msgid "Project Include Path" +msgstr "Kelias iki projekto įterpinių" + +#: lazarusidestrconsts:lisprojectsrcpath +msgid "Project Src Path" +msgstr "Kelias iki projekto pirminio kodo" + +#: lazarusidestrconsts:lismakeexe +msgid "Make Executable" +msgstr "Daryti vykdomąjį failą" + +#: lazarusidestrconsts:lisprojectmacroproperties +msgid "Project macro properties" +msgstr "Projekto makrokomandos savybės" + +#: lazarusidestrconsts:lisopenproject2 +msgid "Open project" +msgstr "Atverti projektą" + +#: lazarusidestrconsts:liskmsaveproject +msgid "Save project" +msgstr "Išsaugoti projektą" + +#: lazarusidestrconsts:liskmcloseproject +msgid "Close project" +msgstr "Užverti projektą" + +#: lazarusidestrconsts:liskmsaveprojectas +msgid "Save project as" +msgstr "Išsaugoti projektą kaip" + +#: lazarusidestrconsts:liskmpublishproject +msgid "Publish project" +msgstr "Skelbti projektą" + +#: lazarusidestrconsts:lisopenthefileasnormalsource +msgid "Open the file as normal source" +msgstr "Failą įkelti kaip įprastą pirminį kodą" + +#: lazarusidestrconsts:lisopenasxmlfile +msgid "Open as XML file" +msgstr "Įkelti kaip XML failą" + +#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro +msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" +msgstr "Paskutinio starto metu įkeliant projektą %s įvyko klaida!%s%sVėl įkelti šį projektą?" + +#: lazarusidestrconsts:lisopenprojectagain +msgid "Open project again" +msgstr "Vėl atverti projektą" + +#: lazarusidestrconsts:lisstartwithanewproject +msgid "Start with a new project" +msgstr "Startuti su nauju projektu" + +#: lazarusidestrconsts:lisprojectmacrounitpath +msgid "macro ProjectUnitPath" +msgstr "makrokomanda ProjectUnitPath" + +#: lazarusidestrconsts:lisconfigdirectory +msgid "Lazarus config directory" +msgstr "Lazarus nustatymų katalogas" + +#: lazarusidestrconsts:lismenufile +msgid "&File" +msgstr "&Failas" + +#: lazarusidestrconsts:lismenuedit +msgid "&Edit" +msgstr "&Keisti" + +#: lazarusidestrconsts:lismenusearch +msgid "&Search" +msgstr "&Paieška" + +#: lazarusidestrconsts:lismenuview +msgid "&View" +msgstr "&Rodymas" + +#: lazarusidestrconsts:lismenuproject +msgid "&Project" +msgstr "Projek&tas" + +#: lazarusidestrconsts:lismenurun +msgid "&Run" +msgstr "&Startuoti" + +#: lazarusidestrconsts:lismenucomponents +msgid "&Components" +msgstr "K&omponentai" + +#: lazarusidestrconsts:lismenutools +msgid "&Tools" +msgstr "Įra&nkiai" + +#: lazarusidestrconsts:lismenuenvironent +msgid "E&nvironment" +msgstr "&Aplinka" + +#: lazarusidestrconsts:lismenuwindows +msgid "&Windows" +msgstr "&Langai" + +#: lazarusidestrconsts:lismenuhelp +msgid "&Help" +msgstr "Žin&ynas" + +#: lazarusidestrconsts:lismenunewunit +msgid "New Unit" +msgstr "Naujas modulis" + +#: lazarusidestrconsts:lismenunewform +msgid "New Form" +msgstr "Nauja forma" + +#: lazarusidestrconsts:lismenunewother +msgid "New ..." +msgstr "Naujas..." + +#: lazarusidestrconsts:lismenuopen +msgid "Open ..." +msgstr "Atverti..." + +#: lazarusidestrconsts:lismenurevert +msgid "Revert" +msgstr "Atstatyti" + +#: lazarusidestrconsts:lispkgeditpublishpackage +msgid "Publish Package" +msgstr "Skelbti paketą" + +#: lazarusidestrconsts:lismenuopenrecent +msgid "Open Recent ..." +msgstr "Atverti paskutinį naudotą..." + +#: lazarusidestrconsts:lismenusave +msgid "Save" +msgstr "Išsaugoti" + +#: lazarusidestrconsts:liskmsaveas +msgid "SaveAs" +msgstr "Išsaugoti kaip" + +#: lazarusidestrconsts:liskmsaveall +msgid "SaveAll" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:lisdiscardchanges +msgid "Discard changes" +msgstr "Neįrašyti pakeitimų" + +#: lazarusidestrconsts:lisdonotclosetheproject +msgid "Do not close the project" +msgstr "Neužverti projekto" + +#: lazarusidestrconsts:lisdonotclosetheide +msgid "Do not close the IDE" +msgstr "Neužveti IKA" + +#: lazarusidestrconsts:lismenusaveas +msgid "Save As ..." +msgstr "Išsaugoti kaip..." + +#: lazarusidestrconsts:lismenusaveall +msgid "Save All" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:lismenuclose +msgid "Close" +msgstr "Užverti" + +#: lazarusidestrconsts:liskmcloseall +msgid "Close All" +msgstr "Užverti visus" + +#: lazarusidestrconsts:lisctdefdefinetemplates +msgid "Define templates" +msgstr "Apibrėžčių šablonai" + +#: lazarusidestrconsts:lismenucloseall +msgid "Close all editor files" +msgstr "Užverti visus redaktoriaus failus" + +#: lazarusidestrconsts:lismenucleandirectory +msgid "Clean directory ..." +msgstr "Apvalyti katalogą..." + +#: lazarusidestrconsts:lismenuquit +msgid "Quit" +msgstr "Baigti darbą" + +#: lazarusidestrconsts:lismenurestart +msgid "Restart" +msgstr "Startuoti išnaujo" + +#: lazarusidestrconsts:lismenuundo +msgid "Undo" +msgstr "Grąžinti" + +#: lazarusidestrconsts:lismenuredo +msgid "Redo" +msgstr "Pakartoti" + +#: lazarusidestrconsts:lismenucut +msgid "Cut" +msgstr "Iškirpti" + +#: lazarusidestrconsts:lismenucopy +msgid "Copy" +msgstr "Kopijuoti" + +#: lazarusidestrconsts:lismenupaste +msgid "Paste" +msgstr "Įdėti" + +#: lazarusidestrconsts:lismenuindentselection +msgid "Indent selection" +msgstr "Suteikti įtrauką pažymėjime" + +#: lazarusidestrconsts:lismenuunindentselection +msgid "Unindent selection" +msgstr "Naikinti įtrauką pažymėjime" + +#: lazarusidestrconsts:lismenuuppercaseselection +msgid "Uppercase selection" +msgstr "Pažymėjime visas raides didžiosiomis" + +#: lazarusidestrconsts:lismenulowercaseselection +msgid "Lowercase selection" +msgstr "Pažymėjime visas raides mažosiomis" + +#: lazarusidestrconsts:lismenutabstospacesselection +msgid "Tabs to spaces in selection" +msgstr "Pažymėtoje srityje tabuliatorius keisti tarpais" + +#: lazarusidestrconsts:lismenuencloseselection +msgid "Enclose selection ..." +msgstr "Apgaubti pažymėtąjį..." + +#: lazarusidestrconsts:lismenucommentselection +msgid "Comment selection" +msgstr "Uždėti komentarą pažymėtajam" + +#: lazarusidestrconsts:lismenuuncommentselection +msgid "Uncomment selection" +msgstr "Nuimti komentarą nuo pažymetojo" + +#: lazarusidestrconsts:liskminsertifdef +msgid "Insert $IFDEF" +msgstr "Įterpti $IFDEF" + +#: lazarusidestrconsts:lismenuconditionalselection +msgid "Insert $IFDEF..." +msgstr "Įterpti $IFDEF..." + +#: lazarusidestrconsts:lismenusortselection +msgid "Sort selection ..." +msgstr "Rūšiuoti pažymėtą..." + +#: lazarusidestrconsts:lismenubeaklinesinselection +msgid "Break Lines in selection" +msgstr "Laužyti eilutes pažymėtoje srityje" + +#: lazarusidestrconsts:liskmselectwordleft +msgid "Select word left" +msgstr "Pažymėti žodį kairėje" + +#: lazarusidestrconsts:liskmselectwordright +msgid "Select word right" +msgstr "Pažymėti žodį dešinėje" + +#: lazarusidestrconsts:liskmselectlinestart +msgid "Select line start" +msgstr "Žymėti iki eilutės pradžios" + +#: lazarusidestrconsts:liskmselectlineend +msgid "Select line end" +msgstr "Žymėti iki eilutės galo" + +#: lazarusidestrconsts:liskmselectpagetop +msgid "Select page top" +msgstr "Žymėti iki lapo viršaus" + +#: lazarusidestrconsts:liskmselectpagebottom +msgid "Select page bottom" +msgstr "Žymėti iki lapo apačios" + +#: lazarusidestrconsts:lismenuselect +msgid "Select" +msgstr "Žymėjimas" + +#: lazarusidestrconsts:lismenuselectall +msgid "Select all" +msgstr "Pažymėti viską" + +#: lazarusidestrconsts:lismenuselecttobrace +msgid "Select to brace" +msgstr "Pažymėti iki skliaustelio" + +#: lazarusidestrconsts:lismenuselectcodeblock +msgid "Select code block" +msgstr "Pažymėti kodo bloką" + +#: lazarusidestrconsts:lismenuselectword +msgid "Select word" +msgstr "Pažymėti žodį" + +#: lazarusidestrconsts:lismenuselectline +msgid "Select line" +msgstr "Pažymėti eilutę" + +#: lazarusidestrconsts:lismenuselectparagraph +msgid "Select paragraph" +msgstr "Pažymėti paragrafą" + +#: lazarusidestrconsts:lismenuinsertcharacter +msgid "Insert from Character Map" +msgstr "Įterpti iš simbolių lentelės" + +#: lazarusidestrconsts:lismenuinserttext +msgid "Insert text" +msgstr "Įterpti tekstą" + +#: lazarusidestrconsts:lismenuinsertcvskeyword +msgid "CVS keyword" +msgstr "CVS raktažodis" + +#: lazarusidestrconsts:lismenuinsertgeneral +msgid "General" +msgstr "Pagrindinis" + +#: lazarusidestrconsts:lisnone2 +msgid "none" +msgstr "nieks" + +#: lazarusidestrconsts:lisor +msgid "or" +msgstr "arba" + +#: lazarusidestrconsts:lisnone +msgid "%snone" +msgstr "%snieks" + +#: lazarusidestrconsts:lisunitpaths +msgid "Unit paths" +msgstr "Modulių keliai" + +#: lazarusidestrconsts:lisincludepaths +msgid "Include paths" +msgstr "Įterpimo keliai" + +#: lazarusidestrconsts:lissourcepaths +msgid "Source paths" +msgstr "Keliai iki pirminio kodo" + +#: lazarusidestrconsts:lismenucompletecode +msgid "Complete Code" +msgstr "Užbaigti kodą" + +#: lazarusidestrconsts:lismenuextractproc +msgid "Extract procedure ..." +msgstr "Ištraukti procedūrą..." + +#: lazarusidestrconsts:lismenufindidentifierrefs +msgid "Find Identifier References ..." +msgstr "Ieškoti identifikatoriaus įrašų..." + +#: lazarusidestrconsts:lismenurenameidentifier +msgid "Rename Identifier ..." +msgstr "Pervardyti identifikatorių..." + +#: lazarusidestrconsts:lismenuinsertgplnotice +msgid "GPL notice" +msgstr "GPL raštas" + +#: lazarusidestrconsts:lismenuinsertlgplnotice +msgid "LGPL notice" +msgstr "LGPL raštas" + +#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice +msgid "Modified LGPL notice" +msgstr "Modifikuotas LGPL raštas" + +#: lazarusidestrconsts:lismenuinsertusername +msgid "Current username" +msgstr "Dabartinis naudotojo vardas" + +#: lazarusidestrconsts:lismenuinsertdatetime +msgid "Current date and time" +msgstr "Dabartinė data ir laikas" + +#: lazarusidestrconsts:lismenuinsertchangelogentry +msgid "ChangeLog entry" +msgstr "Pakeitimų žurnalo įrašas" + +#: lazarusidestrconsts:lismenufind +msgid "Find" +msgstr "Paieška" + +#: lazarusidestrconsts:lismenufindnext +msgid "Find &Next" +msgstr "Ieškoti &toliau" + +#: lazarusidestrconsts:lismenufind2 +msgid "Find ..." +msgstr "Ieškoti..." + +#: lazarusidestrconsts:lismenufindprevious +msgid "Find &Previous" +msgstr "Ieškoti an&kstesnio" + +#: lazarusidestrconsts:lismenufindinfiles +msgid "Find &in files ..." +msgstr "&Ieškoti failuose..." + +#: lazarusidestrconsts:lismenureplace +msgid "Replace" +msgstr "Pakeisti" + +#: lazarusidestrconsts:lismenuincrementalfind +msgid "Incremental Find" +msgstr "Prieauginė paieška" + +#: lazarusidestrconsts:lismenureplace2 +msgid "Replace ..." +msgstr "Pakeisti..." + +#: lazarusidestrconsts:lismenugotoline +msgid "Goto line ..." +msgstr "Rodyti eilutę..." + +#: lazarusidestrconsts:lismenujumpback +msgid "Jump back" +msgstr "Peršokti atgal" + +#: lazarusidestrconsts:lismenujumpforward +msgid "Jump forward" +msgstr "Peršokti pirmyn" + +#: lazarusidestrconsts:lismenuaddjumppointtohistory +msgid "Add jump point to history" +msgstr "Peršokimo tašką įdėti istorijon" + +#: lazarusidestrconsts:lismenuviewjumphistory +msgid "View Jump-History ..." +msgstr "Rodyti peršokimų istoriją..." + +#: lazarusidestrconsts:lismenufindblockotherendofcodeblock +msgid "Find other end of code block" +msgstr "Ieškoti kodo bloko kitos pabaigos" + +#: lazarusidestrconsts:lismenufindcodeblockstart +msgid "Find code block start" +msgstr "Ieškoti kodo bloko pradžios" + +#: lazarusidestrconsts:lismenufinddeclarationatcursor +msgid "Find Declaration at cursor" +msgstr "Ieškoti ties žymekliu nurodytojo paskelbimo" + +#: lazarusidestrconsts:lismenuopenfilenameatcursor +msgid "Open filename at cursor" +msgstr "Atverti ties žymekliu nurodytą failą" + +#: lazarusidestrconsts:lismenugotoincludedirective +msgid "Goto include directive" +msgstr "Rodyti įterpimo direktyvą" + +#: lazarusidestrconsts:lismenujumptonexterror +msgid "Jump to next error" +msgstr "Šokti prie tolesnės klaidos" + +#: lazarusidestrconsts:lismenujumptopreverror +msgid "Jump to previous error" +msgstr "Šokti prie ankstesnės klaidos" + +#: lazarusidestrconsts:lismenusetfreebookmark +msgid "Set a free bookmark" +msgstr "Padėti laisvą žymę" + +#: lazarusidestrconsts:lismenujumptonextbookmark +msgid "Jump to next bookmark" +msgstr "Šokti prie tolesnės žymės" + +#: lazarusidestrconsts:lismenujumptoprevbookmark +msgid "Jump to previous bookmark" +msgstr "Šokti prie ankstesnės žymės" + +#: lazarusidestrconsts:lismenuviewobjectinspector +msgid "Object Inspector" +msgstr "Objektų inspektorius" + +#: lazarusidestrconsts:lismenuviewsourceeditor +msgid "Source Editor" +msgstr "Pirminio kodo redaktorius" + +#: lazarusidestrconsts:lismenuviewcodeexplorer +msgid "Code Explorer" +msgstr "Kodo tyrinėtojas" + +#: lazarusidestrconsts:lismenuviewcodebrowser +msgid "Code Browser" +msgstr "Kodo naršyklė" + +#: lazarusidestrconsts:lismenujumpto +msgid "Jump to" +msgstr "Šokti į" + +#: lazarusidestrconsts:lismenuviewunits +msgid "Units..." +msgstr "Moduliai..." + +#: lazarusidestrconsts:lismenuviewforms +msgid "Forms..." +msgstr "Formos..." + +#: lazarusidestrconsts:lismenuviewunitdependencies +msgid "View Unit Dependencies" +msgstr "Rodyti modulio priklausomybes" + +#: lazarusidestrconsts:liskmviewunitinfo +msgid "View Unit Info" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:lismenuviewunitinfo +msgid "View Unit Information" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:lismenuviewtoggleformunit +msgid "Toggle form/unit view" +msgstr "Rodyti formą arba modulį" + +#: lazarusidestrconsts:lismenuviewmessages +msgid "Messages" +msgstr "Pranešimai" + +#: lazarusidestrconsts:liscopyselectedmessagestoclipboard +msgid "Copy selected messages to clipboard" +msgstr "Kopijuoti pažymėtus pranešimus į iškarpinę" + +#: lazarusidestrconsts:liscopyallmessagestoclipboard +msgid "Copy all messages to clipboard" +msgstr "Kopijuoti visus pranešimus į iškarpinę" + +#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard +msgid "Copy all and hidden messages to clipboard" +msgstr "Kopijuoti visus (ir paslėptus) pranešimus į iškarpinę" + +#: lazarusidestrconsts:lissaveallmessagestofile +msgid "Save all messages to file" +msgstr "Visus pranešimus įrašyti failan" + +#: lazarusidestrconsts:lismenuviewsearchresults +msgid "Search Results" +msgstr "Ieškos rezultatai" + +#: lazarusidestrconsts:lissearchagain +msgid "Search again" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:lissrclosepage +msgid "Close page" +msgstr "Užverti lapą" + +#: lazarusidestrconsts:lismenuviewanchoreditor +msgid "View Anchor Editor" +msgstr "Rodyti prieraišų redaktorių" + +#: lazarusidestrconsts:liskmtoggleviewcomponentpalette +msgid "Toggle view component palette" +msgstr "Keisti komponenčių paletės matomumą" + +#: lazarusidestrconsts:lismenuviewcomponentpalette +msgid "View Component Palette" +msgstr "Rodyti komponenčių paletę" + +#: lazarusidestrconsts:lismenuviewidespeedbuttons +msgid "View IDE speed buttons" +msgstr "Rodyti IKA sparčiuosius mygtukus" + +#: lazarusidestrconsts:lismenudebugwindows +msgid "Debug windows" +msgstr "Derinimo langai" + +#: lazarusidestrconsts:lismenuviewwatches +msgid "Watches" +msgstr "Stebimieji" + +#: lazarusidestrconsts:lismenuviewbreakpoints +msgid "BreakPoints" +msgstr "Stabdos taškai" + +#: lazarusidestrconsts:lismenuviewlocalvariables +msgid "Local Variables" +msgstr "Vietiniai kintamieji" + +#: lazarusidestrconsts:lismenuviewcallstack +msgid "Call Stack" +msgstr "Kreipčių dėklas" + +#: lazarusidestrconsts:lismenuviewdebugoutput +msgid "Debug output" +msgstr "Derinimo išvestis" + +#: lazarusidestrconsts:lismenunewproject +msgid "New Project ..." +msgstr "Naujas projektas..." + +#: lazarusidestrconsts:lismenunewprojectfromfile +msgid "New Project from file ..." +msgstr "Naujas projektas iš failo..." + +#: lazarusidestrconsts:lismenuopenproject +msgid "Open Project ..." +msgstr "Atverti projektą..." + +#: lazarusidestrconsts:lismenucloseproject +msgid "Close Project" +msgstr "Užverti projektą" + +#: lazarusidestrconsts:lismenuopenrecentproject +msgid "Open Recent Project ..." +msgstr "Atverti paskutinį naudotą projektą..." + +#: lazarusidestrconsts:lismenusaveproject +msgid "Save Project" +msgstr "Išsaugoti projektą" + +#: lazarusidestrconsts:lismenusaveprojectas +msgid "Save Project As ..." +msgstr "Projektą išsaugoti kaip..." + +#: lazarusidestrconsts:lismenupublishproject +msgid "Publish Project ..." +msgstr "Skelbti projektą..." + +#: lazarusidestrconsts:lismenuprojectinspector +msgid "Project Inspector" +msgstr "Projekto inspektorius" + +#: lazarusidestrconsts:liskmaddactiveunittoproject +msgid "Add active unit to project" +msgstr "Įdėti į projektą aktyvųjį modulį" + +#: lazarusidestrconsts:liskmremoveactiveunitfromproject +msgid "Remove active unit from project" +msgstr "Pašalinti iš projekto aktyvųjį modulį" + +#: lazarusidestrconsts:liskmviewprojectsource +msgid "View project source" +msgstr "Rodyti projekto pirminį kodą" + +#: lazarusidestrconsts:liskmviewprojecttodolist +msgid "View project ToDo list" +msgstr "Rodyti projekto ToDo sąrašą" + +#: lazarusidestrconsts:lismenuaddtoproject +msgid "Add editor file to Project" +msgstr "Redaktoriaus failą įdėti į projektą" + +#: lazarusidestrconsts:lismenuremovefromproject +msgid "Remove from Project ..." +msgstr "Pašalinti iš projekto..." + +#: lazarusidestrconsts:lismenuviewsource +msgid "View Source" +msgstr "Rodyti pirminį kodą" + +#: lazarusidestrconsts:lismenuviewprojecttodos +msgid "View ToDo List ..." +msgstr "Rodyti ToDo sąrašą..." + +#: lazarusidestrconsts:lismenuprojectoptions +msgid "Project Options ..." +msgstr "Projekto parinktys..." + +#: lazarusidestrconsts:lismenubuild +msgid "Build" +msgstr "Daryti" + +#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath +msgid "Working directory (Leave empty for file path)" +msgstr "Darbinis katalogas (palikite tuščią failo keliui)" + +#: lazarusidestrconsts:lisbfbuildcommand +msgid "Build Command" +msgstr "Darymo komanda" + +#: lazarusidestrconsts:lismenubuildall +msgid "Build all" +msgstr "Daryti visus" + +#: lazarusidestrconsts:lismenuquickcompile +msgid "Quick compile" +msgstr "Spartus kompiliavimas" + +#: lazarusidestrconsts:lismenuabortbuild +msgid "Abort Build" +msgstr "Nutraukti darymą" + +#: lazarusidestrconsts:lismenuprojectrun +msgid "Run" +msgstr "Startuoti" + +#: lazarusidestrconsts:lisbfalwaysbuildbeforerun +msgid "Always Build before Run" +msgstr "Prieš startuojant visada daryti" + +#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2 +msgid "Working Directory (Leave empty for file path)" +msgstr "Darbinis katalogas (palikite tuščią failo keliui)" + +#: lazarusidestrconsts:lisbfruncommand +msgid "Run Command" +msgstr "Startavimo komanda" + +#: lazarusidestrconsts:lismenupause +msgid "Pause" +msgstr "Pauzė" + +#: lazarusidestrconsts:lismenustepinto +msgid "Step into" +msgstr "Žengti gilyn" + +#: lazarusidestrconsts:lismenustepover +msgid "Step over" +msgstr "Žengti virš" + +#: lazarusidestrconsts:lismenuruntocursor +msgid "Run to cursor" +msgstr "Startuoti iki žymeklio" + +#: lazarusidestrconsts:liskmstopprogram +msgid "Stop program" +msgstr "Sustabdyti programą" + +#: lazarusidestrconsts:lismenustop +msgid "Stop" +msgstr "Stabdyti" + +#: lazarusidestrconsts:liscontinue +msgid "Continue" +msgstr "Tęsti" + +#: lazarusidestrconsts:lismenuresetdebugger +msgid "Reset debugger" +msgstr "Atstatyti derintuvę pradžion" + +#: lazarusidestrconsts:liskmcompileroptions +msgid "Compiler options" +msgstr "Kompiliatoriaus parinktys" + +#: lazarusidestrconsts:lismenucompileroptions +msgid "Compiler Options ..." +msgstr "Kompiliatoriaus parinktys..." + +#: lazarusidestrconsts:lismenurunparameters +msgid "Run Parameters ..." +msgstr "Startavimo parametrai..." + +#: lazarusidestrconsts:lismenubuildfile +msgid "Build File" +msgstr "Daryti failą" + +#: lazarusidestrconsts:lismenurunfile +msgid "Run File" +msgstr "Startuoti failą" + +#: lazarusidestrconsts:liskmconfigbuildfile +msgid "Config %sBuild File%s" +msgstr "Derinti %sDaryti failą%s" + +#: lazarusidestrconsts:liskminspect +msgid "Inspect" +msgstr "Inspektuoti" + +#: lazarusidestrconsts:liskmevaluatemodify +msgid "Evaluate/Modify" +msgstr "Įvertinti/Modifikuoti" + +#: lazarusidestrconsts:liskmaddwatch +msgid "Add watch" +msgstr "Pridėti stebimąjį" + +#: lazarusidestrconsts:lismenuconfigbuildfile +msgid "Configure Build+Run File ..." +msgstr "Derinti \"Daryti ir startuoti failą\"..." + +#: lazarusidestrconsts:lismenuinspect +msgid "Inspect ..." +msgstr "Inspektuoti..." + +#: lazarusidestrconsts:lismenuevaluate +msgid "Evaluate/Modify ..." +msgstr "Įvertinti/Modifikuoti..." + +#: lazarusidestrconsts:lismenuaddwatch +msgid "Add watch ..." +msgstr "Pridėti stebimąjį..." + +#: lazarusidestrconsts:lismenuaddbreakpoint +msgid "Add breakpoint" +msgstr "Padėti stabdos tašką" + +#: lazarusidestrconsts:lismenuaddbpsource +msgid "Source breakpoint" +msgstr "Stabdos taškas pirminiame kode" + +#: lazarusidestrconsts:lismenuopenpackage +msgid "Open loaded package ..." +msgstr "Atverti įkeltą paketą..." + +#: lazarusidestrconsts:lismenuopenrecentpkg +msgid "Open recent package ..." +msgstr "Atverti paskutinį naudotą paketą..." + +#: lazarusidestrconsts:lismenuopenpackagefile +msgid "Open package file (.lpk) ..." +msgstr "Atverti paketo failą (.lpk)" + +#: lazarusidestrconsts:lismenuopenpackageofcurunit +msgid "Open package of current unit" +msgstr "Atverti veikiamojo modulio paketą" + +#: lazarusidestrconsts:lismenuaddcurunittopkg +msgid "Add active unit to a package" +msgstr "Įdėti aktyvųjį modulį į paketą" + +#: lazarusidestrconsts:liskmpackagegraph +msgid "Package graph" +msgstr "Paketų grafas" + +#: lazarusidestrconsts:liskmconfigureinstalledpackages +msgid "Configure installed packages" +msgstr "Derinti įdiegtus paketus" + +#: lazarusidestrconsts:liskmconfigurecustomcomponents +msgid "Configure custom components" +msgstr "Derinti naudotojo komponentes" + +#: lazarusidestrconsts:lismenupackagegraph +msgid "Package Graph ..." +msgstr "Paketų grafas..." + +#: lazarusidestrconsts:lismenueditinstallpkgs +msgid "Configure installed packages ..." +msgstr "Derinti įdiegtus paketus..." + +#: lazarusidestrconsts:lismenuconfigcustomcomps +msgid "Configure custom components ..." +msgstr "Derinti naudotojo komponentes..." + +#: lazarusidestrconsts:lismenusettings +msgid "Configure custom tools ..." +msgstr "Derinti naudotojo įrankius..." + +#: lazarusidestrconsts:lismenuquicksyntaxcheck +msgid "Quick syntax check" +msgstr "Sparti sintaksės patikra" + +#: lazarusidestrconsts:lismenuguessunclosedblock +msgid "Guess unclosed block" +msgstr "Nuspėti neužbaigtus blokus" + +#: lazarusidestrconsts:lismenuguessmisplacedifdef +msgid "Guess misplaced IFDEF/ENDIF" +msgstr "Nuspėti nevietoj esančius $IFDEF/$ENDIF" + +#: lazarusidestrconsts:lismenumakeresourcestring +msgid "Make Resource String ..." +msgstr "Kurti resursų eilutę..." + +#: lazarusidestrconsts:lismenudiff +msgid "Diff" +msgstr "Diff" + +#: lazarusidestrconsts:lismenuconvertdfmtolfm +msgid "Convert DFM file to LFM ..." +msgstr "Konvertuoti DFM failą į LFM..." + +#: lazarusidestrconsts:lismenuchecklfm +msgid "Check LFM file in editor" +msgstr "Tikrinti LFM failą redaktoriuje" + +#: lazarusidestrconsts:lismenuconvertdelphiunit +msgid "Convert Delphi unit to Lazarus unit ..." +msgstr "Konvertuoti Delphi modulį į Lazarus modulį..." + +#: lazarusidestrconsts:lismenuconvertdelphiproject +msgid "Convert Delphi project to Lazarus project ..." +msgstr "Konvertuoti Delphi projektą į Lazarus projektą..." + +#: lazarusidestrconsts:lismenuconvertdelphipackage +msgid "Convert Delphi package to Lazarus package ..." +msgstr "Konvertuoti Delphi paketą į Lazarus paketą..." + +#: lazarusidestrconsts:lismenubuildlazarus +msgid "Build Lazarus" +msgstr "Daryti Lazarus" + +#: lazarusidestrconsts:lismenuconfigurebuildlazarus +msgid "Configure \"Build Lazarus\" ..." +msgstr "Derinti \"Daryti Lazarus\"..." + +#: lazarusidestrconsts:lismenugeneraloptions +msgid "Environment options ..." +msgstr "Aplinkos parinktys..." + +#: lazarusidestrconsts:lismenueditoroptions +msgid "Editor options ..." +msgstr "Redaktoriaus parinktys..." + +#: lazarusidestrconsts:lismenueditcodetemplates +msgid "Code Templates ..." +msgstr "Kodo šablonai..." + +#: lazarusidestrconsts:lismendebuggeroptions +msgid "Debugger Options ..." +msgstr "Derintuvės parinktys..." + +#: lazarusidestrconsts:lismenucodetoolsoptions +msgid "CodeTools Options ..." +msgstr "CodeTools parinktys..." + +#: lazarusidestrconsts:lismenucodetoolsdefineseditor +msgid "CodeTools defines editor ..." +msgstr "CodeTools apibrėžčių redaktorius..." + +#: lazarusidestrconsts:lismenuonlinehelp +msgid "Online Help" +msgstr "Internetinis žinynas" + +#: lazarusidestrconsts:liskmconfigurehelp +msgid "Configure Help" +msgstr "Derinti žinyną" + +#: lazarusidestrconsts:liskmcontextsensitivehelp +msgid "Context sensitive help" +msgstr "Kontekstinis žinynas" + +#: lazarusidestrconsts:liskmeditcontextsensitivehelp +msgid "Edit context sensitive help" +msgstr "Keisti kontekstinį žinyną" + +#: lazarusidestrconsts:lismenuconfigurehelp +msgid "Configure Help ..." +msgstr "Derinti žinyną..." + +#: lazarusidestrconsts:lismenucontexthelp +msgid "Context sensitive Help" +msgstr "Kontekstinis žinynas" + +#: lazarusidestrconsts:lismenueditcontexthelp +msgid "Edit context sensitive Help" +msgstr "Redaktoriaus kontekstinis žinynas" + +#: lazarusidestrconsts:lismenucreatelazdocfiles +msgid "Create LazDoc files" +msgstr "Kurti LazDoc failus" + +#: lazarusidestrconsts:lisdsgcopycomponents +msgid "Copy selected components to clipboard" +msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:lisdsgcutcomponents +msgid "Cut selected components to clipboard" +msgstr "Iškirpti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:lisdsgpastecomponents +msgid "Paste selected components from clipboard" +msgstr "Įterpti pažymėtas komponentes iš iškarpinės" + +#: lazarusidestrconsts:lisdsgselectparentcomponent +msgid "Select parent component" +msgstr "Pažymėkite tėvinę komponentę" + +#: lazarusidestrconsts:lisdsgordermovetofront +msgid "Move component to front" +msgstr "Perkelti komponentę priekin" + +#: lazarusidestrconsts:lisdsgordermovetoback +msgid "Move component to back" +msgstr "Perkelti komponentę galan" + +#: lazarusidestrconsts:lisdsgorderforwardone +msgid "Move component one forward" +msgstr "Perkelti komponentę per viena pirmyn" + +#: lazarusidestrconsts:lisdsgorderbackone +msgid "Move component one back" +msgstr "Perkelti komponentę per viena atgal" + +#: lazarusidestrconsts:lischooseprogramsourcepppaslpr +msgid "Choose program source (*.pp,*.pas,*.lpr)" +msgstr "Nurodykit programos pirminį kodą (*.pp, *.pas, *.lpr)" + +#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp +msgid "Program source must have a pascal extension like .pas, .pp or .lpr" +msgstr "Programos pirminio kodo failo prievardis turi būti panašus į paskalio: .pas, .pp arba .lpr" + +#: lazarusidestrconsts:liscompileroptionsforproject +msgid "Compiler Options for Project: %s" +msgstr "Kompiliatoriaus parinktys projektui: %s" + +#: lazarusidestrconsts:lischoosedelphiunit +msgid "Choose Delphi unit (*.pas)" +msgstr "Nurodykit Delphi modulį (*.pas)" + +#: lazarusidestrconsts:lischoosedelphiproject +msgid "Choose Delphi project (*.dpr)" +msgstr "Nurodykit Delphi projektą (*.dpr)" + +#: lazarusidestrconsts:lischoosedelphipackage +msgid "Choose Delphi package (*.dpk)" +msgstr "Nurodykit Delphi paketą (*.dpk)" + +#: lazarusidestrconsts:lisdelphiproject +msgid "Delphi project" +msgstr "Delphi projektas" + +#: lazarusidestrconsts:lisunabletoreadfileerror +msgid "Unable to read file %s%s%s%sError: %s" +msgstr "Nepavyko skaityti iš failo %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisformaterror +msgid "Format error" +msgstr "Formato klaida" + +#: lazarusidestrconsts:lislfmfilecorrupt +msgid "LFM file corrupt" +msgstr "LFM failas sugadintas" + +#: lazarusidestrconsts:lisunabletofindavalidclassnamein +msgid "Unable to find a valid classname in %s%s%s" +msgstr "%s%s%s nepavyko rasti klasę tinkamu vardu" + +#: lazarusidestrconsts:lisunabletoconvertfileerror +msgid "Unable to convert file %s%s%s%sError: %s" +msgstr "Nepavyko konvertuoti į failą %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisunabletowritefileerror +msgid "Unable to write file %s%s%s%sError: %s" +msgstr "Nepavyko rašyti į failą %s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:liserrorcreatinglrs +msgid "Error creating lrs" +msgstr "Klaida kuriant LRS" + +#: lazarusidestrconsts:lislfmfilenotfound +msgid "LFM file not found" +msgstr "Nerastas LFM failas" + +#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren +msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." +msgstr "Šių modulių nepavyko rasti:%s%s%s%s 1) Ko gero šie moduliai nėra modulių kelyje, tada jūs galite nutraukti viską, ištaisyti modulių kelią ir bandyti vėl.%s 2) Arba jūs galite praleisti trūkstamus modulius ir vėliau jiems uždėti komentarą." + +#: lazarusidestrconsts:lisunitnotfound +msgid "Unit not found" +msgstr "Modulis nerastas" + +#: lazarusidestrconsts:lisunitsnotfound2 +msgid "Units not found" +msgstr "Moduliai nerasti" + +#: lazarusidestrconsts:lisunitlfmfile +msgid "Unit: %s%sLFM file: %s" +msgstr "Modulis: %s%sLFM failas: %s" + +#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile +msgid "Unable to convert lfm to lrs and write lrs file." +msgstr "Nepavyko LFM konvertuoti į LRS ir sukurti LRS failą." + +#: lazarusidestrconsts:lisnotadelphiproject +msgid "Not a Delphi project" +msgstr "Ne Delphi projektas" + +#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr +msgid "The file %s%s%s is not a Delphi project (.dpr)" +msgstr "Failas %s%s%s nėra Delphi projektas (.dpr)" + +#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis +msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." +msgstr "Nepavyko įkelti senąjį resursų failą.%sResursų failas yra pirmasis įdedamasis failas \"initialization\" sekcijoje.%sPavyzdžiui: {$I %s.lrs}.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lisresourceloaderror +msgid "Resource load error" +msgstr "Klaida įkeliant resursus" + +#: lazarusidestrconsts:lisignoremissingfile +msgid "Ignore missing file" +msgstr "Praleisti trūkstamą failą" + +#: lazarusidestrconsts:lisnoname +msgid "noname" +msgstr "bevardis" + +#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist +msgid "The destination directory%s%s%s%s does not exist." +msgstr "Paskirties katalogas%s%s%s%s neegzistuoja." + +#: lazarusidestrconsts:lisrenamefile +msgid "Rename file?" +msgstr "Pervardyti failą?" + +#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc +msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" +msgstr "Panašu kad tai paskalio failas.%sRekomenduotina failo varde naudoti tik mažąsias raides, tokiu būdu išvengsite problemų, susijusių su įvairiomis failų sistemomis ar įvairiais kompiliatoriais.%sPervardyti mažosiomis raidėmis?" + +#: lazarusidestrconsts:lisrenametolowercase +msgid "Rename to lowercase" +msgstr "Pervardyti mažosiomis" + +#: lazarusidestrconsts:liskeepname +msgid "Keep name" +msgstr "Nekeisti vardo" + +#: lazarusidestrconsts:lisoverwritefile +msgid "Overwrite file?" +msgstr "Perrašyti failą?" + +#: lazarusidestrconsts:lisafilealreadyexistsreplaceit +msgid "A file %s%s%s already exists.%sReplace it?" +msgstr "Failas %s%s%s jau egzistuoja.%sPerrašyti?" + +#: lazarusidestrconsts:lisoverwritefileondisk +msgid "Overwrite file on disk" +msgstr "Perrašyti failą diske" + +#: lazarusidestrconsts:lisambiguousfilesfound +msgid "Ambiguous files found" +msgstr "Rastas neaiškus failas" + +#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename +msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" +msgstr "Kataloge yra failų, kurių vardai skiriasi tik raidžių lygiais:%s%s%sJuos ištrinti?" + +#: lazarusidestrconsts:lisdeleteoldfile +msgid "Delete old file %s%s%s?" +msgstr "Ištrinti senąjį failą %s%s%s?" + +#: lazarusidestrconsts:lisdeletingoffilefailed +msgid "Deleting of file %s%s%s failed." +msgstr "Nepavyko ištrinti failą %s%s%s." + +#: lazarusidestrconsts:lisstreamingerror +msgid "Streaming error" +msgstr "Klaida siunčiant srautu" + +#: lazarusidestrconsts:lisunabletostreamt +msgid "Unable to stream %s:T%s." +msgstr "Nepavyko siųsti srautu %s:T%s." + +#: lazarusidestrconsts:lisresourcesaveerror +msgid "Resource save error" +msgstr "Klaida išsaugojant resursus" + +#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile +msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "Resursu faile %s%s%s%snepavyko įrašyti resursų antraštinį komentarą.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably +msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." +msgstr "Resurso T%s:FORMDATA nepavyko įrašyti į resursų failą %s%s%s%s.%sKogero tai sintaksės klaida." + +#: lazarusidestrconsts:lisunabletocreatefile2 +msgid "Unable to create file %s%s%s" +msgstr "Nepavyko sukurti failą %s%s%s" + +#: lazarusidestrconsts:liscontinuewithoutloadingform +msgid "Continue without loading form" +msgstr "Tęsti neįkeliant formos" + +#: lazarusidestrconsts:liscancelloadingunit +msgid "Cancel loading unit" +msgstr "Atsisakyti modulio įkėlimo" + +#: lazarusidestrconsts:lisabortallloading +msgid "Abort all loading" +msgstr "Nutraukti visą įkėlimo procesą" + +#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext +msgid "Unable to transform binary component stream of %s:T%s into text." +msgstr "Nepavyko dvejetainį komponento %s:T%s srautą transformuoti į tekstą." + +#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject +msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." +msgstr "Failas %s%s%s%s nerastas.%sPaspaudus \"Ignoruoti\" projektas bus įkeliamas toliau,%spaspaudus \"Nutraukti\" įkėlimas bus nutrauktas." + +#: lazarusidestrconsts:lisskipfileandcontinueloading +msgid "Skip file and continue loading" +msgstr "Tęsti įkrovą praleidžiant failą" + +#: lazarusidestrconsts:lisabortloadingproject +msgid "Abort loading project" +msgstr "Nutraukti projekto įkrovą" + +#: lazarusidestrconsts:lisfilenotfound2 +msgid "File %s%s%s not found.%s" +msgstr "Failas %s%s%s nerastas.%s" + +#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit +msgid "File %s%s%s not found.%sDo you want to create it?%s" +msgstr "Failas %s%s%s nerastas.%sJį sukurti?%s" + +#: lazarusidestrconsts:lisprojectinfofiledetected +msgid "Project info file detected" +msgstr "Aptiktas projekto informacinis failas" + +#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp +msgid "The file %s seems to be the program file of an existing lazarus Project." +msgstr "Panašu kad failas %s yra kažkurio Lazarus projekto programos failas." + +#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject +msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." +msgstr "Panašu kad failas %s%s%s%s yra programa. Užverti šį projektą ir tai programai sukurti naują Lazarus projektą?%sPaspaudus \"Ne\" failas bus įkeltas kaip įprastas pirminis kodas." + +#: lazarusidestrconsts:lisprogramdetected +msgid "Program detected" +msgstr "Aptikta programa" + +#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream +msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" +msgstr "Nepavyko faile %s%s%s%s%sesantį tekstą konvertuoti į dvejetainį srautą. (%s)" + +#: lazarusidestrconsts:lisformloaderror +msgid "Form load error" +msgstr "Klaida įkeliant formą" + +#: lazarusidestrconsts:lissaveprojectlpi +msgid "Save Project %s (*.lpi)" +msgstr "Išsaugoti projektą %s (.lpi)" + +#: lazarusidestrconsts:lisinvalidprojectfilename +msgid "Invalid project filename" +msgstr "Klaidingas projekto failo vardas" + +#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject +msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" +msgstr "Projekto vardas %s%s%s yra klaidingas.%sNurodykite kitokį vardą (pvz.: projektas1.lpi)" + +#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier +msgid "The name %s%s%s is not a valid pascal identifier." +msgstr "Vardas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lischooseadifferentname +msgid "Choose a different name" +msgstr "Nurodykite kitokį vardą" + +#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource +msgid "The project info file %s%s%s%sis equal to the project main source file!" +msgstr "Projekto informacinis failas %s%s%s%s toks pat kaip ir projekto pagrindinio pirminio kodo failas!" + +#: lazarusidestrconsts:lisunitidentifierexists +msgid "Unit identifier exists" +msgstr "Modulio identifikatorius egzistuoja" + +#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose +msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" +msgstr "Projekte jau yra modulis tokiu vardu %s%s%s.%sParinkite kitokį vardą." + +#: lazarusidestrconsts:liserrorcreatingfile +msgid "Error creating file" +msgstr "Klaida kuriant failą" + +#: lazarusidestrconsts:lisunabletocreatefile3 +msgid "Unable to create file%s%s%s%s" +msgstr "Nepavyko sukurti failą%s%s%s%s" + +#: lazarusidestrconsts:liscopyerror2 +msgid "Copy error" +msgstr "Klaida kopijuojant" + +#: lazarusidestrconsts:lissourcedirectorydoesnotexist +msgid "Source directory %s%s%s does not exist." +msgstr "Pirminio kodo katalogas %s%s%s neegzistuoja." + +#: lazarusidestrconsts:lisunabletocreatedirectory +msgid "Unable to create directory %s%s%s." +msgstr "Nepavyko sukurti katalogą %s%s%s." + +#: lazarusidestrconsts:lisunabletocopyfileto +msgid "Unable to copy file %s%s%s%sto %s%s%s" +msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s" + +#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented +msgid "Sorry, this type is not yet implemented" +msgstr "Deja, šis tipas dar neįgyvendintas" + +#: lazarusidestrconsts:lisfilehaschangedsave +msgid "File %s%s%s has changed. Save?" +msgstr "Failas %s%s%s pakeistas. Išsaugoti?" + +#: lazarusidestrconsts:lisunithaschangedsave +msgid "Unit %s%s%s has changed. Save?" +msgstr "Modulis %s%s%s pakeistas. Išsaugoti?" + +#: lazarusidestrconsts:lissourceofpagehaschangedsave +msgid "Source of page %s%s%s has changed. Save?" +msgstr "Pirminis kodas lape %s%s%s pakeistas. Išsaugoti?" + +#: lazarusidestrconsts:lissourcemodified +msgid "Source modified" +msgstr "Pirminis kodas pakeistas" + +#: lazarusidestrconsts:lisopenproject +msgid "Open Project?" +msgstr "Atverti projektą?" + +#: lazarusidestrconsts:lisopentheproject +msgid "Open the project %s?" +msgstr "Atverti projektą %s?" + +#: lazarusidestrconsts:lisopenpackage +msgid "Open Package?" +msgstr "Atverti paketą?" + +#: lazarusidestrconsts:lisopenthepackage +msgid "Open the package %s?" +msgstr "Atverti paketą %s?" + +#: lazarusidestrconsts:lisrevertfailed +msgid "Revert failed" +msgstr "Atstatyti nepavyko" + +#: lazarusidestrconsts:lisfileisvirtual +msgid "File %s%s%s is virtual." +msgstr "Failas %s%s%s yra virtualus." + +#: lazarusidestrconsts:lisunabletowrite +msgid "Unable to write %s%s%s%s%s." +msgstr "Nepavyko rašyti į %s%s%s%s%s." + +#: lazarusidestrconsts:lisfilenottext +msgid "File not text" +msgstr "Neteksto failas" + +#: lazarusidestrconsts:lisunabletorenamefile +msgid "Unable to rename file" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:lisunabletocopyfile +msgid "Unable to copy file" +msgstr "Nepavyko kopijuoti failą" + +#: lazarusidestrconsts:lissourceanddestinationarethesame +msgid "Source and Destination are the same:%s%s" +msgstr "Šaltinis ir tikslas sutampa:%s%s" + +#: lazarusidestrconsts:lisunabletorenamefileto2 +msgid "Unable to rename file %s%s%s%sto %s%s%s." +msgstr "Nepavyko pervardyti failą %s%s%s%sį %s%s%s." + +#: lazarusidestrconsts:lisunabletocopyfileto2 +msgid "Unable to copy file %s%s%s%sto %s%s%s." +msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s." + +#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway +msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" +msgstr "Nepanašu kad failas %s%s%s%s yra teksto failas.%sVistiek jį atverti?" + +#: lazarusidestrconsts:lisinvalidcommand +msgid "Invalid command" +msgstr "Klaidinga komanda" + +#: lazarusidestrconsts:listhecommandafterisnotexecutable +msgid "The command after %s%s%s is not executable." +msgstr "Komanda esanti po %s%s%s nėra vykdomasis failas." + +#: lazarusidestrconsts:lisinvaliddestinationdirectory +msgid "Invalid destination directory" +msgstr "Klaidingas tikslo katalogas" + +#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete +msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." +msgstr "Tikslo katalogas %s%s%s yra klaidingas.%sNurodykite pilną kelią." + +#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory +msgid "Unable to clean up destination directory" +msgstr "Nepavyko apvalyti tikslo katalogo" + +#: lazarusidestrconsts:liscommandafterinvalid +msgid "Command after invalid" +msgstr "Klaidinga komanda esanti po" + +#: lazarusidestrconsts:listhecommandafterpublishingisinvalid +msgid "The command after publishing is invalid:%s%s%s%s" +msgstr "Komanda esanti po paskelbimo yra klaidinga:%s%s%s%s" + +#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions +msgid "Unable to clean up %s%s%s.%sPlease check permissions." +msgstr "Nepavyko apvalyti %s%s%s.%sPatinkrinkite leidimus." + +#: lazarusidestrconsts:liscommandafterpublishingmodule +msgid "Command after publishing module" +msgstr "Komanda po modulio paskelbimo" + +#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith +msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." +msgstr "Nepavyko %s įdėti į projektą, nes projekte jau yra modulis tokiu pat vardu." + +#: lazarusidestrconsts:lisaddtoproject +msgid "Add %s to project?" +msgstr "Įdėti %s į projektą?" + +#: lazarusidestrconsts:listhefile +msgid "The file %s%s%s" +msgstr "Failas %s%s%s" + +#: lazarusidestrconsts:lisisalreadypartoftheproject +msgid "%s is already part of the Project." +msgstr "%s jau yra projekte." + +#: lazarusidestrconsts:lisremovefromproject +msgid "Remove from project" +msgstr "Pašalinti iš projekto" + +#: lazarusidestrconsts:liscreateaprojectfirst +msgid "Create a project first!" +msgstr "Pirma sukurkite projektą!" + +#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt +msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" +msgstr "Nerastas katalogas testui:%s%s%s%s%s(tikrinkite aplinkos parinktis)" + +#: lazarusidestrconsts:lisbuildnewproject +msgid "Build new project" +msgstr "Daryti naująjį projektą" + +#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest +msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" +msgstr "Prieš darymą projektas turi būti išsaugotas%sAplinkos parinktyse parinkę testo katalogą,%snaujus projektus bus galima kurti ir daryti vienu metu.%sIšsaugoti projektą?" + +#: lazarusidestrconsts:lisprojectsuccessfullybuilt +msgid "Project %s%s%s successfully built. :)" +msgstr "Projektas %s%s%s sėkmingai padarytas :)" + +#: lazarusidestrconsts:lisexecutingcommandbefore +msgid "Executing command before" +msgstr "Startuojama komanda prieš" + +#: lazarusidestrconsts:lisexecutingcommandafter +msgid "Executing command after" +msgstr "Startuojama komanda po" + +#: lazarusidestrconsts:lisnoprogramfilesfound +msgid "No program file %s%s%s found." +msgstr "Nerastas programos failas %s%s%s." + +#: lazarusidestrconsts:liserrorinitializingprogramserrors +msgid "Error initializing program%s%s%s%s%sError: %s" +msgstr "Įvyko klaida inicializuojant programą%s%s%s%s%sKlaida: %s" + +#: lazarusidestrconsts:lisnotnow +msgid "Not now" +msgstr "Ne dabar" + +#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling +msgid "You can not build lazarus while debugging or compiling." +msgstr "Derinimo ar kompiliavimo metu negalima daryti Lazarus." + +#: lazarusidestrconsts:lisunabletosavefile +msgid "Unable to save file %s%s%s" +msgstr "Nepavyko išsaugoti failą %s%s%s" + +#: lazarusidestrconsts:lisreaderror +msgid "Read Error" +msgstr "Skaitymo klaida" + +#: lazarusidestrconsts:lisunabletoreadfile2 +msgid "Unable to read file %s%s%s!" +msgstr "Nepavyko skaityti iš failo %s%s%s!" + +#: lazarusidestrconsts:liswriteerror +msgid "Write Error" +msgstr "Rašymo klaida" + +#: lazarusidestrconsts:lisunabletowritetofile +msgid "Unable to write to file %s%s%s!" +msgstr "Nepavyko rašyti į failą %s%s%s!" + +#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2 +msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" +msgstr "Nepanašu kad failas %s%s%s%syra teksto failas.%sVistiek atverti?" + +#: lazarusidestrconsts:lisunabletocreatebackupdirectory +msgid "Unable to create backup directory %s%s%s." +msgstr "Nepavyko sukurti atsarginių kopijų katalogo %s%s%s." + +#: lazarusidestrconsts:lisdeletefilefailed +msgid "Delete file failed" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:lisunabletoremoveoldbackupfile +msgid "Unable to remove old backup file %s%s%s!" +msgstr "Nepavyko ištrinti seną atsarginės kopijos failą %s%s%s!" + +#: lazarusidestrconsts:lisrenamefilefailed +msgid "Rename file failed" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:lisunabletorenamefileto +msgid "Unable to rename file %s%s%s to %s%s%s!" +msgstr "Nepavyko pervardyti failą %s%s%s į %s%s%s!" + +#: lazarusidestrconsts:lisbackupfilefailed +msgid "Backup file failed" +msgstr "Nepavyko padaryti failo atsarginę kopiją" + +#: lazarusidestrconsts:lisunabletobackupfileto +msgid "Unable to backup file %s%s%s to %s%s%s!" +msgstr "Nepavyko padaryti failo %s%s%s atsarginę kopiją į %s%s%s!" + +#: lazarusidestrconsts:lisfilenotlowercase +msgid "File not lowercase" +msgstr "Failo vardas ne mažosiomis raidėmis" + +#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds +msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" +msgstr "Modulio failo varde %s%s%s nevisos raidės yra mažosios.%sFreePascal kompiliatorius 1.0.x priima failus, kurių varduose tik mažosios raidės. Jei jūs nenaudojate FPC 1.0.x, tada jūs galite ignoruoti šį pranešimą.%s%sPervardyti failą?" + +#: lazarusidestrconsts:lisdeleteambiguousfile +msgid "Delete ambiguous file?" +msgstr "Ištrinti neaiškųjį failą?" + +#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete +msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" +msgstr "Rastas neaiškus failas: %s%s%s%sŠis failas gali būti supainiotas su %s%s%s%s%sIštrinti neaiškųjį failą?" + +#: lazarusidestrconsts:lislazaruseditorv +msgid "Lazarus Editor v%s" +msgstr "Lazarus redaktorius v%s" + +#: lazarusidestrconsts:lisnewproject +msgid "%s - (new project)" +msgstr "%s - (naujas projektas)" + +#: lazarusidestrconsts:liscompiling +msgid "%s (compiling ...)" +msgstr "%s (kompiliuojama...)" + +#: lazarusidestrconsts:lisdebugging +msgid "%s (debugging ...)" +msgstr "%s (derinama...)" + +#: lazarusidestrconsts:lisunabletofindfile +msgid "Unable to find file %s%s%s." +msgstr "Nerastas failas %s%s%s." + +#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption +msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" +msgstr "Failas %s%s%s nerastas.%sPatikrinkite kelius meniu%s\"Projektas -> Kompiliatoriaus parinktys... -> Keliai -> Kitų modulių failai\"" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal +msgid "NOTE: Could not create Define Template for Free Pascal Sources" +msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto FreePascal pirminiam kodui" + +#: lazarusidestrconsts:lisclassnotfound +msgid "Class not found" +msgstr "Klasė nerasta" + +#: lazarusidestrconsts:lisoifclassnotfound +msgid "Class %s%s%s not found." +msgstr "Klasė %s%s%s nerasta." + +#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste +msgid "Class %s%s%s is not a registered component class.%sUnable to paste." +msgstr "Klasė %s%s%s nėra registruoto komponento klasė.%sĮdėti nepavyks." + +#: lazarusidestrconsts:liscontrolneedsparent +msgid "Control needs parent" +msgstr "Valdikliui reikia tėvo" + +#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro +msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." +msgstr "Klasė %s%s%s yra \"TControl\" tipo, todėl jos neis įdėti ne į valdiklį.%sĮdėti nepavyks." + +#: lazarusidestrconsts:lisconversionerror +msgid "Conversion error" +msgstr "Klaida konvertuojant" + +#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat +msgid "Unable to convert component text into binary format:%s%s" +msgstr "Nepavyko komponentės tekstą konvertuoti į dvejetainį formatą:%s%s" + +#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources +msgid "NOTE: Could not create Define Template for Lazarus Sources" +msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto Lazarus pirminiam kodui" + +#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction +msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." +msgstr "Klaidingas reiškinys.%sUžuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos, kuri yra tik viename faile.%sPažymėkite reiškinį ir bandykite vėl." + +#: lazarusidestrconsts:lisselectionexceedsstringconstant +msgid "Selection exceeds string constant" +msgstr "Pažymėta daugiau nei eilutės konstanta" + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 +msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." +msgstr "Užuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos.%sPažymėkite tik eilutės reiškinį ir bandykite vėl." + +#: lazarusidestrconsts:lisnoresourcestringsectionfound +msgid "No ResourceString Section found" +msgstr "Nerasta \"ResourceString\" sekcija" + +#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe +msgid "Unable to find a ResourceString section in this or any of the used units." +msgstr "Nepavyko rasti \"ResourceString\" sekcijos šiame ir kituose naudojamuose moduliuose" + +#: lazarusidestrconsts:liscomponentnameisnotavalididentifier +msgid "Component name %s%s%s is not a valid identifier" +msgstr "Komponento vardas %s%s%s nėra identifikatorius" + +#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe +msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" +msgstr "Vardai dubliuojasi: komponentas, vardu %s%s%s, jau yra paveldėtame komponente %s" + +#: lazarusidestrconsts:liscomponentnameiskeyword +msgid "Component name %s%s%s is keyword" +msgstr "Komponentės vardas %s%s%s kaip ir raktažodžio" + +#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus +msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." +msgstr "Jau pačio modulio vardas yra toks %s%s%s. Paskalio identifikatoriai turi būti unikalūs." + +#: lazarusidestrconsts:lisunabletorenamevariableinsource +msgid "Unable to rename variable in source." +msgstr "Nepavyko pirminiame kode pervardyti kintamąjį" + +#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource +msgid "Unable to update CreateForm statement in project source" +msgstr "Nepavyko projekto pirminiame kode atnaujinti sakinį \"CreateStatement\"" + +#: lazarusidestrconsts:listhereisalreadyaformwiththename +msgid "There is already a form with the name %s%s%s" +msgstr "Forma tokiu vardu %s%s%s jau yra" + +#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus +msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." +msgstr "Modulis tokiu vardu %s%s%s jau yra. Paskalio identifikatoriai turi būti unikalūs." + +#: lazarusidestrconsts:lisseemessages +msgid "See messages." +msgstr "Peržvelkit pranešimus." + +#: lazarusidestrconsts:liserror +msgid "Error: " +msgstr "Klaida:" + +#: lazarusidestrconsts:lissavechanges +msgid "Save changes?" +msgstr "Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:lissavefilebeforeclosingform +msgid "Save file %s%s%s%sbefore closing form %s%s%s?" +msgstr "Išsaugoti failą %s%s%s%sprieš užveriant formą %s%s%s?" + +#: lazarusidestrconsts:lisunabletorenameforminsource +msgid "Unable to rename form in source." +msgstr "Nepavyko pirminiame kode pervardyti formą." + +#: lazarusidestrconsts:lissorrynotimplementedyet +msgid "Sorry, not implemented yet" +msgstr "Deja, dar neįgyvendinta" + +#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage +msgid "Unable to find method. Plz fix the error shown in the message window." +msgstr "Nepavyko rasti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin +msgid "Unable to create new method. Plz fix the error shown in the message window." +msgstr "Nepavyko sukurti naują metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage +msgid "Unable to show method. Plz fix the error shown in the message window." +msgstr "Nepavyko parodyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag +msgid "Unable to rename method. Plz fix the error shown in the message window." +msgstr "Nepavyko pervardyti metodą. Pirma ištaisykite pranešimų lange rodomą klaidą." + +#: lazarusidestrconsts:lisstopdebugging +msgid "Stop Debugging?" +msgstr "Nutraukti derinimą?" + +#: lazarusidestrconsts:lisstopthedebugging +msgid "Stop the debugging?" +msgstr "Nutraukti derinimą?" + +#: lazarusidestrconsts:liscannotfindlazarusstarter +msgid "Cannot find lazarus starter:%s%s" +msgstr "Nepavyko rasti Lazarus startuotoją:%s%s" + +#: lazarusidestrconsts:lisresourcefilecomment +msgid "This is an automatically generated lazarus resource file" +msgstr "Tai automatiškai sugeneruotas Lazarus resursų failas" + +#: lazarusidestrconsts:lisopenfile +msgid "Open file" +msgstr "Atverti failą" + +#: lazarusidestrconsts:lisiecoexportfileexists +msgid "Export file exists" +msgstr "Eksportuojamas failas egzistuoja" + +#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti +msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" +msgstr "Eksportuojamas failas %s%s%s jau yra.%sAtverti failą ir jame įrašyti tik kompiliatoriaus parinktis?%s(Kitos faile esančios nuostatos lik tokios pačios.)" + +#: lazarusidestrconsts:lisiecoopenorloadcompileroptions +msgid "Open or Load Compiler Options" +msgstr "Atverti arba įkelti kompiliatoriaus parinktis" + +#: lazarusidestrconsts:lisiecoerroraccessingxml +msgid "Error accessing xml" +msgstr "Klaida kreipiantis į XML" + +#: lazarusidestrconsts:lisiecoerrorloadingxml +msgid "Error loading xml" +msgstr "Klaida įkeliant XML" + +#: lazarusidestrconsts:lisiecoerrorloadingxmlfile +msgid "Error loading xml file %s%s%s:%s%s" +msgstr "Įvyko klaida įkeliant XML failą %s%s%s:%s%s" + +#: lazarusidestrconsts:lisiecoerroraccessingxmlfile +msgid "Error accessing xml file %s%s%s:%s%s" +msgstr "Įvyko klaida kreipiantis į XML falą %s%s%s:%s%s" + +#: lazarusidestrconsts:lisiecorecentfiles +msgid "Recent files" +msgstr "Paskutiniai naudoti" + +#: lazarusidestrconsts:lisiecosavetorecent +msgid "Save to recent" +msgstr "Išsaugoti paskutinį naudotame" + +#: lazarusidestrconsts:lisiecoopenrecent +msgid "Open recent" +msgstr "Atverti paskutinį naudotą" + +#: lazarusidestrconsts:lisiecosavetofile +msgid "Save to file" +msgstr "Išsaugoti faile" + +#: lazarusidestrconsts:lisiecoloadfromfile +msgid "Load from file" +msgstr "Įkelti iš failo" + +#: lazarusidestrconsts:lislazarusfile +msgid "Lazarus File" +msgstr "Lazarus failas" + +#: lazarusidestrconsts:lispascalunit +msgid "Pascal unit" +msgstr "Paskalio modulis" + +#: lazarusidestrconsts:lispascalsourcefile +msgid "Pascal source file" +msgstr "Paskalio pirminio kodo failas" + +#: lazarusidestrconsts:lisfreepascalsourcefile +msgid "FreePascal source file" +msgstr "FreePascal pirminio kodo failas" + +#: lazarusidestrconsts:lisdebugunabletoloadfile +msgid "Unable to load file" +msgstr "Nepavyko įkelti failą" + +#: lazarusidestrconsts:lisdebugunabletoloadfile2 +msgid "Unable to load file %s%s%s." +msgstr "Nepavyko įkelti failą %s%s%s." + +#: lazarusidestrconsts:lisopenprojectfile +msgid "Open Project File" +msgstr "Atverti projekto failą" + +#: lazarusidestrconsts:lislazarusprojectinfofile +msgid "Lazarus Project Info file" +msgstr "Lazarus projekto informacinis failas" + +#: lazarusidestrconsts:lisallfiles +msgid "All Files" +msgstr "Visi failai" + +#: lazarusidestrconsts:lisprojectclosed +msgid "Project closed" +msgstr "Projektas užvertas" + +#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin +msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically." +msgstr "Projektas užvertas. Šiuo atveju yra trys galimybės.%sUžuomina: jums nebūtina pačiam užverti projektą, tai padaroma automatiškai." + +#: lazarusidestrconsts:lisquitlazarus +msgid "Quit Lazarus" +msgstr "Baigti Lazarus darbą" + +#: lazarusidestrconsts:liscreatenewproject +msgid "Create new project" +msgstr "Kurti naują projektą" + +#: lazarusidestrconsts:lisopenpackagefile +msgid "Open Package File" +msgstr "Atverti paketo failą" + +#: lazarusidestrconsts:lissavespace +msgid "Save " +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lisselectdfmfiles +msgid "Select Delphi form files (*.dfm)" +msgstr "Nurodykite Delphi formos failus (*.dfm)" + +#: lazarusidestrconsts:lischoosedirectory +msgid "Choose directory" +msgstr "Nurodykite katalogą" + +#: lazarusidestrconsts:lisdestinationdirectory +msgid "Destination directory" +msgstr "Paskirties katalogas" + +#: lazarusidestrconsts:liscommandafter +msgid "Command after" +msgstr "Komanda po" + +#: lazarusidestrconsts:lischooselazarussourcedirectory +msgid "Choose Lazarus Directory" +msgstr "Nurodykite Lazarus katalogą" + +#: lazarusidestrconsts:lischoosecompilerpath +msgid "Choose compiler filename (%s)" +msgstr "Nurorodykite kompiliatoriaus dailo vardą (%s)" + +#: lazarusidestrconsts:lischoosefpcsourcedir +msgid "Choose FPC source directory" +msgstr "Nurodykite FPC pirminio kodo katalogą" + +#: lazarusidestrconsts:lischoosemakepath +msgid "Choose make path" +msgstr "Nurodykite make kelią" + +#: lazarusidestrconsts:lischoosedebuggerpath +msgid "Choose debugger filename" +msgstr "Nurodykite derintuvės failo vardą" + +#: lazarusidestrconsts:lischoosetestbuilddir +msgid "Choose the directory for tests" +msgstr "Nurodykite katalogą testams" + +#: lazarusidestrconsts:lislazarusdesktopsettings +msgid "Lazarus Desktop Settings" +msgstr "Lazarus darbastalio nuostatos" + +#: lazarusidestrconsts:lisxmlfiles +msgid "XML files" +msgstr "XML failai" + +#: lazarusidestrconsts:lissavechangestoproject +msgid "Save changes to project %s?" +msgstr "Išsaugoti pakeitimus projekte %s?" + +#: lazarusidestrconsts:lisprojectchanged +msgid "Project changed" +msgstr "Projektas pakeistas" + +#: lazarusidestrconsts:lisfpcsourcedirectoryerror +msgid "FPC Source Directory error" +msgstr "FPC pirminio kodo katalogo klaida" + +#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory +msgid "Please check the freepascal source directory" +msgstr "Patikrinkite FreePascal pirminio kodo katalogą" + +#: lazarusidestrconsts:liscompilererror +msgid "Compiler error" +msgstr "Kompiliatoriaus klaida" + +#: lazarusidestrconsts:lisplzcheckthecompilername +msgid "Please check the compiler name" +msgstr "Patikrinkite kompiliatoriaus vardą" + +#: lazarusidestrconsts:lisaboutlazarus +msgid "About Lazarus" +msgstr "Apie Lazarus" + +#: lazarusidestrconsts:lisversion +msgid "Version" +msgstr "Versija" + +#: lazarusidestrconsts:lisdate +msgid "Date" +msgstr "Data" + +#: lazarusidestrconsts:lissvnrevision +msgid "SVN Revision: " +msgstr "SVN poversijis:" + +#: lazarusidestrconsts:lisclose +msgid "&Close" +msgstr "&Užverti" + +#: lazarusidestrconsts:lisaboutlazarusmsg +msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." +msgstr "Licenzija: GPL/LGPL%sLazarus yra IKA (integruota kūrimo aplinka), skirtas su FreePascal kurti (vizualinėms bei konsolės) programoms. FreePascal yra (L)GPL tipo paskalio ir objektinio paskalio kompiliatorius, jis dirba Linux, Windows, Mac OS X, FreeBSD ir kitose operacinėse sistemose.%sLazarus yra trūkstamoji galvosukio dalis, kuri jums leidžia visose paminėtose platformose kurti programas aplinkoje panašioje į Delphi. IKA yra GPK (greitas programų kūrimas) įrankis, kuriame yra formų konstruktorius.%sLazarus auga, todėl mums reikia daugiau kūrėjų." + +#: lazarusidestrconsts:lisaboutnocontributors +msgid "Cannot find contributors list." +msgstr "Nepavyko rasti talkininkų sąrašo" + +#: lazarusidestrconsts:lisunitnamealreadyexistscap +msgid "Unitname already in project" +msgstr "Modulio vardas jau paminėtas projekte" + +#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming +msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." +msgstr "Modulis %s%s%s jau egzistuoja.%sPaspaudus \"Ignoruoti\" bus pervadyjama,%spaspaudus \"Atsisakyti\" šis pirminis kodas nebus išsaugotas,%so paspaudus \"Nutraukti\" bus nutrauktas visas išsaugojimo procesas." + +#: lazarusidestrconsts:lisforcerenaming +msgid "Force renaming" +msgstr "Vistiek pervardyti" + +#: lazarusidestrconsts:liscancelrenaming +msgid "Cancel renaming" +msgstr "Atsisakyti pervardyjimo" + +#: lazarusidestrconsts:lisabortall +msgid "Abort all" +msgstr "Nutraukti viską" + +#: lazarusidestrconsts:lisinvalidpascalidentifiercap +msgid "Invalid Pascal Identifier" +msgstr "Klaidingas paskalio identifikatorius" + +#: lazarusidestrconsts:lisinvalidpascalidentifiertext +msgid "The name \"%s\" is not a valid pascal identifier." +msgstr "Vardas \"%s\" nėra paskalio identifikatorius." + +#: lazarusidestrconsts:liscopyerror +msgid "Copy Error" +msgstr "Klaida kopijuojant" + +#: lazarusidestrconsts:lishintopen +msgid "Open" +msgstr "Atverti" + +#: lazarusidestrconsts:lishintsave +msgid "Save" +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lishintsaveall +msgid "Save all" +msgstr "Išsaugoti visus" + +#: lazarusidestrconsts:lishinttoggleformunit +msgid "Toggle Form/Unit" +msgstr "Rodyti formą arba modulį" + +#: lazarusidestrconsts:lishintviewunits +msgid "View Units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:lishintviewforms +msgid "View Forms" +msgstr "Rodyti formas" + +#: lazarusidestrconsts:lishintrun +msgid "Run" +msgstr "Startuoti" + +#: lazarusidestrconsts:lishintpause +msgid "Pause" +msgstr "Pauzė" + +#: lazarusidestrconsts:lishintstepinto +msgid "Step Into" +msgstr "Žengti gilyn" + +#: lazarusidestrconsts:lishintstepover +msgid "Step Over" +msgstr "Žengti virš" + +#: lazarusidestrconsts:lisgplnotice +msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." + +#: lazarusidestrconsts:lislgplnotice +msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." + +#: lazarusidestrconsts:lismodifiedlgplnotice +msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." +msgstr "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." + +#: lazarusidestrconsts:dlgbaknosubdirectory +msgid "(no subdirectory)" +msgstr "(pakatalogio nėra)" + +#: lazarusidestrconsts:dlgsearchcaption +msgid "Searching..." +msgstr "Ieškoma..." + +#: lazarusidestrconsts:dlgsearchabort +msgid "Search terminated by user." +msgstr "Iešką nutraukė naudotojas." + +#: lazarusidestrconsts:lissmatches +msgid "Matches" +msgstr "Atitikmenys" + +#: lazarusidestrconsts:lisssearching +msgid "Searching" +msgstr "Ieškoma" + +#: lazarusidestrconsts:lisssearchtext +msgid "Search text" +msgstr "Teksto paieška" + +#: lazarusidestrconsts:dlgdesktop +msgid "Desktop" +msgstr "Darbastalis" + +#: lazarusidestrconsts:dlgwindows +msgid "Windows" +msgstr "Langai" + +#: lazarusidestrconsts:dlgfrmeditor +msgid "Form Editor" +msgstr "Formų konstruktorius" + +#: lazarusidestrconsts:dlgobjinsp +msgid "Object Inspector" +msgstr "Objektų inspektorius" + +#: lazarusidestrconsts:dlgenvfiles +msgid "Files" +msgstr "Failai" + +#: lazarusidestrconsts:lisignorebinaries +msgid "Ignore binaries" +msgstr "Praleisti dvejetainius failus" + +#: lazarusidestrconsts:lissimplesyntax +msgid "Simple Syntax" +msgstr "Paprasta sintaksė" + +#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta +msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" +msgstr "Įprastai filtre nurodomas reguliarusis reiškinys. Paprastojoje sintaksėje taškas \".\" įra įprastas simbolis, žvaigždė \"*\" atitinka betką, klaustukas \"?\" atitinka vieną kažkokį simbolį, kablelis arba kabliataškis atskiria alternatyvas. Pavyzdžiui: prasta sintaksė *.pas;*pp atitinka ^(.*\\.pas|.*\\.pp)$" + +#: lazarusidestrconsts:lisuseexcludefilter +msgid "Use Exclude Filter" +msgstr "Naudoti neįtraukimo filtrą" + +#: lazarusidestrconsts:lisexcludefilter +msgid "Exclude Filter" +msgstr "Neįtraukimo filtras" + +#: lazarusidestrconsts:lisprojectinformation +msgid "Project Information" +msgstr "Informacija apie projektą" + +#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles +msgid "Save editor info of non project files" +msgstr "Išsaugoti redaktoriaus informaciją apie projektui nepriklausančius failus" + +#: lazarusidestrconsts:lissaveinfoofclosededitorfiles +msgid "Save info of closed editor files" +msgstr "Išsaugoti informaciją apie užvertus redaktoriaus failus" + +#: lazarusidestrconsts:lisuseincludefilter +msgid "Use Include Filter" +msgstr "Naudoti įterpimo filtrą" + +#: lazarusidestrconsts:lisincludefilter +msgid "Include Filter" +msgstr "Įterpimo filtras" + +#: lazarusidestrconsts:dlgenvbckup +msgid "Backup" +msgstr "Atsarginė kopija" + +#: lazarusidestrconsts:dlgnaming +msgid "Naming" +msgstr "Vardų suteikimas" + +#: lazarusidestrconsts:lislazdoc +msgid "LazDoc" +msgstr "LazDoc" + +#: lazarusidestrconsts:lisokbtn +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:dlgcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lazarusidestrconsts:liskmclassic +msgid "Classic" +msgstr "Klasikinis" + +#: lazarusidestrconsts:lispefilename +msgid "Filename:" +msgstr "Failo vardas:" + +#: lazarusidestrconsts:lispeunitname +msgid "Unitname:" +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses +msgid "The unitname is used when the IDE extends uses clauses." +msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą." + +#: lazarusidestrconsts:lispetheunitnameisusedwhentheideextendsusesclauses +msgid "The unitname is used when the IDE extends uses clauses." +msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą." + +#: lazarusidestrconsts:lispeinvalidunitfilename +msgid "Invalid unit filename" +msgstr "Klaidingas modulio failo vardas" + +#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas +msgid "A pascal unit must have the extension .pp or .pas" +msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" + +#: lazarusidestrconsts:lispeapascalunitmusthavetheextensionpporpas +msgid "A pascal unit must have the extension .pp or .pas" +msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" + +#: lazarusidestrconsts:lispeinvalidunitname +msgid "Invalid unitname" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier +msgid "The unitname is not a valid pascal identifier." +msgstr "Modulio vardas nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni +msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" +msgstr "Modulio ir failo vardai nesutampa.%Pavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"." + +#: lazarusidestrconsts:lispetheunitnameisnotavalidpascalidentifier +msgid "The unitname is not a valid pascal identifier." +msgstr "Modulio vardas nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lispeconflictfound +msgid "Conflict found" +msgstr "Aptiktas konfliktas" + +#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile +msgid "There is already an unit with this name.%sFile: %s" +msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s" + +#: lazarusidestrconsts:lispethereisalreadyanunitwiththisnamefile +msgid "There is already an unit with this name.%sFile: %s" +msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s" + +#: lazarusidestrconsts:lispeunitnameandfilenamedonotmatchexampleunit1pasanduni +msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" +msgstr "Modulio ir failo vardai nesutampa.%Pavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"." + +#: lazarusidestrconsts:lisok +msgid "&Ok" +msgstr "&Tinka" + +#: lazarusidestrconsts:liscmparameter +msgid "Parameter" +msgstr "Parametras" + +#: lazarusidestrconsts:lisctpleaseselectamacro +msgid "please select a macro" +msgstr "pažymėkite makrokomandą" + +#: lazarusidestrconsts:lisa2pcreatenewfile +msgid "Create new file" +msgstr "Kurti naują failą" + +#: lazarusidestrconsts:dlgenvlanguage +msgid "Language" +msgstr "Kalba" + +#: lazarusidestrconsts:dlgautosave +msgid "Auto save" +msgstr "Automatinis išsaugojimas" + +#: lazarusidestrconsts:dlgedfiles +msgid "Editor files" +msgstr "Redaktoriaus failai" + +#: lazarusidestrconsts:dlgenvproject +msgid "Project" +msgstr "Projektas" + +#: lazarusidestrconsts:liscodebrowser +msgid "Code browser" +msgstr "Kodo naršyklė" + +#: lazarusidestrconsts:dlgintvinsec +msgid "Interval in secs" +msgstr "Intervalas sekundėmis" + +#: lazarusidestrconsts:dlgdesktopfiles +msgid "Desktop files" +msgstr "Darbastalio failai" + +#: lazarusidestrconsts:dlgsavedfile +msgid "Save desktop settings to file" +msgstr "Įrašyti darbastalio nustatas faile" + +#: lazarusidestrconsts:dlgloaddfile +msgid "Load desktop settings from file" +msgstr "Įkelti darbastalio nuostatas iš failo" + +#: lazarusidestrconsts:dlgminimizeallonminimizemain +msgid "Minimize all on minimize main" +msgstr "Suskleidžiant pagrindinį suskleisti visus" + +#: lazarusidestrconsts:dlghideideonrun +msgid "Hide IDE windows on run" +msgstr "Startuojant programą slėpti IKA langus" + +#: lazarusidestrconsts:dlgpalhints +msgid "Hints for component palette" +msgstr "Sufleriai komponenčių paletei" + +#: lazarusidestrconsts:lischeckchangesondiskwithloading +msgid "Check changes on disk with loading" +msgstr "Įkeliant ieškoti pasikeitimų diske" + +#: lazarusidestrconsts:dlgspbhints +msgid "Hints for main speed buttons (open, save, ...)" +msgstr "Sufleriai pagrindiniams spartos mygtukams (\"Atverti\", \"Išsaugoti\", ...)" + +#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick +msgid "Double click on messages jumps (otherwise: single click)" +msgstr "Spustelėjus dukart ant pranešimo peršoks į pranešamą vietą (kitaip - vienąkart)" + +#: lazarusidestrconsts:dlgwinpos +msgid "Window Positions" +msgstr "Langų pozicijos" + +#: lazarusidestrconsts:dlgmainmenu +msgid "Main Menu" +msgstr "Pagrindinis meniu" + +#: lazarusidestrconsts:dlgsrcedit +msgid "Source Editor" +msgstr "Pirminio kodo redaktorius" + +#: lazarusidestrconsts:dlgmsgs +msgid "Messages" +msgstr "Pranešimai" + +#: lazarusidestrconsts:dlgprojfiles +msgid "Project files" +msgstr "Projekto failai" + +#: lazarusidestrconsts:dlgenvtype +msgid "Type" +msgstr "Tipas" + +#: lazarusidestrconsts:dlgenvnone +msgid "None" +msgstr "Joks" + +#: lazarusidestrconsts:dlgsmbfront +msgid "Symbol in front (.~pp)" +msgstr "Simbolis priekyje (.~pp)" + +#: lazarusidestrconsts:lisnobackupfiles +msgid "No backup files" +msgstr "Nedaryti atsarginių kopijų" + +#: lazarusidestrconsts:dlgsmbbehind +msgid "Symbol behind (.pp~)" +msgstr "Simbolis gale (.pp~)" + +#: lazarusidestrconsts:dlgsmbcounter +msgid "Counter (.pp;1)" +msgstr "Skaitliukas (.pp.1)" + +#: lazarusidestrconsts:dlgcustomext +msgid "User defined extension (.pp.xxx)" +msgstr "Naudotojo nurodytas prievardis (.pp.xxx)" + +#: lazarusidestrconsts:dlgbckupsubdir +msgid "Same name (in subdirectory)" +msgstr "Tokspat vardas (pakatalogyje)" + +#: lazarusidestrconsts:dlgedcustomext +msgid "User defined extension" +msgstr "Naudotojo nurodytas prievardis" + +#: lazarusidestrconsts:dlgmaxcntr +msgid "Maximum counter" +msgstr "Skaitliuko riba" + +#: lazarusidestrconsts:dlgedbsubdir +msgid "Sub directory" +msgstr "Pakatalogis" + +#: lazarusidestrconsts:dlgenvotherfiles +msgid "Other files" +msgstr "Kiti failai" + +#: lazarusidestrconsts:dlgmaxrecentfiles +msgid "Max recent files" +msgstr "Maksimalus atvertų failų sąrašo ilgis" + +#: lazarusidestrconsts:dlgmaxrecentprojs +msgid "Max recent project files" +msgstr "Maksimalus atvertų projektų sąrašo ilgis" + +#: lazarusidestrconsts:dlgqopenlastprj +msgid "Open last project at start" +msgstr "Startuojant atverti paskutinisyk atvertą projektą" + +#: lazarusidestrconsts:dlglazarusdir +msgid "Lazarus directory (default for all projects)" +msgstr "Lazarus katalogas (numatytas visiems projektams)" + +#: lazarusidestrconsts:dlgfpcpath +msgid "Compiler path (e.g. %s)" +msgstr "Kompiliatoriaus failas (pvz.: %s)" + +#: lazarusidestrconsts:dlgfpcsrcpath +msgid "FPC source directory" +msgstr "FPC pirminio kodo katalogas" + +#: lazarusidestrconsts:dlgmakepath +msgid "Make path" +msgstr "Programos make failas" + +#: lazarusidestrconsts:dlgdebugtype +msgid "Debugger type and path" +msgstr "Derintuvės tipas ir failas" + +#: lazarusidestrconsts:dlgtestprjdir +msgid "Directory for building test projects" +msgstr "Katalogas testo projektų darymui" + +#: lazarusidestrconsts:dlgqshowgrid +msgid "Show grid" +msgstr "Rodyti tinklelį" + +#: lazarusidestrconsts:dlgqshowborderspacing +msgid "Show border spacing" +msgstr "Rodyti rėmelio plotį" + +#: lazarusidestrconsts:dlggridcolor +msgid "Grid color" +msgstr "Tinklelio spalva" + +#: lazarusidestrconsts:dlgqsnaptogrid +msgid "Snap to grid" +msgstr "Pritraukti prie tinklelio taškų" + +#: lazarusidestrconsts:dlggridx +msgid "Grid size X" +msgstr "Tinklelio tarpai X" + +#: lazarusidestrconsts:dlggridxhint +msgid "Horizontal grid step size" +msgstr "Horizontalūs tarpai tarp tinklelio taškų" + +#: lazarusidestrconsts:dlggridy +msgid "Grid size Y" +msgstr "Tinklelio tarpai Y" + +#: lazarusidestrconsts:dlggridyhint +msgid "Vertical grid step size" +msgstr "Vertikalūs tarpai tarp tinklelio taškų" + +#: lazarusidestrconsts:dlgguidelines +msgid "Show Guide Lines" +msgstr "Rodyti pagalbines linijas" + +#: lazarusidestrconsts:dlgsnapguidelines +msgid "Snap to Guide Lines" +msgstr "Pritraukti prie pagalbinių linijų" + +#: lazarusidestrconsts:dlglefttopclr +msgid "color for left, top" +msgstr "Apatinės bei viršutinės spalva" + +#: lazarusidestrconsts:dlgrightbottomclr +msgid "color for right, bottom" +msgstr "Kairiosios bei dešiniosios spalva" + +#: lazarusidestrconsts:dlgshowcaps +msgid "Show component captions" +msgstr "Rodyti komponenčių antraštes" + +#: lazarusidestrconsts:dlgshowedrhints +msgid "Show editor hints" +msgstr "Redaktoriuje rodyti informacinius langelius" + +#: lazarusidestrconsts:dlgautoform +msgid "Auto create form when opening unit" +msgstr "Atveriant modulį formą sukurti automatiškai" + +#: lazarusidestrconsts:dlgrightclickselects +msgid "Right Click selects" +msgstr "Dešinysis pelės spustelėjimas pažymi" + +#: lazarusidestrconsts:dlggrabbercolor +msgid "Grabber color" +msgstr "Rankenėlės spalva" + +#: lazarusidestrconsts:dlgmarkercolor +msgid "Marker color" +msgstr "Žymeklio spalva" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidle +msgid "Reduce designer painting" +msgstr "Sumažinti paišymą konstruktoriuje" + +#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu +msgid "Paint designer items only on idle (reduce overhead for slow computers)" +msgstr "Piešti tik IKA esančius konstruktoriaus elementus (sumažina lėtų kompiuterių apkrovą)" + +#: lazarusidestrconsts:dlgenvgrid +msgid "Grid" +msgstr "Tinklelis" + +#: lazarusidestrconsts:dlgenvlguidelines +msgid "Guide lines" +msgstr "Pagalbinės linijos" + +#: lazarusidestrconsts:dlgenvmisc +msgid "Miscellaneous" +msgstr "Įvairūs" + +#: lazarusidestrconsts:dlgruberbandselectioncolor +msgid "Selection" +msgstr "Žymėjimas" + +#: lazarusidestrconsts:dlgruberbandcreationcolor +msgid "Creation" +msgstr "Kūrimas" + +#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds +msgid "Select grand childs" +msgstr "Žymėti provaikius" + +#: lazarusidestrconsts:dlgrubberbandgroup +msgid "Rubber band" +msgstr "Žymėjimo rėmelis" + +#: lazarusidestrconsts:dlgpasext +msgid "Default pascal extension" +msgstr "Numatytas paskalio prievardis" + +#: lazarusidestrconsts:dlgcharcasefileact +msgid "Save As - auto rename pascal files lower case" +msgstr "Išsaugant kitaip paskalio failus automatiškai pervardyti mažosiomis raidėmis" + +#: lazarusidestrconsts:dlgambigfileact +msgid "Ambiguous file action:" +msgstr "Esant neaiškiam failui:" + +#: lazarusidestrconsts:dlgenvask +msgid "Ask" +msgstr "Klausti" + +#: lazarusidestrconsts:dlgautodel +msgid "Auto delete file" +msgstr "Failą ištrinti automatiškai" + +#: lazarusidestrconsts:dlgautoren +msgid "Auto rename file lowercase" +msgstr "Failą automatiškai pervardyti mažosiomis raidėmis" + +#: lazarusidestrconsts:dlgnoautomaticrenaming +msgid "no automatic renaming" +msgstr "Automatiškai nepervardyti" + +#: lazarusidestrconsts:dlgambigwarn +msgid "Warn on compile" +msgstr "Perspėti prieš kompiliuojant" + +#: lazarusidestrconsts:dlgignoreverb +msgid "Ignore" +msgstr "Ignoruoti" + +#: lazarusidestrconsts:dlgbackcolor +msgid "Background" +msgstr "Fonas" + +#: lazarusidestrconsts:dlgsubpropkcolor +msgid "Subpropertes" +msgstr "Posavybės" + +#: lazarusidestrconsts:dlgreferencecolor +msgid "Reference" +msgstr "Paminėjimas" + +#: lazarusidestrconsts:dlgvaluecolor +msgid "Value" +msgstr "Reikšmė" + +#: lazarusidestrconsts:liswladd +msgid "&Add" +msgstr "Pri&dėti" + +#: lazarusidestrconsts:liswlproperties +msgid "&Properties" +msgstr "&Savybės" + +#: lazarusidestrconsts:liswlenabled +msgid "&Enabled" +msgstr "Į&galintas" + +#: lazarusidestrconsts:liswldelete +msgid "&Delete" +msgstr "&Pašalinti" + +#: lazarusidestrconsts:liswldisableall +msgid "D&isable All" +msgstr "Pasyv&inti visus" + +#: lazarusidestrconsts:liswlenableall +msgid "E&nable All" +msgstr "Įgali&nti visus" + +#: lazarusidestrconsts:liswldeleteall +msgid "De&lete All" +msgstr "Paša&linti visus" + +#: lazarusidestrconsts:dlgdefvaluecolor +msgid "Default value" +msgstr "Numatyta reikšmė" + +#: lazarusidestrconsts:dlgpropnamecolor +msgid "Property name" +msgstr "Savybės vardas" + +#: lazarusidestrconsts:dlgoimiscellaneous +msgid "Miscellaneous" +msgstr "Įvairūs" + +#: lazarusidestrconsts:dlgoiitemheight +msgid "Item height" +msgstr "Elemento aukštis" + +#: lazarusidestrconsts:lisshowhintsinobjectinspector +msgid "Show hints in Object Inspector" +msgstr "Rodyti informacinius langelius objektų inspektoriuje" + +#: lazarusidestrconsts:dlgenvcolors +msgid "Colors" +msgstr "Spalvos" + +#: lazarusidestrconsts:dlgenvbackuphelpnote +msgid "Notes: Project files are all files in the project directory" +msgstr "Pastaba: projekto failai - visi failai, esantys projekto kataloge" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename +msgid "Invalid compiler filename" +msgstr "Klaidingas kompiliatoriaus failas" + +#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg +msgid "The compiler file \"%s\" is not an executable." +msgstr "Kompiliatoriaus failas \"%s\" nėra paleidžiamasis." + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename +msgid "Invalid make filename" +msgstr "Klaidingas make failas" + +#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg +msgid "The make file \"%s\" is not an executable." +msgstr "Programos make failas \"%s\" nėra vykdomasis." + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename +msgid "Invalid debugger filename" +msgstr "Klaidingas derintuvės failas" + +#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg +msgid "The debugger file \"%s\" is not an executable." +msgstr "Derintuvės failas \"%s\" nėra paleidžiamasis." + +#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound +msgid "Directory not found" +msgstr "Katalogas nerastas" + +#: lazarusidestrconsts:lisinstallationfailed +msgid "Installation failed" +msgstr "Diegimas nepavyko" + +#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati +msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" +msgstr "Nepavyko kompiliuoti paketą %s%s%s .%sPašalinti jį iš diegimo sarašo?" + +#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg +msgid "Lazarus directory \"%s\" not found." +msgstr "Nerastas Lazarus katalogas \"%s\"." + +#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir +msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." +msgstr "Lazarus katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"lcl\", \"debugger\", \"designer\", \"components\", ... ." + +#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg +msgid "FPC source directory \"%s\" not found." +msgstr "Nerastas FPC pirminio kodo katalogas \"%s\"." + +#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir +msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." +msgstr "FPC pirminio kodo katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"rtl\", \"packages\", \"compiler\", ... ." + +#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg +msgid "Test directory \"%s\" not found." +msgstr "Nerastas testo katalogas \"%s\"." + +#: lazarusidestrconsts:dlgeddisplay +msgid "Display" +msgstr "Ekranas" + +#: lazarusidestrconsts:liseotabwidths +msgid "Tab widths" +msgstr "Tabuliatoriaus plotis" + +#: lazarusidestrconsts:dlgkeymapping +msgid "Key Mappings" +msgstr "Klavišų priskyrimai" + +#: lazarusidestrconsts:dlgedcolor +msgid "Color" +msgstr "Spalva" + +#: lazarusidestrconsts:dlgkeymappingerrors +msgid "Key mapping errors" +msgstr "Klavišų priskyrimų klaidos" + +#: lazarusidestrconsts:dlgedback +msgid "Back" +msgstr "Atgal" + +#: lazarusidestrconsts:dlgreport +msgid "Report" +msgstr "Ataskaita" + +#: lazarusidestrconsts:dlgednoerr +msgid "No errors in key mapping found." +msgstr "Klavišų priskyrimuose klaidų nerasta." + +#: lazarusidestrconsts:dlgdeltemplate +msgid "Delete template " +msgstr "Pašalinti šabloną" + +#: lazarusidestrconsts:dlgchscodetempl +msgid "Choose code template file (*.dci)" +msgstr "Rinkitės kodo šablono failą (*.dci)" + +#: lazarusidestrconsts:dlgallfiles +msgid "All files" +msgstr "Visi failai" + +#: lazarusidestrconsts:lissavefileas +msgid "Save file as" +msgstr "Išsaugoti failą kaip" + +#: lazarusidestrconsts:lisopenexistingfile +msgid "Open existing file" +msgstr "Atverti failą" + +#: lazarusidestrconsts:lislazarusunit +msgid "Lazarus unit" +msgstr "Lazarus modulis" + +#: lazarusidestrconsts:lislazarusinclude +msgid "Lazarus include file" +msgstr "Lazarus įdedamasis failas" + +#: lazarusidestrconsts:lislazarusproject +msgid "Lazarus project" +msgstr "Lazarus projektas" + +#: lazarusidestrconsts:lislazarusform +msgid "Lazarus form" +msgstr "Lazarus forma" + +#: lazarusidestrconsts:lislazaruspackage +msgid "Lazarus package" +msgstr "Lazarus paketas" + +#: lazarusidestrconsts:lislazarusprojectsource +msgid "Lazarus project source" +msgstr "Lazarus projekto pirminis kodas" + +#: lazarusidestrconsts:dlgaltsetclmode +msgid "Alt-Key sets column mode" +msgstr "Nuspaudus Alt klavišą - žymimi stulpeliai" + +#: lazarusidestrconsts:dlgalwaysvisiblecaret +msgid "Always visible caret" +msgstr "Žymeklis matomas nuolat" + +#: lazarusidestrconsts:dlgautoident +msgid "Auto indent" +msgstr "Automatinė įtrauka" + +#: lazarusidestrconsts:dlgbrachighlight +msgid "Bracket highlighting" +msgstr "Paryškinti porinius skliaustus" + +#: lazarusidestrconsts:dlgdragdroped +msgid "Drag Drop editing" +msgstr "Redaguojant tekstą galima nuvilkti" + +#: lazarusidestrconsts:dlgdropfiles +msgid "Drop files" +msgstr "Failus galima nuvilkti" + +#: lazarusidestrconsts:dlggroupundo +msgid "Group Undo" +msgstr "Grupinis grąžinimas" + +#: lazarusidestrconsts:dlghalfpagescroll +msgid "Half page scroll" +msgstr "Slikti tik per puse lapo" + +#: lazarusidestrconsts:dlgkeepcaretx +msgid "Keep caret X position" +msgstr "Išlaikyti žymeklio X poziciją" + +#: lazarusidestrconsts:dlgpersistentcaret +msgid "Persistent caret" +msgstr "Nuolatinis žymeklis" + +#: lazarusidestrconsts:dlgcaretskipsselection +msgid "Caret skips selection" +msgstr "Nuo žymėjimo atitrūkstantis žymeklis" + +#: lazarusidestrconsts:dlgrightmousemovescursor +msgid "Right mouse moves caret" +msgstr "Spragtelėjus dešinį pelės mygtuką perkeliamas žymeklis" + +#: lazarusidestrconsts:dlgscrollbyoneless +msgid "Scroll by one less" +msgstr "Slenkant per lapą slinkti viena eilute mažiau" + +#: lazarusidestrconsts:dlgscrollpastendfile +msgid "Scroll past end of file" +msgstr "Failo pabaiga nesustabdo slinkties" + +#: lazarusidestrconsts:dlgscrollpastendline +msgid "Scroll past end of line" +msgstr "Eilutės pabaiga nesustabdo slinkties" + +#: lazarusidestrconsts:dlgclosebuttonsnotebook +msgid "Show close buttons in notebook" +msgstr "Redaktoriaus kortelėse rodyti \"Užverti\" mygtukus" + +#: lazarusidestrconsts:dlgshowscrollhint +msgid "Show scroll hint" +msgstr "Slenkant rodyti informacinį langelį" + +#: lazarusidestrconsts:dlgmouselinks +msgid "Mouse links" +msgstr "Aktyvuoti saitą su Ctrl ir pele" + +#: lazarusidestrconsts:dlgshowgutterhints +msgid "Show gutter hints" +msgstr "Rodyti kairiosios paraštės informacinius langelius" + +#: lazarusidestrconsts:dlgsmarttabs +msgid "Smart tabs" +msgstr "Gudrus tabuliatorius" + +#: lazarusidestrconsts:dlgtabstospaces +msgid "Tabs to spaces" +msgstr "Vietoj tabuliatoriaus - tarpo simboliai" + +#: lazarusidestrconsts:dlgtabindent +msgid "Tab indents blocks" +msgstr "Tabuliatorius įtraukia blokus" + +#: lazarusidestrconsts:dlgtrimtrailingspaces +msgid "Trim trailing spaces" +msgstr "Eilučių galuose pašalinti tarpo simbolius" + +#: lazarusidestrconsts:dlgundoaftersave +msgid "Undo after save" +msgstr "Išsaugojus grąžinimas neišvalomas" + +#: lazarusidestrconsts:dlgdoubleclickline +msgid "Double click line" +msgstr "Spragtelėjus dukart pažymima visa eilutė" + +#: lazarusidestrconsts:dlgfindtextatcursor +msgid "Find text at cursor" +msgstr "Ieškoti ties žymekliu esančio teksto" + +#: lazarusidestrconsts:dlgusesyntaxhighlight +msgid "Use syntax highlight" +msgstr "Paryškinti sintaksę" + +#: lazarusidestrconsts:dlgusecodefolding +msgid "Code folding" +msgstr "Kodo suvėrimas" + +#: lazarusidestrconsts:dlgcopywordatcursoroncopynone +msgid "Copy word on copy none" +msgstr "Kai kopijuojant nieks nepažymėta- kopijuoti žodį" + +#: lazarusidestrconsts:dlghomekeyjumpstoneareststart +msgid "Home key jumps to nearest start" +msgstr "Spustelėjus \"Home\", žymeklis peršoks į artimiausią pradžią" + +#: lazarusidestrconsts:dlgblockindent +msgid "Block indent" +msgstr "Blokų įtrauka" + +#: lazarusidestrconsts:dlgundolimit +msgid "Undo limit" +msgstr "Grąžinimų riba" + +#: lazarusidestrconsts:dlgtabwidths +msgid "Tab widths" +msgstr "Tabuliatoriaus ilgis" + +#: lazarusidestrconsts:dlgmargingutter +msgid "Margin and gutter" +msgstr "Paraštės" + +#: lazarusidestrconsts:dlgvisiblerightmargin +msgid "Visible right margin" +msgstr "Dešinioji paraštė matoma" + +#: lazarusidestrconsts:dlgvisiblegutter +msgid "Visible gutter" +msgstr "Kairioji paraštė matoma" + +#: lazarusidestrconsts:dlgshowlinenumbers +msgid "Show line numbers" +msgstr "Rodyti eilučių numerius" + +#: lazarusidestrconsts:dlgshowcompilinglinenumbers +msgid "Show line numbers" +msgstr "Rodyti eilučių numerius" + +#: lazarusidestrconsts:dlgrightmargin +msgid "Right margin" +msgstr "Dešinioji paraštė" + +#: lazarusidestrconsts:dlgrightmargincolor +msgid "Right margin color" +msgstr "Dešiniosios paraštės spalva" + +#: lazarusidestrconsts:dlggutterwidth +msgid "Gutter width" +msgstr "Kairiosios paraštės plotis" + +#: lazarusidestrconsts:dlgguttercolor +msgid "Gutter color" +msgstr "Kairiosios paraštės spalva" + +#: lazarusidestrconsts:dlgeditorfont +msgid "Editor font" +msgstr "Redaktoriaus šriftas" + +#: lazarusidestrconsts:dlgdefaulteditorfont +msgid "Default editor font" +msgstr "Numatytas redaktoriaus šriftas" + +#: lazarusidestrconsts:dlgeditorfontheight +msgid "Editor font height" +msgstr "Redaktoriaus šrifto dydis" + +#: lazarusidestrconsts:dlgextralinespacing +msgid "Extra line spacing" +msgstr "Papildomas tarpas tarp eilučių" + +#: lazarusidestrconsts:dlgkeymappingscheme +msgid "Key Mapping Scheme" +msgstr "Klavišų priskyrimo schema" + +#: lazarusidestrconsts:dlgcheckconsistency +msgid "Check consistency" +msgstr "Tikrinti darną" + +#: lazarusidestrconsts:lisedoptschoosescheme +msgid "Choose Scheme" +msgstr "Rinkitės derinį" + +#: lazarusidestrconsts:dlgedhintcommand +msgid "Hint: click on the command you want to edit" +msgstr "Užuomina: spustelkite kairį pelės mygtuką ant komandos, kurią norite keisti" + +#: lazarusidestrconsts:dlglang +msgid "Language" +msgstr "Kalba" + +#: lazarusidestrconsts:dlgclrscheme +msgid "Color Scheme" +msgstr "Spalvų derinys" + +#: lazarusidestrconsts:dlgfileexts +msgid "File extensions" +msgstr "Failų prievardžiai" + +#: lazarusidestrconsts:dlgedelement +msgid "Element" +msgstr "Elementas" + +#: lazarusidestrconsts:dlgsetelementdefault +msgid "Set element to default" +msgstr "Priskirti numatytą reikšmę" + +#: lazarusidestrconsts:dlgsetallelementdefault +msgid "Set all elements to default" +msgstr "Visiems priskirti numatytą reikšmę" + +#: lazarusidestrconsts:dlgforecolor +msgid "Foreground color" +msgstr "Priekinė spalva" + +#: lazarusidestrconsts:dlgedusedefcolor +msgid "Use default color" +msgstr "Naudoti numatytą spalvą" + +#: lazarusidestrconsts:dlgtextattributes +msgid "Text attributes" +msgstr "Teksto atributai" + +#: lazarusidestrconsts:dlgedbold +msgid "Bold" +msgstr "Pusjuodis" + +#: lazarusidestrconsts:dlgedital +msgid "Italic" +msgstr "Kursyvas" + +#: lazarusidestrconsts:dlgedunder +msgid "Underline" +msgstr "Pabraukimas" + +#: lazarusidestrconsts:dlgedidcomlet +msgid "Identifier completion" +msgstr "Identifikatoriaus užbaigimas" + +#: lazarusidestrconsts:dlgedcodeparams +msgid "Code parameters" +msgstr "Kodo parametrai" + +#: lazarusidestrconsts:dlgtooltipeval +msgid "Tooltip expression evaluation" +msgstr "Reiškinio įverčio informacinis langelis" + +#: lazarusidestrconsts:dlgtooltiptools +msgid "Tooltip symbol Tools" +msgstr "Simbolio įrankių informacinis langelis" + +#: lazarusidestrconsts:dlgeddelay +msgid "Delay" +msgstr "Delsa" + +#: lazarusidestrconsts:dlgtimesecondunit +msgid "sec" +msgstr "s." + +#: lazarusidestrconsts:dlgedcodetempl +msgid "Code templates" +msgstr "Kodo šablonai" + +#: lazarusidestrconsts:dlgtplfname +msgid "Template file name" +msgstr "Šablono failo vardas" + +#: lazarusidestrconsts:dlgedadd +msgid "Add..." +msgstr "Pridėti..." + +#: lazarusidestrconsts:dlgededit +msgid "Edit..." +msgstr "Keisti..." + +#: lazarusidestrconsts:dlgeddelete +msgid "Delete" +msgstr "Pašalinti" + +#: lazarusidestrconsts:dlgindentcodeto +msgid "Indent code to" +msgstr "Įtraukti kodą pagal" + +#: lazarusidestrconsts:dlgcodetoolstab +msgid "Code Tools" +msgstr "Kodo pagalbininkai" + +#: lazarusidestrconsts:lisautomaticfeatures +msgid "Automatic features" +msgstr "Automatinės ypatybės" + +#: lazarusidestrconsts:dlgcfdividerdrawlevel +msgid "Divider Draw Level" +msgstr "Skirtuko rodymo lygis" + +#: lazarusidestrconsts:dlgcodetoolsopts +msgid "CodeTools Options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:dlgcodecreation +msgid "Code Creation" +msgstr "Kodo kūrimas" + +#: lazarusidestrconsts:dlgwordspolicies +msgid "Words" +msgstr "Žodžiai" + +#: lazarusidestrconsts:dlglinesplitting +msgid "Line Splitting" +msgstr "Eilučių laužymas" + +#: lazarusidestrconsts:dlgspacenotcosmos +msgid "Space" +msgstr "Tarpo simbolis" + +#: lazarusidestrconsts:dlgidentifiercompletion +msgid "Identifier completion" +msgstr "Identifikatoriaus užbaigimas" + +#: lazarusidestrconsts:dlgadditionalsrcpath +msgid "Additional Source search path for all projects (.pp;.pas)" +msgstr "Papildomi visų projektų keliai iki pirminio kodo" + +#: lazarusidestrconsts:dlgjumpingetc +msgid "Jumping (e.g. Method Jumping)" +msgstr "Šokinėjimas (pvz. tarp metodų)" + +#: lazarusidestrconsts:dlgadjusttopline +msgid "Adjust top line due to comment in front" +msgstr "Turi matytis ir komentaras" + +#: lazarusidestrconsts:dlgcentercursorline +msgid "Center Cursor Line" +msgstr "Žymeklis ekrano centre" + +#: lazarusidestrconsts:dlgcursorbeyondeol +msgid "Cursor beyond EOL" +msgstr "Žymeklis peržengia EOL" + +#: lazarusidestrconsts:dlgclassinsertpolicy +msgid "Class part insert policy" +msgstr "Klasės dalies įterpimo politika" + +#: lazarusidestrconsts:dlgalphabetically +msgid "Alphabetically" +msgstr "Pagal abėcėlę" + +#: lazarusidestrconsts:dlgcdtlast +msgid "Last" +msgstr "Gale" + +#: lazarusidestrconsts:dlgmixmethodsandproperties +msgid "Mix methods and properties" +msgstr "Maišyti metodus su savybėm" + +#: lazarusidestrconsts:dlgforwardprocsinsertpolicy +msgid "Procedure insert policy" +msgstr "Procedūros įterpimo politika" + +#: lazarusidestrconsts:dlglast +msgid "Last (i.e. at end of source)" +msgstr "Pačiame gale" + +#: lazarusidestrconsts:dlginfrontofmethods +msgid "In front of methods" +msgstr "Priešais metodus" + +#: lazarusidestrconsts:dlgbehindmethods +msgid "Behind methods" +msgstr "Po metodų" + +#: lazarusidestrconsts:dlgforwardprocskeeporder +msgid "Keep order of procedures" +msgstr "Išlaikyti procedūrų eilę" + +#: lazarusidestrconsts:dlgmethodinspolicy +msgid "Method insert policy" +msgstr "Metodo įterpimo policija" + +#: lazarusidestrconsts:dlgcdtclassorder +msgid "Class order" +msgstr "Klasės eilė" + +#: lazarusidestrconsts:dlgkeywordpolicy +msgid "Keyword policy" +msgstr "Raktažodžio politika" + +#: lazarusidestrconsts:dlgcdtlower +msgid "lowercase" +msgstr "Mažosiomis raidėmis" + +#: lazarusidestrconsts:dlgcdtuppercase +msgid "UPPERCASE" +msgstr "Didžiosiomis raidėmis" + +#: lazarusidestrconsts:dlg1up2low +msgid "Lowercase, first letter up" +msgstr "Mažosiomis raidėmis, pirmoji - didžioji" + +#: lazarusidestrconsts:dlgidentifierpolicy +msgid "Identifier policy" +msgstr "Identifikatoriaus politika" + +#: lazarusidestrconsts:dlgpropertycompletion +msgid "Property completion" +msgstr "\"Property\" užbaigimas" + +#: lazarusidestrconsts:lisheadercommentforclass +msgid "Header comment for class" +msgstr "Antraštinis komentaras klasei" + +#: lazarusidestrconsts:dlgcompleteproperties +msgid "Complete properties" +msgstr "Užbaigti savybes" + +#: lazarusidestrconsts:dlgcdtreadprefix +msgid "Read prefix" +msgstr "\"Read\" prefiksas" + +#: lazarusidestrconsts:dlgcdtwriteprefix +msgid "Write prefix" +msgstr "\"Write\" prefiksas" + +#: lazarusidestrconsts:dlgcdtstoredpostfix +msgid "Stored postfix" +msgstr "\"Stored\" postfiksas" + +#: lazarusidestrconsts:dlgcdtvariableprefix +msgid "Variable prefix" +msgstr "Kintamojo prefiksas" + +#: lazarusidestrconsts:dlgsetpropertyvariable +msgid "Set property Variable" +msgstr "\"Set\" kintamojo vardas" + +#: lazarusidestrconsts:dlgmaxlinelength +msgid "Max line length:" +msgstr "Maksimalus eilutės ilgis:" + +#: lazarusidestrconsts:dlgnotsplitlinefront +msgid "Do not split line In front of:" +msgstr "Nelaužti eilutės priešais:" + +#: lazarusidestrconsts:dlgnotsplitlineafter +msgid "Do not split line after:" +msgstr "Nelaužti eilutės po:" + +#: lazarusidestrconsts:dlgcdtpreview +msgid "Preview (Max line length = 1)" +msgstr "Peržiūra (maksimalus eilutės ilgis - 1)" + +#: lazarusidestrconsts:dlginsspacefront +msgid "Insert space in front of" +msgstr "Įterpti tarpą priešais" + +#: lazarusidestrconsts:dlginsspaceafter +msgid "Insert space after" +msgstr "Iterpti tarpą po" + +#: lazarusidestrconsts:dlgwrdpreview +msgid "Preview" +msgstr "Peržiūra" + +#: lazarusidestrconsts:dlgaddsemicolon +msgid "Add semicolon" +msgstr "Pridėti kabliataškį" + +#: lazarusidestrconsts:locwndsrceditor +msgid "Lazarus Source Editor" +msgstr "Lazarus pirminio kodo redaktorius" + +#: lazarusidestrconsts:dlgcompileroptions +msgid "Compiler Options" +msgstr "Kompiliatoriaus parinktys" + +#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented +msgid "Online Help not yet implemented" +msgstr "Kontekstinis žinynas dar neįgyvendintas" + +#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav +msgid "Right click on the items tree to get the popupmenu with all available package functions." +msgstr "Spustelėje dešinį pelės mygtuką ant medžio elemento iššoks meniu su visomis galimomis paketo funkcijomis." + +#: lazarusidestrconsts:dlgsearchpaths +msgid "Paths" +msgstr "Keliai" + +#: lazarusidestrconsts:dlgcoparsing +msgid "Parsing" +msgstr "Analizė" + +#: lazarusidestrconsts:dlgcodegeneration +msgid "Code" +msgstr "Kodas" + +#: lazarusidestrconsts:dlgcolinking +msgid "Linking" +msgstr "Saistymas" + +#: lazarusidestrconsts:dlgcomessages +msgid "Messages" +msgstr "Pranešimai" + +#: lazarusidestrconsts:dlgcoother +msgid "Other" +msgstr "Kiti" + +#: lazarusidestrconsts:dlgcoinherited +msgid "Inherited" +msgstr "Paveldėta" + +#: lazarusidestrconsts:dlgcocompilation +msgid "Compilation" +msgstr "Kompiliacija" + +#: lazarusidestrconsts:lisbrowseforcompiler +msgid "Browse for Compiler (%s)" +msgstr "Nurodyti kompiliatorių (%s)" + +#: lazarusidestrconsts:lisunitoutputdirectory +msgid "Unit Output directory" +msgstr "Modulio išvesties katalogas" + +#: lazarusidestrconsts:lisselectanode +msgid "Select a node" +msgstr "Pažymėkit mazgą" + +#: lazarusidestrconsts:dlgshowcompileroptions +msgid "Show compiler options" +msgstr "Rodyti kompiliatoriaus parinktis" + +#: lazarusidestrconsts:dlgcoopts +msgid "Options: " +msgstr "Parinktys: " + +#: lazarusidestrconsts:dlgcostyle +msgid "Style:" +msgstr "Stilius:" + +#: lazarusidestrconsts:lisnocompileroptionsinherited +msgid "No compiler options inherited." +msgstr "Nėra paveldėtų kompiliatoriaus parinkčių." + +#: lazarusidestrconsts:lisunitpath +msgid "unit path" +msgstr "kelias iki modulio" + +#: lazarusidestrconsts:lisincludepath +msgid "include path" +msgstr "kelias iki įterpinių" + +#: lazarusidestrconsts:lisobjectpath +msgid "object path" +msgstr "kelias iki objekto" + +#: lazarusidestrconsts:lislibrarypath +msgid "library path" +msgstr "kelias iki bibliotekos" + +#: lazarusidestrconsts:lislinkeroptions +msgid "linker options" +msgstr "saistyklės parinktys" + +#: lazarusidestrconsts:liscustomoptions +msgid "custom options" +msgstr "naudotojo parinktys" + +#: lazarusidestrconsts:dlgcoasis +msgid "As-Is" +msgstr "Kaip yra" + +#: lazarusidestrconsts:dlgsyntaxoptions +msgid "Syntax options" +msgstr "Sintaksės parinktys" + +#: lazarusidestrconsts:dlgdelphi2ext +msgid "Delphi 2 Extensions" +msgstr "Delphi 2 plėtiniai" + +#: lazarusidestrconsts:dlgcocops +msgid "C Style Operators (*=, +=, /= and -=)" +msgstr "C stiliaus operatoriai (*=, +=, /= bei -=)" + +#: lazarusidestrconsts:dlgassertcode +msgid "Include Assertion Code" +msgstr "Įterpti \"Assertion\" kodą" + +#: lazarusidestrconsts:dlglabelgoto +msgid "Allow LABEL and GOTO" +msgstr "Galimi LABEL ir GOTO" + +#: lazarusidestrconsts:dlgcppinline +msgid "C++ Styled INLINE" +msgstr "C stiliaus INLINE" + +#: lazarusidestrconsts:dlgcmacro +msgid "C Style Macros (global)" +msgstr "C stiliaus makrokomandos (globaliai)" + +#: lazarusidestrconsts:dlgbp7cptb +msgid "TP/BP 7.0 Compatible" +msgstr "Suderinamumas su TP/BP 7.0" + +#: lazarusidestrconsts:dlginitdoneonly +msgid "Constructor name must be 'init' (destructor must be 'done')" +msgstr "Konstruktoriaus vardas turi būti \"init\" (destruktoriaus - \"done\")" + +#: lazarusidestrconsts:dlgstatickeyword +msgid "Static Keyword in Objects" +msgstr "Objektuose statiniai raktažodžiai" + +#: lazarusidestrconsts:dlgdeplhicomp +msgid "Delphi Compatible" +msgstr "Suderinamumas su Delphi" + +#: lazarusidestrconsts:dlgcoansistr +msgid "Use Ansi Strings" +msgstr "Naudoti ANSI eilutes" + +#: lazarusidestrconsts:dlggpccomp +msgid "GPC (GNU Pascal Compiler) Compatible" +msgstr "Suderinamumas su GPC (GNU Pascal Compiler)" + +#: lazarusidestrconsts:dlgcounitstyle +msgid "Unit Style:" +msgstr "Modulio stilius:" + +#: lazarusidestrconsts:dlgcosmartlinkable +msgid "Smart Linkable" +msgstr "Saistoma sumaniai" + +#: lazarusidestrconsts:dlgcochecks +msgid "Checks:" +msgstr "Tikrinti:" + +#: lazarusidestrconsts:dlgcorange +msgid "Range" +msgstr "Rėžį" + +#: lazarusidestrconsts:dlgcooverflow +msgid "Overflow" +msgstr "Perpildymą" + +#: lazarusidestrconsts:dlgcostack +msgid "Stack" +msgstr "Dėklą" + +#: lazarusidestrconsts:dlgheapsize +msgid "Heap Size" +msgstr "Krūvos dydį" + +#: lazarusidestrconsts:dlgcogenerate +msgid "Generate:" +msgstr "Generuoti:" + +#: lazarusidestrconsts:dlgconormal +msgid "Normal Code" +msgstr "Normalų kodą" + +#: lazarusidestrconsts:dlgcofast +msgid "Faster Code" +msgstr "Greitesnį kodą" + +#: lazarusidestrconsts:dlgcosmaller +msgid "Smaller Code" +msgstr "Mažesnį kodą" + +#: lazarusidestrconsts:dlgtargetproc +msgid "Target i386" +msgstr "Paskirtis i386" + +#: lazarusidestrconsts:dlgtargetplatform +msgid "Target Platform:" +msgstr "Paskirties platforma:" + +#: lazarusidestrconsts:dlgoptimiz +msgid "Optimizations:" +msgstr "Optimizacija:" + +#: lazarusidestrconsts:dlgcokeepvarsreg +msgid "Keep certain variables in registers" +msgstr "Registre laikyti dažniausiai naudojamus kintamuosius" + +#: lazarusidestrconsts:dlguncertopt +msgid "Uncertain Optimizations" +msgstr "Neužtikrinta optimizacija" + +#: lazarusidestrconsts:dlglevelnoneopt +msgid "Level 0 (no extra Optimizations)" +msgstr "0 lygis (optimizacijos nėra)" + +#: lazarusidestrconsts:dlglevel1opt +msgid "Level 1 (quick and debugger friendly)" +msgstr "1 lygis (įprastų instrukcijų sekos keičiamos greitesniais ekvivalentais)" + +#: lazarusidestrconsts:dlglevel2opt +msgid "Level 2 (Level 1 + quick optimizations)" +msgstr "2 lygis (1 lygis + registro duomenų bereikalingų pakartotinų įkėlimų eliminavimas)" + +#: lazarusidestrconsts:dlglevel3opt +msgid "Level 3 (Level 2 + slow optimizations)" +msgstr "3 lygis (2 lygis +kitos laiką ryjančios optimizacijos)" + +#: lazarusidestrconsts:dlgtargetos +msgid "Target OS" +msgstr "Paskirties OS" + +#: lazarusidestrconsts:dlgtargetcpu +msgid "Target CPU" +msgstr "Paskirties procesorius:" + +#: lazarusidestrconsts:dlgcodebugging +msgid "Debugging:" +msgstr "Derinimas:" + +#: lazarusidestrconsts:dlgcogdb +msgid "Generate Debugging Info For GDB (Slows Compiling)" +msgstr "Kurti \"GDB\" skirtą derinimo informaciją (sulėtins kompiliavimą)" + +#: lazarusidestrconsts:dlgcodbx +msgid "Generate Debugging Info For DBX (Slows Compiling)" +msgstr "Kurti \"DBX\" skirtą derinimo informaciją (sulėtins kompiliavimą)" + +#: lazarusidestrconsts:dlglnumsbct +msgid "Display Line Numbers in Run-time Error Backtraces" +msgstr "Rodyti eilučių numerius veikos metu įvykusių klaidų pėdsako pranešimuose" + +#: lazarusidestrconsts:dlgcoheaptrc +msgid "Use Heaptrc Unit" +msgstr "Naudoti \"Heaptrc\" modulį" + +#: lazarusidestrconsts:dlgcovalgrind +msgid "Generate code for valgrind" +msgstr "Kurti \"valgrind\" skirtą kodą" + +#: lazarusidestrconsts:dlggprof +msgid "Generate code for gprof" +msgstr "Kurti \"gprof\" skirtą kodą" + +#: lazarusidestrconsts:dlgcostrip +msgid "Strip Symbols From Executable" +msgstr "Pašalinti simbolius iš vykdomojo failo" + +#: lazarusidestrconsts:dlglinklibraries +msgid "Link Style:" +msgstr "Saistymo stilius:" + +#: lazarusidestrconsts:dlglinksmart +msgid "Link Smart" +msgstr "Saistyti sumaniai" + +#: lazarusidestrconsts:dlgpassoptslinker +msgid "Pass Options To The Linker (Delimiter is space)" +msgstr "Perduoti parinktis saistyklei (atskirta kabliataškiais)" + +#: lazarusidestrconsts:liscotargetosspecificoptions +msgid "Target OS specific options" +msgstr "Paskirties OS specifinės parinktys" + +#: lazarusidestrconsts:dlgverbosity +msgid "Verbosity during compilation:" +msgstr "Pranešimų gausa kompiliuojant:" + +#: lazarusidestrconsts:dlgcoshowerr +msgid "Show Errors" +msgstr "Rodyti klaidas" + +#: lazarusidestrconsts:dlgshowwarnings +msgid "Show Warnings" +msgstr "Rodyti perspėjimus" + +#: lazarusidestrconsts:dlgshownotes +msgid "Show Notes" +msgstr "Rodyti pastabas" + +#: lazarusidestrconsts:dlgshowhint +msgid "Show Hints" +msgstr "Rodyti užuominas" + +#: lazarusidestrconsts:dlgshowgeneralinfo +msgid "Show general info" +msgstr "Rodyti pagrindinę informaciją" + +#: lazarusidestrconsts:dlgshowprocserror +msgid "Show all procs on error" +msgstr "Įvykus klaidai rodyti visus procedūrų paskelbimus" + +#: lazarusidestrconsts:dlgshoweverything +msgid "Show everything" +msgstr "Rodyti viską" + +#: lazarusidestrconsts:dlgshowsummary +msgid "Show summary" +msgstr "Rodyti apibendrinimą" + +#: lazarusidestrconsts:dlgshowdebuginfo +msgid "Show debug info" +msgstr "Rodyti derinimo informaciją" + +#: lazarusidestrconsts:dlgshowusedfiles +msgid "Show used files" +msgstr "Rodyti naudojamus failus" + +#: lazarusidestrconsts:dlgshowtriedfiles +msgid "Show tried files" +msgstr "Rodyti apibrėžtas makrokomandas" + +#: lazarusidestrconsts:dlgshowdefinedmacros +msgid "Show defined macros" +msgstr "Rodyti " + +#: lazarusidestrconsts:dlgshowcompiledprocedures +msgid "Show compiled procedures" +msgstr "Rodyti kompiliuotas procedūras" + +#: lazarusidestrconsts:dlgshowconditionals +msgid "Show conditionals" +msgstr "Rodyti sąlygines instrukcijas" + +#: lazarusidestrconsts:dlgshowexecutableinfo +msgid "Show executable info (Win32 only)" +msgstr "Rodyti vykdomosios bylos informaciją (tik Win32)" + +#: lazarusidestrconsts:dlgshownothing +msgid "Show nothing (only errors)" +msgstr "Slėpti viską (išskyrus klaidas)" + +#: lazarusidestrconsts:dlgwritefpclogo +msgid "Write an FPC logo" +msgstr "Įrašyti FPC logotipą" + +#: lazarusidestrconsts:dlghintsunused +msgid "Show Hints for unused units in main source" +msgstr "Rodyti užuominas apie pagrindiniame pirminiame kode nenaudojamus modulius" + +#: lazarusidestrconsts:dlghintsparametersendernotused +msgid "Show Hints for parameter \"Sender\" not used" +msgstr "Rodyti užuominas apie nenaudojamus \"Sender\" parametrus" + +#: lazarusidestrconsts:dlgconfigfiles +msgid "Config Files:" +msgstr "Nustatymų failai:" + +#: lazarusidestrconsts:dlgusefpccfg +msgid "Use standard Compiler Config File (fpc.cfg)" +msgstr "Naudoti standartinį kompiliatoriaus nustatymų failą (fpc.cfg)" + +#: lazarusidestrconsts:dlgusecustomconfig +msgid "Use addional Compiler Config File" +msgstr "Naudoti papildomą kompiliatoriaus nustatymų failą" + +#: lazarusidestrconsts:liscustomoptions2 +msgid "Custom options" +msgstr "Naudotojo parinktys" + +#: lazarusidestrconsts:dlgstopafternrerr +msgid "Stop after number of errors:" +msgstr "Po kelių klaidų sustoti:" + +#: lazarusidestrconsts:dlgotherunitfiles +msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" +msgstr "Kitų modulių failai (-Fu) (atskirti kabliataškiais)" + +#: lazarusidestrconsts:dlgcoincfiles +msgid "Include Files (-Fi):" +msgstr "Įterpiami failai (-Fi):" + +#: lazarusidestrconsts:dlgcosources +msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" +msgstr "Kiti pirminiai kodai (.pp/.pas failai, skirta tik IKA, ne kompiliatoriui)" + +#: lazarusidestrconsts:dlgcolibraries +msgid "Libraries (-Fl):" +msgstr "Bibliotekos (-Fl):" + +#: lazarusidestrconsts:dlgcodebugpath +msgid "Debugger path addition (none):" +msgstr "Papildomas kelias iki derintuvės (joks):" + +#: lazarusidestrconsts:liscompiler +msgid "Compiler" +msgstr "Kompiliatorius" + +#: lazarusidestrconsts:listofpcpath +msgid "Path:" +msgstr "Failas:" + +#: lazarusidestrconsts:liscoskipcallingcompiler +msgid "Skip calling Compiler" +msgstr "Nešaukti kompiliatoriaus" + +#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile +msgid "Ambiguous additional compiler config file" +msgstr "Neaiškus papildomas kompiliatoriaus nustatymų failas" + +#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena +msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." +msgstr "Perspėjimas: papildomo kompiliatoriaus nustatymų failo vardas yra toks pat kaip ir FreePascal ieškomo standartinio nustatymų failo. Dėl to, praleidžiant standartinį nustatymų failą, bus analizuojamas TIK papildomas nustatymų failas." + +#: lazarusidestrconsts:liscoclickokifaresuretodothat +msgid "%s%sClick OK if you are sure to do that." +msgstr "%s%sJei esate tikras kad to reikia, spustelkit \"Tinka\"." + +#: lazarusidestrconsts:liscocallon +msgid "Call on:" +msgstr "Iššaukti kai:" + +#: lazarusidestrconsts:liscocalloncompile +msgid "Compile" +msgstr "Kompiliuojama" + +#: lazarusidestrconsts:liscocallonbuild +msgid "Build" +msgstr "Daroma" + +#: lazarusidestrconsts:liscocallonrun +msgid "Run" +msgstr "Startuojama" + +#: lazarusidestrconsts:liscoexecuteafter +msgid "Execute after" +msgstr "Startuoti po" + +#: lazarusidestrconsts:liscoexecutebefore +msgid "Execute before" +msgstr "Startuoti prieš" + +#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages +msgid "Additional compiler options inherited from packages" +msgstr "Papildomi iš paketų paveldėtos kompiliatoriaus parinktys" + +#: lazarusidestrconsts:liscocommand +msgid "Command:" +msgstr "Komanda:" + +#: lazarusidestrconsts:liscoscanforfpcmessages +msgid "Scan for FPC messages" +msgstr "Ieškoti FPC pranešimų" + +#: lazarusidestrconsts:liscoscanformakemessages +msgid "Scan for Make messages" +msgstr "Ieškoti Make pranešimų" + +#: lazarusidestrconsts:liscoshowallmessages +msgid "Show all messages" +msgstr "Rodyti visus pranešimus" + +#: lazarusidestrconsts:dlgunitoutp +msgid "Unit output directory (-FU):" +msgstr "Modulio išvesties katalogas (-FU):" + +#: lazarusidestrconsts:liscodefault +msgid "default (%s)" +msgstr "numatytas (%s)" + +#: lazarusidestrconsts:dlgbutapply +msgid "Apply" +msgstr "Pritaikyti" + +#: lazarusidestrconsts:dlgcoshowoptions +msgid "Show Options" +msgstr "Rodyti parinktis" + +#: lazarusidestrconsts:dlgcoloadsave +msgid "Load/Save" +msgstr "Įkelti/išsaugoti" + +#: lazarusidestrconsts:dlgmainviewforms +msgid "View project forms" +msgstr "Rodyti projekto formas" + +#: lazarusidestrconsts:dlgmainviewunits +msgid "View project units" +msgstr "Rodyti projekto modulius" + +#: lazarusidestrconsts:dlgmultiselect +msgid "Multi Select" +msgstr "Pažymėti kelis" + +#: lazarusidestrconsts:dlgprojectoptions +msgid "Project Options" +msgstr "Projekto parinktys" + +#: lazarusidestrconsts:dlgpoapplication +msgid "Application" +msgstr "Taikomoji programa" + +#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra +msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." +msgstr "Taikomoji programa%sVizualinė LCL/FreePascal programa. Programos failu automatiškai rūpinsis Lazarus." + +#: lazarusidestrconsts:dlgpofroms +msgid "Forms" +msgstr "Formos" + +#: lazarusidestrconsts:dlgpomisc +msgid "Miscellaneous" +msgstr "Įvairūs" + +#: lazarusidestrconsts:dlgposavesession +msgid "Session" +msgstr "Sesija" + +#: lazarusidestrconsts:dlgapplicationsettings +msgid "Application Settings" +msgstr "Programos nuostatos" + +#: lazarusidestrconsts:dlgpotitle +msgid "Title:" +msgstr "Antraštė:" + +#: lazarusidestrconsts:dlgpooutputsettings +msgid "Output Settings" +msgstr "Išvesties nuostatos" + +#: lazarusidestrconsts:dlgpotargetfilename +msgid "Target file name:" +msgstr "Būsimo failo vardas:" + +#: lazarusidestrconsts:dlgpouseappbundle +msgid "Use Application Bundle for running and debugging (darwin only)" +msgstr "Startui ir derinimui naudoti programą-rišulį (tik dėl Darwin)" + +#: lazarusidestrconsts:dlgpousemanifest +msgid "Use manifest file to enable themes (windows only)" +msgstr "Naudoti manifest failą temų įgalinimui (tik dėl Windows)" + +#: lazarusidestrconsts:dlgautocreateforms +msgid "Auto-create forms:" +msgstr "Automatiškai kuriamos formos:" + +#: lazarusidestrconsts:dlgavailableforms +msgid "Available forms:" +msgstr "Esamos formos:" + +#: lazarusidestrconsts:dlgautocreatenewforms +msgid "When creating new forms, add them to auto-created forms" +msgstr "Kuriant nauja formą, ją įdėti į automatiškai kuriamų formų sąrašą" + +#: lazarusidestrconsts:dlgsaveeditorinfo +msgid "Save editor info for closed files" +msgstr "Išsaugoti redaktoriaus informaciją apie užvertus failus" + +#: lazarusidestrconsts:dlgsaveeditorinfoproject +msgid "Save editor info only for project files" +msgstr "Išsaugoti redaktoriaus informaciją tik apie projekto failus" + +#: lazarusidestrconsts:lismainunitispascalsource +msgid "Main Unit is Pascal Source" +msgstr "Pagrindinis modulis yra Paskalio pirminis kodas" + +#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject +msgid "Main Unit has Uses Section containing all Units of project" +msgstr "Pagrindiniame modulyje yra sekcija \"Uses\", kurioje paminėti visi projekto moduliai" + +#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements +msgid "Main Unit has Application.CreateForm statements" +msgstr "Pagrindiniame modulyje yra sakinių \"Application.CreateForm\"" + +#: lazarusidestrconsts:lismainunithasapplicationtitlestatements +msgid "Main Unit has Application.Title statements" +msgstr "Pagrindiniame modulyje yra sakinių \"Application.Title\"" + +#: lazarusidestrconsts:lisprojectisrunnable +msgid "Project is runnable" +msgstr "Projektas yra vykdomasis" + +#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged +msgid "Always build (even if nothing changed)" +msgstr "Visada daryti (net jei nėra pakeitimų)" + +#: lazarusidestrconsts:dlgrunparameters +msgid "Run parameters" +msgstr "Starto parametrai" + +#: lazarusidestrconsts:dlgrunolocal +msgid "Local" +msgstr "Vietiniai" + +#: lazarusidestrconsts:dlgrunoenvironment +msgid "Environment" +msgstr "Aplinka" + +#: lazarusidestrconsts:dlghostapplication +msgid "Host application" +msgstr "Programa-šeimininkė" + +#: lazarusidestrconsts:dlgcommandlineparams +msgid "Command line parameters (without application name)" +msgstr "Komandinės eilutės parametrai (be programos vardo)" + +#: lazarusidestrconsts:dlguselaunchingapp +msgid "Use launching application" +msgstr "Naudoti paleidžiančiąją programą" + +#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox +msgid "Launching application" +msgstr "Paleidžiančioji programa" + +#: lazarusidestrconsts:dlgroworkingdirectory +msgid "Working directory" +msgstr "Darbinis katalogas" + +#: lazarusidestrconsts:dlgrunodisplay +msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" +msgstr "Ekranas (neskirta win32; pvz.: 198.112.45.11:0, x.org:1, hydra:0.1)" + +#: lazarusidestrconsts:dlgrunousedisplay +msgid "Use display" +msgstr "Dirbti ekrane" + +#: lazarusidestrconsts:dlgrunosystemvariables +msgid "System variables" +msgstr "Sistemos kintamieji" + +#: lazarusidestrconsts:dlgrunovariable +msgid "Variable" +msgstr "Kintamasis" + +#: lazarusidestrconsts:dlgrunovalue +msgid "Value" +msgstr "Reikšmė" + +#: lazarusidestrconsts:dlgrunouseroverrides +msgid "User overrides" +msgstr "Naudotojo pakeitimai" + +#: lazarusidestrconsts:dlgincludesystemvariables +msgid "Include system variables" +msgstr "Pridėti sistemos kintamuosius" + +#: lazarusidestrconsts:dlgdirectorydoesnotexist +msgid "Directory does not exist" +msgstr "Katalogas nerastas" + +#: lazarusidestrconsts:lisrunparamsfilenotexecutable +msgid "File not executable" +msgstr "Failas nėra vykdomasis" + +#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable +msgid "The host application %s%s%s is not executable." +msgstr "Programa-šeimininkas %s%s%s nėra vykdomasis failas." + +#: lazarusidestrconsts:dlgthedirectory +msgid "The directory \"" +msgstr "Katalogas \"" + +#: lazarusidestrconsts:dlgdoesnotexist +msgid "\" does not exist." +msgstr "\" neegzistuoja" + +#: lazarusidestrconsts:dlgtexttofing +msgid "&Text to Find" +msgstr "Ieškomasis &tekstas" + +#: lazarusidestrconsts:dlgreplacewith +msgid "&Replace With" +msgstr "&Pakeisti šiuo" + +#: lazarusidestrconsts:dlgfropts +msgid "Options" +msgstr "Parinktys" + +#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor +msgid "When this file is active in source editor ..." +msgstr "Kai šis failas pirminio kodo redaktoriuje aktyvus..." + +#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead +msgid "On build project execute the Build File command instead" +msgstr "Darant projektą, ištikro vykdyti komandą \"Kurti failą\"" + +#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead +msgid "On run project execute the Run File command instead" +msgstr "Startuojant projektą, ištikro vykdyti komandą \"Startuoti failą\"" + +#: lazarusidestrconsts:liscefilter +msgid "(Filter)" +msgstr "(Filtras)" + +#: lazarusidestrconsts:dlgcasesensitive +msgid "Case Sensitive" +msgstr "Paisyti raidžių lygio" + +#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda +msgid "Distinguish big and small letters e.g. A and a" +msgstr "Ieškant skirti didžiąsias ir mažąsias raides" + +#: lazarusidestrconsts:dlgwholewordsonly +msgid "Whole Words Only" +msgstr "Tik ištisų žodžių" + +#: lazarusidestrconsts:lisonlysearchforwholewords +msgid "Only search for whole words" +msgstr "Ieškoti tik ištisų žodžių" + +#: lazarusidestrconsts:dlgregularexpressions +msgid "Regular Expressions" +msgstr "Reguliarusis reiškinys" + +#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme +msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" +msgstr "Teksto paieškai ir pakeitimui galima naudoti reguliariojo reiškinio sintaksę (labai panašiai kaip ir Perl)" + +#: lazarusidestrconsts:dlgmultiline +msgid "Multiline" +msgstr "Kelios eilutės" + +#: lazarusidestrconsts:lisallowsearchingformultiplelines +msgid "Allow searching for multiple lines" +msgstr "Ar galima keleto eilučių paieška" + +#: lazarusidestrconsts:dlgpromptonreplace +msgid "Prompt On Replace" +msgstr "Reikalauti patvirtinimo" + +#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext +msgid "Ask before replacing each found text" +msgstr "Klausti patvirtinimo kiekvienąkart prieš pakeičiant rastą tekstą" + +#: lazarusidestrconsts:dlgsrorigin +msgid "Origin" +msgstr "Pradžia" + +#: lazarusidestrconsts:dlgfromcursor +msgid "From Cursor" +msgstr "Nuo žymeklio" + +#: lazarusidestrconsts:dlgentirescope +msgid "Entire Scope" +msgstr "Visoje srityje" + +#: lazarusidestrconsts:dlgscope +msgid "Scope" +msgstr "Sritis" + +#: lazarusidestrconsts:liswithrequiredpackages +msgid "With required packages" +msgstr "Su reikiamais paketais" + +#: lazarusidestrconsts:lislevels +msgid "Levels" +msgstr "Lygiai" + +#: lazarusidestrconsts:lisshowpackages +msgid "Show packages" +msgstr "Rodyti paketus" + +#: lazarusidestrconsts:lisshowunits +msgid "Show units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:lisshowidentifiers +msgid "Show identifiers" +msgstr "Rodyti identifikatorius" + +#: lazarusidestrconsts:lisfilter +msgid "Filter" +msgstr "Filtras" + +#: lazarusidestrconsts:lisprivate +msgid "Private" +msgstr "Private" + +#: lazarusidestrconsts:lisprotected +msgid "Protected" +msgstr "Protected" + +#: lazarusidestrconsts:lisexpandallpackages +msgid "Expand all packages" +msgstr "Išsklaeisti visus paketus" + +#: lazarusidestrconsts:liscollapseallpackages +msgid "Collapse all packages" +msgstr "Suskleisti visus paketus" + +#: lazarusidestrconsts:lisexpandallunits +msgid "Expand all units" +msgstr "Išskleiti visus modulius" + +#: lazarusidestrconsts:liscollapseallunits +msgid "Collapse all units" +msgstr "Suskleisti visus modulius" + +#: lazarusidestrconsts:lisexpandallclasses +msgid "Expand all classes" +msgstr "Išskleisti visas klases" + +#: lazarusidestrconsts:liscollapseallclasses +msgid "Collapse all classes" +msgstr "Suskleisti visas klases" + +#: lazarusidestrconsts:lisexport +msgid "Export ..." +msgstr "Eksportas..." + +#: lazarusidestrconsts:lisbegins +msgid "begins" +msgstr "prasideda" + +#: lazarusidestrconsts:lisidentifierbeginswith +msgid "Identifier begins with ..." +msgstr "Identifikatorius prasideda..." + +#: lazarusidestrconsts:lisunitnamebeginswith +msgid "Unit name begins with ..." +msgstr "Modulio vardas prasideda..." + +#: lazarusidestrconsts:lispackagenamebeginswith +msgid "Package name begins with ..." +msgstr "Paketo vardas prasideda..." + +#: lazarusidestrconsts:liscontains +msgid "contains" +msgstr "yra" + +#: lazarusidestrconsts:lisidentifiercontains +msgid "Identifier contains ..." +msgstr "Identifikatoriuje yra..." + +#: lazarusidestrconsts:lisunitnamecontains +msgid "Unit name contains ..." +msgstr "Modulio varde yra..." + +#: lazarusidestrconsts:lispackagenamecontains +msgid "Package name contains ..." +msgstr "Paketo varde yra..." + +#: lazarusidestrconsts:lisfriincurrentunit +msgid "in current unit" +msgstr "šiame modulyje" + +#: lazarusidestrconsts:lisfriinmainproject +msgid "in main project" +msgstr "pagrindiniame projekte" + +#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit +msgid "in project/package owning current unit" +msgstr "projekte/pakete, kuriam priklauso šis modulis" + +#: lazarusidestrconsts:lisfriinallopenpackagesandprojects +msgid "in all open packages and projects" +msgstr "visuose atvertuose paketuose ir projektuose" + +#: lazarusidestrconsts:lisfrirenameallreferences +msgid "Rename all References" +msgstr "Pervardyti visus surastus" + +#: lazarusidestrconsts:dlgglobal +msgid "Global" +msgstr "Globaliai" + +#: lazarusidestrconsts:dlgselectedtext +msgid "Selected Text" +msgstr "Pažymėtame tekste" + +#: lazarusidestrconsts:dlgdirection +msgid "Direction" +msgstr "Kryptis" + +#: lazarusidestrconsts:lisfrforwardsearch +msgid "Forward search" +msgstr "Ieškoti pirmyn" + +#: lazarusidestrconsts:lisfrbackwardsearch +msgid "Backward search" +msgstr "Iekoti atgal" + +#: lazarusidestrconsts:dlgupword +msgid "Up" +msgstr "Viršun" + +#: lazarusidestrconsts:dlgdownword +msgid "Down" +msgstr "Apačion" + +#: lazarusidestrconsts:dlgreplaceall +msgid "Replace &All" +msgstr "Pakeisti &visus" + +#: lazarusidestrconsts:dlggetposition +msgid "Get position" +msgstr "Sužinoti poziciją" + +#: lazarusidestrconsts:dlgleftpos +msgid "Left:" +msgstr "Kairė:" + +#: lazarusidestrconsts:dlgwidthpos +msgid "Width:" +msgstr "Plotis:" + +#: lazarusidestrconsts:dlgtoppos +msgid "Top:" +msgstr "Viršus:" + +#: lazarusidestrconsts:dlgheightpos +msgid "Height:" +msgstr "Aukštis:" + +#: lazarusidestrconsts:rsiwpusewindowmanagersetting +msgid "Use windowmanager setting" +msgstr "Naudoti langų tvarkytuvės nuostatas" + +#: lazarusidestrconsts:rsiwpdefault +msgid "Default" +msgstr "Numatytas" + +#: lazarusidestrconsts:rsiwprestorewindowgeometry +msgid "Restore window geometry" +msgstr "Atstatyti lango geometriją" + +#: lazarusidestrconsts:rsiwpdocked +msgid "Docked" +msgstr "Įstatytas" + +#: lazarusidestrconsts:rsiwpcustomposition +msgid "Custom position" +msgstr "Nurodytas dydis" + +#: lazarusidestrconsts:rsiwprestorewindowsize +msgid "Restore window size" +msgstr "Atstatyti lango dydį" + +#: lazarusidestrconsts:liscodeexplorer +msgid "Code Explorer" +msgstr "Kodo tyrinėtojas" + +#: lazarusidestrconsts:uemfinddeclaration +msgid "&Find Declaration" +msgstr "Ieškoti kur &paskelbta" + +#: lazarusidestrconsts:uemopenfileatcursor +msgid "&Open file at cursor" +msgstr "Atverti ties žymekliu nurodytą &failą" + +#: lazarusidestrconsts:uemprocedurejump +msgid "Procedure Jump" +msgstr "Rodyti procedūros paskelbimą arba jos kodą" + +#: lazarusidestrconsts:uemclosepage +msgid "&Close Page" +msgstr "&Užverti lapą" + +#: lazarusidestrconsts:uemcut +msgid "Cut" +msgstr "Iškirpti" + +#: lazarusidestrconsts:uemcopy +msgid "Copy" +msgstr "Kopijuoti" + +#: lazarusidestrconsts:uempaste +msgid "Paste" +msgstr "Įdėti" + +#: lazarusidestrconsts:uemcopyfilename +msgid "Copy filename" +msgstr "Kopijuoti failo vardą" + +#: lazarusidestrconsts:uemgotobookmark +msgid "&Goto Bookmark" +msgstr "&Rodyti žymę" + +#: lazarusidestrconsts:uemsetfreebookmark +msgid "Set a free Bookmark" +msgstr "Padėti laisvą žymę" + +#: lazarusidestrconsts:uemnextbookmark +msgid "Goto next Bookmark" +msgstr "Rodyti tolesnę žymę" + +#: lazarusidestrconsts:uemprevbookmark +msgid "Goto previous Bookmark" +msgstr "Rodyti ankstesnę žymę" + +#: lazarusidestrconsts:uembookmarkn +msgid "Bookmark" +msgstr "Žymė" + +#: lazarusidestrconsts:lisopenlfm +msgid "Open %s" +msgstr "Atverti %s" + +#: lazarusidestrconsts:uemsetbookmark +msgid "&Set Bookmark" +msgstr "Pa&dėti žymę" + +#: lazarusidestrconsts:uemreadonly +msgid "Read Only" +msgstr "Tik skaitymui" + +#: lazarusidestrconsts:uemshowlinenumbers +msgid "Show Line Numbers" +msgstr "Rodyti eilučių numerius" + +#: lazarusidestrconsts:uemshowunitinfo +msgid "Unit Info" +msgstr "Informacija apie modulį" + +#: lazarusidestrconsts:uemdebugword +msgid "Debug" +msgstr "Derinimas" + +#: lazarusidestrconsts:uemaddbreakpoint +msgid "&Add Breakpoint" +msgstr "Padėti st&abdos tašką" + +#: lazarusidestrconsts:uemaddwatchatcursor +msgid "Add &Watch At Cursor" +msgstr "&Stebėti esantį ties žymekliu" + +#: lazarusidestrconsts:uemruntocursor +msgid "&Run to Cursor" +msgstr "S&tartuoti iki žymeklio" + +#: lazarusidestrconsts:uemviewcallstack +msgid "View Call Stack" +msgstr "Rodyti kreipčių dėklą" + +#: lazarusidestrconsts:uemmoveeditorleft +msgid "Move Editor Left" +msgstr "Perkelti redaktorių kairėn" + +#: lazarusidestrconsts:uemmoveeditorright +msgid "Move Editor Right" +msgstr "Perkelti redaktorių dešinėn" + +#: lazarusidestrconsts:uemrefactor +msgid "Refactoring" +msgstr "Pertvarkymas" + +#: lazarusidestrconsts:uemcompletecode +msgid "Complete Code" +msgstr "Pabaigti kodą" + +#: lazarusidestrconsts:uemencloseselection +msgid "Enclose Selection" +msgstr "Apgaubti pažymėtąjį" + +#: lazarusidestrconsts:uemextractproc +msgid "Extract Procedure" +msgstr "Ištraukti procedūrą" + +#: lazarusidestrconsts:ueminvertassignment +msgid "Invert Assignment" +msgstr "Sukeisti priskyrimą" + +#: lazarusidestrconsts:uemfindidentifierreferences +msgid "Find Identifier References" +msgstr "Ieškoti identifikatoriaus įrašų" + +#: lazarusidestrconsts:uemrenameidentifier +msgid "Rename Identifier" +msgstr "Pervardyti identifikatorių" + +#: lazarusidestrconsts:uemeditorproperties +msgid "Editor properties" +msgstr "Redaktoriaus savybės" + +#: lazarusidestrconsts:uenotimplcap +msgid "Not implemented yet" +msgstr "Dar neįgyvendinta" + +#: lazarusidestrconsts:uenotimpltext +msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" +msgstr "Jei jūs galite mums padėti įgyvendinti šią ypatybę, tada rašykite į lazarus@miraclec.com" + +#: lazarusidestrconsts:uenotimplcapagain +msgid "I told You: Not implemented yet" +msgstr "Aš tau sakau: dar neįgyvendinta." + +#: lazarusidestrconsts:uefilerocap +msgid "File is readonly" +msgstr "Failas tik skaitymui" + +#: lazarusidestrconsts:uefilerotext1 +msgid "The file \"" +msgstr "Failas \"" + +#: lazarusidestrconsts:uefilerotext2 +msgid "\" is not writable." +msgstr "\" nėra skirtas rašymui" + +#: lazarusidestrconsts:uemodified +msgid "Modified" +msgstr "Pakeista" + +#: lazarusidestrconsts:uepreadonly +msgid "Readonly" +msgstr "Tik skaitymui" + +#: lazarusidestrconsts:uepins +msgid "INS" +msgstr "ĮTERPTI" + +#: lazarusidestrconsts:uepovr +msgid "OVR" +msgstr "KEISTI" + +#: lazarusidestrconsts:lisuefontwith +msgid "Font without UTF-8" +msgstr "Ne UTF-8 šriftas" + +#: lazarusidestrconsts:lisuethecurre +msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." +msgstr "Dabartinis redaktoriaus šriftas nėra suderintas su UTF-8 koduote, o jūsų sistema naudoja būtent šią koduotę.%sTai reiškia kad ne ASCII simboliai greičiausiai bus rodomi klaidingai.%sKitą šriftą galite pasirinkti redaktoriaus parinktyse." + +#: lazarusidestrconsts:lisuedonotsho +msgid "Do not show this message again." +msgstr "Daugiau neberodyti šio pranešimo." + +#: lazarusidestrconsts:lisinvalidmultiselection +msgid "Invalid multiselection" +msgstr "Klaidingas daugybinis pažymėjimas" + +#: lazarusidestrconsts:lisunableconvertbinarystreamtotext +msgid "Unable convert binary stream to text" +msgstr "Nepavyko dvejetainį srautą konvertuoti į tekstą" + +#: lazarusidestrconsts:lisunabletostreamselectedcomponents +msgid "Unable to stream selected components" +msgstr "Pažymėtųjų komponenčių persiųsti srautu nepavyko." + +#: lazarusidestrconsts:liscannotcopytoplevelcomponent +msgid "Can not copy top level component." +msgstr "Aukščiausiame lygyje esančių komponenčių kopijuoti negalima." + +#: lazarusidestrconsts:liscopyingawholeformisnotimplemented +msgid "Copying a whole form is not implemented." +msgstr "Visos formos kopijavimas dar nėra įgyvendintas." + +#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent +msgid "There was an error during writing the selected component %s:%s:%s%s" +msgstr "Rašant pažymėtąją komponentę %s:%s įvyko klaida:%s%s" + +#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe +msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" +msgstr "Konvertuojant pažymėtosios komponentės %s:%s dvejetainį srautą įvyko klaida:%s%s" + +#: lazarusidestrconsts:lisunablecopycomponentstoclipboard +msgid "Unable copy components to clipboard" +msgstr "Komponentę kopijuoti į iškarpinę nepavyko" + +#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli +msgid "There was an error while copying the component stream to clipboard:%s%s" +msgstr "Komponentę srautu kopijuojant į iškarpinę įvyko klaida:%s%s" + +#: lazarusidestrconsts:liserrorin +msgid "Error in %s" +msgstr "%s klaida" + +#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename +msgid "There is already another component with the name %s%s%s." +msgstr "Jau yra komponentas tokiu vardu %s%s%s." + +#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated +msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" +msgstr "Klasės %s%s%s%s komponentų redaktorius, iššauktas veiksmažodžio #%s %s%s%s,%spadarė klaidą:%s%s%s%s" + +#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror +msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" +msgstr "Klasės %s%s%skomponentų redaktorius padarė klaidą:%s%s%s%s" + +#: lazarusidestrconsts:fdinvalidmultiselectiontext +msgid "Multiselected components must be of a single form." +msgstr "Kelios pažymėtos komponentės turi būti toje pačioje formoje." + +#: lazarusidestrconsts:lisinvaliddelete +msgid "Invalid delete" +msgstr "Klaidingas šalinimas" + +#: lazarusidestrconsts:listherootcomponentcannotbedeleted +msgid "The root component can not be deleted." +msgstr "Šakninio komponento negalima Pašalinti." + +#: lazarusidestrconsts:fdmalignword +msgid "Align" +msgstr "Lygiuotė" + +#: lazarusidestrconsts:fdmmirrorhorizontal +msgid "Mirror horizontal" +msgstr "Apsukti horizontaliai" + +#: lazarusidestrconsts:fdmmirrorvertical +msgid "Mirror vertical" +msgstr "Apsukti vertikaliai" + +#: lazarusidestrconsts:fdmscaleword +msgid "Scale" +msgstr "Mastelis" + +#: lazarusidestrconsts:fdmsizeword +msgid "Size" +msgstr "Dydis" + +#: lazarusidestrconsts:fdmtaborder +msgid "Tab order..." +msgstr "Tabuliatoriaus eilė..." + +#: lazarusidestrconsts:fdmorder +msgid "Order" +msgstr "Eilė" + +#: lazarusidestrconsts:fdmordermovetofront +msgid "Move to front" +msgstr "Perkelti į priekį" + +#: lazarusidestrconsts:fdmordermovetoback +msgid "Move to back" +msgstr "Perkelti į galą" + +#: lazarusidestrconsts:fdmorderforwardone +msgid "Forward one" +msgstr "Vienu pirmyn" + +#: lazarusidestrconsts:fdmorderbackone +msgid "Back one" +msgstr "Vienu atgal" + +#: lazarusidestrconsts:fdmdeleteselection +msgid "Delete selection" +msgstr "Pašalinti pažymėtą" + +#: lazarusidestrconsts:lischangeclass +msgid "Change Class" +msgstr "Pakeisti klasę" + +#: lazarusidestrconsts:fdmsnaptogridoption +msgid "Option: Snap to grid" +msgstr "Parinktis: pritraukti prie tinklelio taškų" + +#: lazarusidestrconsts:lisviewsourcelfm +msgid "View Source (.lfm)" +msgstr "Rodyti pirminį kodą (.lfm)" + +#: lazarusidestrconsts:fdmsaveformasxml +msgid "Save form as xml" +msgstr "Išsaugoti formą kaip xml" + +#: lazarusidestrconsts:fdmsnaptoguidelinesoption +msgid "Option: Snap to guide lines" +msgstr "Parinktis: pritraukti prie pagalbinių linijų" + +#: lazarusidestrconsts:fdmshowoptions +msgid "Show Options for form editing" +msgstr "Formos konstravimo parinktys" + +#: lazarusidestrconsts:srkmeditkeys +msgid "Edit Keys" +msgstr "Keisti klavišus" + +#: lazarusidestrconsts:srkmcommand +msgid "Command:" +msgstr "Komanda:" + +#: lazarusidestrconsts:srkmconflic +msgid "Conflict " +msgstr "Konfliktas" + +#: lazarusidestrconsts:srkmconflicw +msgid " conflicts with " +msgstr " konfliktuoja su " + +#: lazarusidestrconsts:srkmcommand1 +msgid " command1 \"" +msgstr "komanda 1 \"" + +#: lazarusidestrconsts:srkmcommand2 +msgid " command2 \"" +msgstr "komanda 2 \"" + +#: lazarusidestrconsts:srkmeditforcmd +msgid "Edit keys for command" +msgstr "Keisti klavišus komandai" + +#: lazarusidestrconsts:srkmkey +msgid "Key (or 2 keys combination)" +msgstr "Klavišas (arba dviejų kombinacija)" + +#: lazarusidestrconsts:srkmgrabkey +msgid "Grab key" +msgstr "Susekti klavišą" + +#: lazarusidestrconsts:srkmgrabsecondkey +msgid "Grab second key" +msgstr "Susekti kitą klavišą" + +#: lazarusidestrconsts:srkmpresskey +msgid "Please press a key ..." +msgstr "Spustelkit kokį nors klavišą..." + +#: lazarusidestrconsts:srkmalternkey +msgid "Alternative key (or 2 keys combination)" +msgstr "Alternatyvusis klavišas (arba dviejų kombinacija)" + +#: lazarusidestrconsts:srkmalreadyconnected +msgid " The key \"%s\" is already connected to \"%s\"." +msgstr "Klavišas \"%s\" jau yra surištas su \"%s\"." + +#: lazarusidestrconsts:srkmecwordleft +msgid "Move cursor word left" +msgstr "Perkelti žymeklį žodžiu kairiau" + +#: lazarusidestrconsts:srkmecwordright +msgid "Move cursor word right" +msgstr "Perkelti žymeklį žodžiu dešiniau" + +#: lazarusidestrconsts:srkmeclinestart +msgid "Move cursor to line start" +msgstr "Perkelti žymeklį į eilutės pradžia" + +#: lazarusidestrconsts:srkmeclineend +msgid "Move cursor to line end" +msgstr "Perkelti žymeklį į eilutės pabaigą" + +#: lazarusidestrconsts:srkmecpageup +msgid "Move cursor up one page" +msgstr "Perkelti žymeklį lapu aukščiau" + +#: lazarusidestrconsts:srkmecpagedown +msgid "Move cursor down one page" +msgstr "Perkelti žymeklį lapu žemiau" + +#: lazarusidestrconsts:srkmecpageleft +msgid "Move cursor left one page" +msgstr "Perkelti žymeklį lapu kairiau" + +#: lazarusidestrconsts:srkmecpageright +msgid "Move cursor right one page" +msgstr "Perkelti žymeklį lapu dešiniau" + +#: lazarusidestrconsts:srkmecpagetop +msgid "Move cursor to top of page" +msgstr "Perkelti žymeklį į lapo pradžią" + +#: lazarusidestrconsts:srkmecpagebottom +msgid "Move cursor to bottom of page" +msgstr "Perkelti žymeklį į lapo pabaigą" + +#: lazarusidestrconsts:srkmeceditortop +msgid "Move cursor to absolute beginning" +msgstr "Perkelti žymeklį į absoliučią pradžią" + +#: lazarusidestrconsts:srkmeceditorbottom +msgid "Move cursor to absolute end" +msgstr "Perkelti žymeklį į absoliučią pabaigą" + +#: lazarusidestrconsts:srkmecgotoxy +msgid "Goto XY" +msgstr "Eiti į poziciją" + +#: lazarusidestrconsts:srkmecselleft +msgid "SelLeft" +msgstr "Žymėti simboliu kairiau" + +#: lazarusidestrconsts:srkmecselright +msgid "SelRight" +msgstr "Žymėti simboliu dešiniau" + +#: lazarusidestrconsts:srkmecselup +msgid "Select Up" +msgstr "Žymėti eilute aukščiau" + +#: lazarusidestrconsts:srkmecseldown +msgid "Select Down" +msgstr "Žymėti eilute žemiau" + +#: lazarusidestrconsts:srkmecselwordleft +msgid "Select Word Left" +msgstr "Žymėti žodžiu kairiau" + +#: lazarusidestrconsts:srkmecselwordright +msgid "Select Word Right" +msgstr "Žymėti žodžiu dešiniau" + +#: lazarusidestrconsts:srkmecsellinestart +msgid "Select Line Start" +msgstr "Žymėti iki eilutės pradžios" + +#: lazarusidestrconsts:srkmecsellineend +msgid "Select Line End" +msgstr "Žymėti iki eilutės galo" + +#: lazarusidestrconsts:srkmecselpageup +msgid "Select Page Up" +msgstr "Žymėti lapu aukščiau" + +#: lazarusidestrconsts:srkmecselpagedown +msgid "Select Page Down" +msgstr "Žymėti lapu žemiau" + +#: lazarusidestrconsts:srkmecselpageleft +msgid "Select Page Left" +msgstr "Žymėti lapu kairiau" + +#: lazarusidestrconsts:srkmecselpageright +msgid "Select Page Right" +msgstr "Žymėti lapu dešiniau" + +#: lazarusidestrconsts:srkmecselpagetop +msgid "Select Page Top" +msgstr "Žymėti iki lapo viršaus" + +#: lazarusidestrconsts:srkmecselpagebottom +msgid "Select Page Bottom" +msgstr "Žymėti iki lapo apačios" + +#: lazarusidestrconsts:srkmecseleditortop +msgid "Select to absolute beginning" +msgstr "Žymėti iki absoliučios pradžios" + +#: lazarusidestrconsts:srkmecseleditorbottom +msgid "Select to absolute end" +msgstr "Žymėti iki absoliučios pabaigos" + +#: lazarusidestrconsts:srkmecselgotoxy +msgid "Select Goto XY" +msgstr "Žymėti ir eiti į XY" + +#: lazarusidestrconsts:srkmecselectall +msgid "Select All" +msgstr "Žymėti viską" + +#: lazarusidestrconsts:srkmecdeletelastchar +msgid "Delete Last Char" +msgstr "Pašalinti paskutinį simbolį" + +#: lazarusidestrconsts:srkmecdeletechar +msgid "Delete char at cursor" +msgstr "Pašalinti simbolį ties žymekliu" + +#: lazarusidestrconsts:srkmecdeleteword +msgid "Delete to end of word" +msgstr "Pašalinti iki žodžio pabaigos" + +#: lazarusidestrconsts:srkmecdeletelastword +msgid "Delete to start of word" +msgstr "Pašalinti iki žodžio pradžios" + +#: lazarusidestrconsts:srkmecdeletebol +msgid "Delete to beginning of line" +msgstr "Pašalinti iki eilutės pradžios" + +#: lazarusidestrconsts:srkmecdeleteeol +msgid "Delete to end of line" +msgstr "Pašalinti iki eilutės pabaigos" + +#: lazarusidestrconsts:srkmecdeleteline +msgid "Delete current line" +msgstr "Pašalinti šią veikiamąją eilutę" + +#: lazarusidestrconsts:srkmecclearall +msgid "Delete whole text" +msgstr "Pašalinti visą tekstą" + +#: lazarusidestrconsts:srkmeclinebreak +msgid "Break line and move cursor" +msgstr "Laužti eilutę bei perkelti žymeklį" + +#: lazarusidestrconsts:srkmecinsertline +msgid "Break line, leave cursor" +msgstr "Laužti eilutę, neperkeliant žymeklio" + +#: lazarusidestrconsts:srkmecchar +msgid "Char" +msgstr "Simbolis" + +#: lazarusidestrconsts:srkmecimestr +msgid "Ime Str" +msgstr "IME eilutė" + +#: lazarusidestrconsts:srkmeccut +msgid "Cut selection to clipboard" +msgstr "Pažymėtą iškirpti į iškarpinę" + +#: lazarusidestrconsts:srkmeccopy +msgid "Copy selection to clipboard" +msgstr "Pažymėtą kopijuoti į iškarpinę" + +#: lazarusidestrconsts:srkmecpaste +msgid "Paste clipboard to current position" +msgstr "Iš iškarpinės įdėti veikiamojoje vietoje" + +#: lazarusidestrconsts:srkmecscrollup +msgid "Scroll up one line" +msgstr "Slinkti aukštyn per vieną eilutę" + +#: lazarusidestrconsts:srkmecscrolldown +msgid "Scroll down one line" +msgstr "Slinkti žemyn per vieną eilutę" + +#: lazarusidestrconsts:srkmecscrollleft +msgid "Scroll left one char" +msgstr "Slinkti kairėn per vieną simbolį" + +#: lazarusidestrconsts:srkmecscrollright +msgid "Scroll right one char" +msgstr "Slinkti dešinėn per vieną simbolį" + +#: lazarusidestrconsts:srkmecinsertmode +msgid "Insert Mode" +msgstr "Įterpimo veiksena" + +#: lazarusidestrconsts:srkmecoverwritemode +msgid "Overwrite Mode" +msgstr "Perrašymo veiksena" + +#: lazarusidestrconsts:srkmectogglemode +msgid "Toggle Mode" +msgstr "Perjungti veikseną" + +#: lazarusidestrconsts:srkmecblockindent +msgid "Indent block" +msgstr "Suteikti blokui įtrauką" + +#: lazarusidestrconsts:srkmecblockunindent +msgid "Unindent block" +msgstr "Naikinti bloko įtrauką" + +#: lazarusidestrconsts:srkmecshifttab +msgid "Shift Tab" +msgstr "Shift Tab" + +#: lazarusidestrconsts:srkmecmatchbracket +msgid "Go to matching bracket" +msgstr "Eiti prie skliausto porininko" + +#: lazarusidestrconsts:srkmecnormalselect +msgid "Normal selection mode" +msgstr "Įprasta žymėjimo veiksena" + +#: lazarusidestrconsts:srkmeccolumnselect +msgid "Column selection mode" +msgstr "Stulpelių žymėjimo veiksena" + +#: lazarusidestrconsts:srkmeclineselect +msgid "Line selection mode" +msgstr "Eilučių žymėjimo veiksena" + +#: lazarusidestrconsts:srkmecautocompletion +msgid "Code template completion" +msgstr "Kodo šablono užbaigimas" + +#: lazarusidestrconsts:srkmecuserfirst +msgid "User First" +msgstr "Pirma naudotojas" + +#: lazarusidestrconsts:srkmecsetfreebookmark +msgid "Set a free Bookmark" +msgstr "Padėti laisva žymę" + +#: lazarusidestrconsts:srkmecprevbookmark +msgid "Previous Bookmark" +msgstr "Ankstesnė žymė" + +#: lazarusidestrconsts:srkmecnextbookmark +msgid "Next Bookmark" +msgstr "Tolesnė žymė" + +#: lazarusidestrconsts:liskmgotomarker0 +msgid "Go to marker 0" +msgstr "Rodyti žymeklį 0" + +#: lazarusidestrconsts:liskmgotomarker1 +msgid "Go to marker 1" +msgstr "Rodyti žymeklį 1" + +#: lazarusidestrconsts:liskmgotomarker2 +msgid "Go to marker 2" +msgstr "Rodyti žymeklį 2" + +#: lazarusidestrconsts:liskmgotomarker3 +msgid "Go to marker 3" +msgstr "Rodyti žymeklį 3" + +#: lazarusidestrconsts:liskmgotomarker4 +msgid "Go to marker 4" +msgstr "Rodyti žymeklį 4" + +#: lazarusidestrconsts:liskmgotomarker5 +msgid "Go to marker 5" +msgstr "Rodyti žymeklį 5" + +#: lazarusidestrconsts:liskmgotomarker6 +msgid "Go to marker 6" +msgstr "Rodyti žymeklį 6" + +#: lazarusidestrconsts:liskmgotomarker7 +msgid "Go to marker 7" +msgstr "Rodyti žymeklį 7" + +#: lazarusidestrconsts:liskmgotomarker8 +msgid "Go to marker 8" +msgstr "Rodyti žymeklį 8" + +#: lazarusidestrconsts:liskmgotomarker9 +msgid "Go to marker 9" +msgstr "Rodyti žymeklį 9" + +#: lazarusidestrconsts:liskmsetmarker0 +msgid "Set marker 0" +msgstr "Uždėti žymeklį 0" + +#: lazarusidestrconsts:liskmsetmarker1 +msgid "Set marker 1" +msgstr "Uždėti žymeklį 1" + +#: lazarusidestrconsts:liskmsetmarker2 +msgid "Set marker 2" +msgstr "Uždėti žymeklį 2" + +#: lazarusidestrconsts:liskmsetmarker3 +msgid "Set marker 3" +msgstr "Uždėti žymeklį 3" + +#: lazarusidestrconsts:liskmsetmarker4 +msgid "Set marker 4" +msgstr "Uždėti žymeklį 4" + +#: lazarusidestrconsts:liskmsetmarker5 +msgid "Set marker 5" +msgstr "Uždėti žymeklį 5" + +#: lazarusidestrconsts:liskmsetmarker6 +msgid "Set marker 6" +msgstr "Uždėti žymeklį 6" + +#: lazarusidestrconsts:liskmsetmarker7 +msgid "Set marker 7" +msgstr "Uždėti žymeklį 7" + +#: lazarusidestrconsts:liskmsetmarker8 +msgid "Set marker 8" +msgstr "Uždėti žymeklį 8" + +#: lazarusidestrconsts:liskmsetmarker9 +msgid "Set marker 9" +msgstr "Uždėti žymeklį 9" + +#: lazarusidestrconsts:srkmecgotomarker +msgid "Go to Marker %d" +msgstr "Rodyti žymeklį %d" + +#: lazarusidestrconsts:srkmecsetmarker +msgid "Set Marker %d" +msgstr "Uždėti žymeklį %d" + +#: lazarusidestrconsts:srkmecjumptoeditor +msgid "Focus to source editor" +msgstr "Aktyvuoti pirminio kodo redaktorių" + +#: lazarusidestrconsts:liskmtogglebetweenunitandform +msgid "Toggle between Unit and Form" +msgstr "Persijungti tarp formos ir modulio" + +#: lazarusidestrconsts:srkmecnexteditor +msgid "Go to next editor" +msgstr "Eiti į tolesnį redaktorių" + +#: lazarusidestrconsts:srkmecpreveditor +msgid "Go to prior editor" +msgstr "Eiti į ankstesni redaktorių" + +#: lazarusidestrconsts:liskmaddbreakpoint +msgid "Add break point" +msgstr "Padėti stabdos tašką" + +#: lazarusidestrconsts:liskmremovebreakpoint +msgid "Remove break point" +msgstr "Pašalinti stabdos tašką" + +#: lazarusidestrconsts:srkmecmoveeditorleft +msgid "Move editor left" +msgstr "Perkelti redaktorių kairėn" + +#: lazarusidestrconsts:srkmecmoveeditorright +msgid "Move editor right" +msgstr "Perkelti redaktorių dešinėn" + +#: lazarusidestrconsts:liskmgotosourceeditor1 +msgid "Go to source editor 1" +msgstr "Rodyti pirminio kodo redaktoriaus 1 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor2 +msgid "Go to source editor 2" +msgstr "Rodyti pirminio kodo redaktoriaus 2 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor3 +msgid "Go to source editor 3" +msgstr "Rodyti pirminio kodo redaktoriaus 3 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor4 +msgid "Go to source editor 4" +msgstr "Rodyti pirminio kodo redaktoriaus 4 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor5 +msgid "Go to source editor 5" +msgstr "Rodyti pirminio kodo redaktoriaus 5 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor6 +msgid "Go to source editor 6" +msgstr "Rodyti pirminio kodo redaktoriaus 6 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor7 +msgid "Go to source editor 7" +msgstr "Rodyti pirminio kodo redaktoriaus 7 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor8 +msgid "Go to source editor 8" +msgstr "Rodyti pirminio kodo redaktoriaus 8 kortelę" + +#: lazarusidestrconsts:liskmgotosourceeditor9 +msgid "Go to source editor 9" +msgstr "Rodyti pirminio kodo redaktoriaus 9 kortelę" + +#: lazarusidestrconsts:srkmecgotoeditor +msgid "Go to editor %d" +msgstr "Rodyti %s redaktorių" + +#: lazarusidestrconsts:srkmecselectiontabs2spaces +msgid "Convert tabs to spaces in selection" +msgstr "Pažymėjime tabuliatoriaus simbolius konvertuoti į tarpų simbolius" + +#: lazarusidestrconsts:liskmencloseselection +msgid "Enclose selection" +msgstr "Apgaubti pažymėtąjį" + +#: lazarusidestrconsts:srkmecinsertcharacter +msgid "Insert from Charactermap" +msgstr "Įterpti iš simbolių lentelės" + +#: lazarusidestrconsts:srkmecinsertgplnotice +msgid "Insert GPL notice" +msgstr "Įterpti GPL raštą" + +#: lazarusidestrconsts:srkmecinsertlgplnotice +msgid "Insert LGPL notice" +msgstr "Įterpti LGPL raštą" + +#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice +msgid "Insert modified LGPL notice" +msgstr "Įterpti modifikuotą LGPL raštą" + +#: lazarusidestrconsts:liskminsertusername +msgid "Insert username" +msgstr "Įterpti naudotojo vardą" + +#: lazarusidestrconsts:liskminsertdateandtime +msgid "Insert date and time" +msgstr "Įterpti datą ir laiką" + +#: lazarusidestrconsts:srkmecinsertusername +msgid "Insert current username" +msgstr "Įterpti dabartinį vartotojo vardą" + +#: lazarusidestrconsts:srkmecinsertdatetime +msgid "Insert current date and time" +msgstr "Įterpti dabartinę datą ir laiką" + +#: lazarusidestrconsts:srkmecinsertchangelogentry +msgid "Insert ChangeLog entry" +msgstr "Įterpti pakeitimų žurnalo įrašą" + +#: lazarusidestrconsts:srkmecinsertcvsauthor +msgid "Insert CVS keyword Author" +msgstr "Įterpti CVS raktažodį \"Author\"" + +#: lazarusidestrconsts:srkmecinsertcvsdate +msgid "Insert CVS keyword Date" +msgstr "Įterpti CVS raktažodį \"Date\"" + +#: lazarusidestrconsts:srkmecinsertcvsheader +msgid "Insert CVS keyword Header" +msgstr "Įterpti CVS raktažodį \"Header\"" + +#: lazarusidestrconsts:srkmecinsertcvsid +msgid "Insert CVS keyword ID" +msgstr "Įterpti CVS raktažodį \"ID\"" + +#: lazarusidestrconsts:srkmecinsertcvslog +msgid "Insert CVS keyword Log" +msgstr "Įterpti CVS raktažodį \"Log\"" + +#: lazarusidestrconsts:srkmecinsertcvsname +msgid "Insert CVS keyword Name" +msgstr "Įterpti CVS raktažodį \"Name\"" + +#: lazarusidestrconsts:srkmecinsertcvsrevision +msgid "Insert CVS keyword Revision" +msgstr "Įterpti CVS raktažodį \"Revision\"" + +#: lazarusidestrconsts:srkmecinsertcvssource +msgid "Insert CVS keyword Source" +msgstr "Įterpti CVS raktažodį \"Source\"" + +#: lazarusidestrconsts:srkmecfind +msgid "Find text" +msgstr "Ieškoti teksto" + +#: lazarusidestrconsts:srkmecfindnext +msgid "Find next" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:srkmecfindprevious +msgid "Find previous" +msgstr "Ieškoti ankstesnio" + +#: lazarusidestrconsts:srkmecfindinfiles +msgid "Find in files" +msgstr "Ieškoti failuose" + +#: lazarusidestrconsts:srkmecreplace +msgid "Replace text" +msgstr "Pakeisti tekstą" + +#: lazarusidestrconsts:liskmfindincremental +msgid "Find incremental" +msgstr "Prieauginė paieška" + +#: lazarusidestrconsts:srkmecfindproceduredefinition +msgid "Find procedure definiton" +msgstr "Ieškoti procedūros apibrėžties" + +#: lazarusidestrconsts:srkmecfindproceduremethod +msgid "Find procedure method" +msgstr "Ieškoti procedūros metodo" + +#: lazarusidestrconsts:srkmecgotolinenumber +msgid "Go to line number" +msgstr "Rodyti eilutę nurodytu numeriu" + +#: lazarusidestrconsts:srkmecfindnextwordoccurrence +msgid "Find next word occurrence" +msgstr "Ieškoti žodžio toliau" + +#: lazarusidestrconsts:srkmecfindprevwordoccurrence +msgid "Find previous word occurrence" +msgstr "Ieškoti žodžio atgaline tvarka" + +#: lazarusidestrconsts:srkmecaddjumppoint +msgid "Add jump point" +msgstr "Pridėti peršokimo tašką" + +#: lazarusidestrconsts:liskmviewjumphistory +msgid "View jump history" +msgstr "Rodyti peršokimų istoriją" + +#: lazarusidestrconsts:srkmecopenfileatcursor +msgid "Open file at cursor" +msgstr "Atverti ties žymekliu nurodytą failą" + +#: lazarusidestrconsts:srkmecgotoincludedirective +msgid "Go to to include directive of current include file" +msgstr "Rodyti veikiamojo įdėtojo failo įdėjimo direktyvą" + +#: lazarusidestrconsts:srkmecprocedurelist +msgid "Procedure List ..." +msgstr "Procedurų sąrašas..." + +#: lazarusidestrconsts:srkmectoggleformunit +msgid "Switch between form and unit" +msgstr "Persijungti tarp formos ir modulio" + +#: lazarusidestrconsts:srkmectoggleobjectinsp +msgid "View Object Inspector" +msgstr "Rodyti objektų inspektorių" + +#: lazarusidestrconsts:srkmectogglesourceeditor +msgid "View Source Editor" +msgstr "Rodyti pirminio kodo redaktorių" + +#: lazarusidestrconsts:srkmectogglecodeexpl +msgid "View Code Explorer" +msgstr "Rodyti kodo tyrinėtoją" + +#: lazarusidestrconsts:srkmectogglelazdoc +msgid "View Documentation Editor" +msgstr "Rodyti dokumentacijos redaktorių" + +#: lazarusidestrconsts:srkmectogglemessages +msgid "View messages" +msgstr "Rodyti pranešimus" + +#: lazarusidestrconsts:srkmectogglesearchresults +msgid "View Search Results" +msgstr "Rodyti ieškos rezultatus" + +#: lazarusidestrconsts:srkmectogglewatches +msgid "View watches" +msgstr "Rodyti stebimuosius" + +#: lazarusidestrconsts:srkmectogglebreakpoints +msgid "View breakpoints" +msgstr "Rodyti stabdos taškus" + +#: lazarusidestrconsts:srkmectoggledebuggerout +msgid "View debugger output" +msgstr "Rodyti derintuvės išvestį" + +#: lazarusidestrconsts:srkmectogglelocals +msgid "View local variables" +msgstr "Rodyti vietinius kintamuosius" + +#: lazarusidestrconsts:srkmectogglecallstack +msgid "View call stack" +msgstr "Rodyti kreipčių dėklą" + +#: lazarusidestrconsts:srkmecviewunits +msgid "View units" +msgstr "Rodyti modulius" + +#: lazarusidestrconsts:srkmecviewforms +msgid "View forms" +msgstr "Rodyti formas" + +#: lazarusidestrconsts:srkmecviewunitdependencies +msgid "View unit dependencies" +msgstr "Rodyti modulio priklausomybes" + +#: lazarusidestrconsts:srkmecviewunitinfo +msgid "View unit information" +msgstr "Rodyti informaciją apie modulį" + +#: lazarusidestrconsts:srkmecviewanchoreditor +msgid "View anchor editor" +msgstr "Rodyti prieraišų redaktorių" + +#: lazarusidestrconsts:srkmectogglecodebrowser +msgid "View code browser" +msgstr "Rodyti kodo naršyklę" + +#: lazarusidestrconsts:srkmectogglecomppalette +msgid "View component palette" +msgstr "Rodyti komponenčių paletę" + +#: lazarusidestrconsts:srkmectoggleidespeedbtns +msgid "View IDE speed buttons" +msgstr "Rodyti IKA spartos mygtukus" + +#: lazarusidestrconsts:srkmecwordcompletion +msgid "Word completion" +msgstr "Užbaigti žodį" + +#: lazarusidestrconsts:srkmeccompletecode +msgid "Complete code" +msgstr "Užbaigti kodą" + +#: lazarusidestrconsts:srkmecshowcodecontext +msgid "Show code context" +msgstr "Rodyti kodo turinį" + +#: lazarusidestrconsts:srkmecextractproc +msgid "Extract procedure" +msgstr "Ištraukti procedūrą" + +#: lazarusidestrconsts:srkmecfindidentifierrefs +msgid "Find identifier references" +msgstr "Ieškoti identifikatoriaus įrašų" + +#: lazarusidestrconsts:srkmecrenameidentifier +msgid "Rename identifier" +msgstr "Pervardyti identifikatorių" + +#: lazarusidestrconsts:srkmecinvertassignment +msgid "Invert assignment" +msgstr "Sukeisti priskyrimą" + +#: lazarusidestrconsts:srkmecsyntaxcheck +msgid "Syntax check" +msgstr "Sintaksės patikra" + +#: lazarusidestrconsts:srkmecguessmisplacedifdef +msgid "Guess misplaced $IFDEF" +msgstr "Nuspėti nevietoj esančius $IFDEF" + +#: lazarusidestrconsts:srkmecfinddeclaration +msgid "Find declaration" +msgstr "Ieškoti paskelbimo" + +#: lazarusidestrconsts:srkmecfindblockotherend +msgid "Find block other end" +msgstr "Ieškoti bloko kito galo" + +#: lazarusidestrconsts:srkmecfindblockstart +msgid "Find block start" +msgstr "Ieškoti bloko pradžios" + +#: lazarusidestrconsts:srkmecbuild +msgid "build program/project" +msgstr "daryti programą/projektą" + +#: lazarusidestrconsts:srkmecbuildall +msgid "build all files of program/project" +msgstr "daryti visus programos/projekto failus" + +#: lazarusidestrconsts:srkmecquickcompile +msgid "quick compile, no linking" +msgstr "kompiliuoti greitai, nesaistyti" + +#: lazarusidestrconsts:srkmecabortbuild +msgid "abort build" +msgstr "nutraukti darymą" + +#: lazarusidestrconsts:srkmecrun +msgid "run program" +msgstr "startuoti programą" + +#: lazarusidestrconsts:srkmecpause +msgid "pause program" +msgstr "pristabdyti programos veiką" + +#: lazarusidestrconsts:srkmecstopprogram +msgid "stop program" +msgstr "sustabdyti programos veiką" + +#: lazarusidestrconsts:srkmecresetdebugger +msgid "reset debugger" +msgstr "atstatyti derintuvę" + +#: lazarusidestrconsts:srkmecaddbreakpoint +msgid "add break point" +msgstr "padėti stabdos tašką" + +#: lazarusidestrconsts:srkmecremovebreakpoint +msgid "remove break point" +msgstr "pašalinti stabdos tašką" + +#: lazarusidestrconsts:srkmecrunparameters +msgid "run parameters" +msgstr "starto parametrai" + +#: lazarusidestrconsts:srkmeccompileroptions +msgid "compiler options" +msgstr "kompiliatoriaus parinktys" + +#: lazarusidestrconsts:srkmecbuildfile +msgid "build file" +msgstr "daryti failą" + +#: lazarusidestrconsts:srkmecrunfile +msgid "run file" +msgstr "startuoti failą" + +#: lazarusidestrconsts:srkmecconfigbuildfile +msgid "config build file" +msgstr "Derinti failo darytuvę" + +#: lazarusidestrconsts:srkmecinspect +msgid "inspect" +msgstr "inspektuoti" + +#: lazarusidestrconsts:srkmecevaluate +msgid "evaluate/modify" +msgstr "įvertinti/modifikuoti" + +#: lazarusidestrconsts:srkmecaddwatch +msgid "add watch" +msgstr "stebėti" + +#: lazarusidestrconsts:srkmecexttoolsettings +msgid "External tools settings" +msgstr "Išorės įrankių nuostatos" + +#: lazarusidestrconsts:srkmecbuildlazarus +msgid "Build lazarus" +msgstr "Daryti Lazarus" + +#: lazarusidestrconsts:srkmecexttool +msgid "External tool %d" +msgstr "Išorės įrankis %d" + +#: lazarusidestrconsts:srkmeccustomtool +msgid "Custom tool %d" +msgstr "Naudotojo įrankis %d" + +#: lazarusidestrconsts:srkmecenvironmentoptions +msgid "General environment options" +msgstr "Pagrindinės aplinkos parinktys" + +#: lazarusidestrconsts:liskmeditoroptions +msgid "Editor options" +msgstr "Redaktoriaus parinktys" + +#: lazarusidestrconsts:liskmeditcodetemplates +msgid "Edit Code Templates" +msgstr "Keisti kodo šablonus" + +#: lazarusidestrconsts:liskmcodetoolsoptions +msgid "CodeTools options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:liskmcodetoolsdefineseditor +msgid "CodeTools defines editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:srkmeccodetoolsoptions +msgid "Codetools options" +msgstr "CodeTools parinktys" + +#: lazarusidestrconsts:srkmeccodetoolsdefinesed +msgid "Codetools defines editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:lismenurescanfpcsourcedirectory +msgid "Rescan FPC source directory" +msgstr "Peržvelgti FPC pirminio kodo katalogą" + +#: lazarusidestrconsts:srkmecmakeresourcestring +msgid "Make resource string" +msgstr "Sukurti resursų eilutę" + +#: lazarusidestrconsts:liskmdiffeditorfiles +msgid "Diff editor files" +msgstr "Redaktoriaus failus apdoroti komanda Diff" + +#: lazarusidestrconsts:liskmconvertdfmfiletolfm +msgid "Convert DFM file to LFM" +msgstr "Konvertuoti DFM į LFM" + +#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit +msgid "Convert Delphi unit to Lazarus unit" +msgstr "Konvertuoti Delphi modulį į Lazarus modulį" + +#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject +msgid "Convert Delphi project to Lazarus project" +msgstr "Konvertuoti Delphi projektą į Lazarus projektą" + +#: lazarusidestrconsts:srkmecdiff +msgid "Diff" +msgstr "Diff" + +#: lazarusidestrconsts:srkmecunknown +msgid "unknown editor command" +msgstr "nežinoma redaktoriaus komana" + +#: lazarusidestrconsts:srvk_unknown +msgid "Unknown" +msgstr "Nežinomas" + +#: lazarusidestrconsts:srvk_lbutton +msgid "Mouse Button Left" +msgstr "Pelės kairysis klavišas" + +#: lazarusidestrconsts:srvk_rbutton +msgid "Mouse Button Right" +msgstr "Pelės dešinysis klavišas" + +#: lazarusidestrconsts:srvk_mbutton +msgid "Mouse Button Middle" +msgstr "Pelės vidurinis klavišas" + +#: lazarusidestrconsts:srvk_back +msgid "Backspace" +msgstr "Backspace" + +#: lazarusidestrconsts:srvk_tab +msgid "Tab" +msgstr "Tab" + +#: lazarusidestrconsts:srvk_clear +msgid "Clear" +msgstr "Clear" + +#: lazarusidestrconsts:srvk_return +msgid "Return" +msgstr "Return" + +#: lazarusidestrconsts:srvk_shift +msgid "Shift" +msgstr "Shift" + +#: lazarusidestrconsts:srvk_control +msgid "Control" +msgstr "Ctrl" + +#: lazarusidestrconsts:srvk_menu +msgid "Menu" +msgstr "Menu" + +#: lazarusidestrconsts:srvk_pause +msgid "Pause key" +msgstr "Pause klavišas" + +#: lazarusidestrconsts:srvk_capital +msgid "Capital" +msgstr "Caps Lock" + +#: lazarusidestrconsts:srvk_kana +msgid "Kana" +msgstr "Kana" + +#: lazarusidestrconsts:srvk_junja +msgid "Junja" +msgstr "Junja" + +#: lazarusidestrconsts:srvk_final +msgid "Final" +msgstr "Final" + +#: lazarusidestrconsts:srvk_hanja +msgid "Hanja" +msgstr "Hanja" + +#: lazarusidestrconsts:srvk_escape +msgid "Escape" +msgstr "Esc" + +#: lazarusidestrconsts:srvk_convert +msgid "Convert" +msgstr "Convert" + +#: lazarusidestrconsts:srvk_nonconvert +msgid "Nonconvert" +msgstr "Nonconvert" + +#: lazarusidestrconsts:srvk_accept +msgid "Accept" +msgstr "Accept" + +#: lazarusidestrconsts:srvk_modechange +msgid "Mode Change" +msgstr "Mode Change" + +#: lazarusidestrconsts:srvk_space +msgid "Space key" +msgstr "Space klavišas" + +#: lazarusidestrconsts:srvk_prior +msgid "Prior" +msgstr "Prior" + +#: lazarusidestrconsts:srvk_next +msgid "Next" +msgstr "Next" + +#: lazarusidestrconsts:srvk_end +msgid "End" +msgstr "End" + +#: lazarusidestrconsts:srvk_home +msgid "Home" +msgstr "Home" + +#: lazarusidestrconsts:srvk_left +msgid "Left" +msgstr "Left" + +#: lazarusidestrconsts:srvk_up +msgid "Up" +msgstr "Up" + +#: lazarusidestrconsts:srvk_right +msgid "Right" +msgstr "Right" + +#: lazarusidestrconsts:srvk_print +msgid "Print" +msgstr "Print" + +#: lazarusidestrconsts:srvk_execute +msgid "Execute" +msgstr "Execute" + +#: lazarusidestrconsts:srvk_snapshot +msgid "Snapshot" +msgstr "Snapshot" + +#: lazarusidestrconsts:srvk_insert +msgid "Insert" +msgstr "Insert" + +#: lazarusidestrconsts:srvk_help +msgid "Help" +msgstr "Help" + +#: lazarusidestrconsts:srvk_lwin +msgid "left windows key" +msgstr "kairysis windows klavišas" + +#: lazarusidestrconsts:srvk_rwin +msgid "right windows key" +msgstr "dešinysis windows klavišas" + +#: lazarusidestrconsts:srvk_apps +msgid "application key" +msgstr "programos klavišas" + +#: lazarusidestrconsts:srvk_numpad +msgid "Numpad %d" +msgstr "Numpad %d" + +#: lazarusidestrconsts:srvk_numlock +msgid "Numlock" +msgstr "Numlock" + +#: lazarusidestrconsts:srvk_scroll +msgid "Scroll" +msgstr "Sroll" + +#: lazarusidestrconsts:srvk_irregular +msgid "Irregular " +msgstr "Nereguliarus" + +#: lazarusidestrconsts:srkm_alt +msgid "Alt" +msgstr "Alt" + +#: lazarusidestrconsts:srkm_ctrl +msgid "Ctrl" +msgstr "Ctrl" + +#: lazarusidestrconsts:srkmcatcursormoving +msgid "Cursor moving commands" +msgstr "Žymeklio perkėlimo komandos" + +#: lazarusidestrconsts:srkmcatselection +msgid "Text selection commands" +msgstr "Teksto žymėjimo komandos" + +#: lazarusidestrconsts:srkmcatediting +msgid "Text editing commands" +msgstr "Teksto keitimo komandos" + +#: lazarusidestrconsts:liskmdeletelastchar +msgid "Delete last char" +msgstr "Pašalinti paskutinį simbolį" + +#: lazarusidestrconsts:srkmcatcmdcmd +msgid "Command commands" +msgstr "Menių \"Komandos\" komandos" + +#: lazarusidestrconsts:srkmcatsearchreplace +msgid "Text search and replace commands" +msgstr "Teksto ieškos ir pakeitimo komandos" + +#: lazarusidestrconsts:srkmcatmarker +msgid "Text marker commands" +msgstr "Teksto žymeklio komandos" + +#: lazarusidestrconsts:liskmsetfreebookmark +msgid "Set free Bookmark" +msgstr "Padėti laisvą žymę" + +#: lazarusidestrconsts:srkmcatcodetools +msgid "CodeTools commands" +msgstr "CodeTools komandos" + +#: lazarusidestrconsts:srkmcatsrcnotebook +msgid "Source Notebook commands" +msgstr "Pirminio kodo redaktoriaus komandos" + +#: lazarusidestrconsts:srkmcatfilemenu +msgid "File menu commands" +msgstr "Meniu \"Failas\" komandos" + +#: lazarusidestrconsts:liskmgotosourceeditor10 +msgid "Go to source editor 10" +msgstr "Rodyti pirminio kodo redaktoriaus 10 kortelę" + +#: lazarusidestrconsts:srkmcatviewmenu +msgid "View menu commands" +msgstr "Meniu \"Rodymas\" komandos" + +#: lazarusidestrconsts:liskmtoggleviewobjectinspector +msgid "Toggle view Object Inspector" +msgstr "Keisti \"Objektų inspektorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewsourceeditor +msgid "Toggle view Source Editor" +msgstr "Keisti \"Pirminio kodo redaktorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewcodeexplorer +msgid "Toggle view Code Explorer" +msgstr "Keisti \"Kodo tyrinėtojas\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor +msgid "Toggle view Documentation Editor" +msgstr "Keisti \"Dokumentacijos redaktorius\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewmessages +msgid "Toggle view Messages" +msgstr "Keisti \"Pranešimai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewsearchresults +msgid "Toggle view Search Results" +msgstr "Keisti \"Ieškos rezultatai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewwatches +msgid "Toggle view Watches" +msgstr "Keisti \"Stebimieji\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewbreakpoints +msgid "Toggle view Breakpoints" +msgstr "Keisti \"Stabdos taškai\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewlocalvariables +msgid "Toggle view Local Variables" +msgstr "Keisti \"Vietiniai kintamieji\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewcallstack +msgid "Toggle view Call Stack" +msgstr "Keisti \"Kreipčių dėklas\" matomumą" + +#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput +msgid "Toggle view Debugger Output" +msgstr "Keisti \"Derintuvės išvestis\" matomumą" + +#: lazarusidestrconsts:srkmcatprojectmenu +msgid "Project menu commands" +msgstr "Menių \"Projektas\" komandos" + +#: lazarusidestrconsts:liskmnewproject +msgid "New project" +msgstr "Naujas projektas" + +#: lazarusidestrconsts:liskmnewprojectfromfile +msgid "New project from file" +msgstr "Naujas projektas iš failo" + +#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons +msgid "Toggle view IDE speed buttons" +msgstr "Keisti IKA sparčiųjų mygtukų matomumą" + +#: lazarusidestrconsts:srkmcatrunmenu +msgid "Run menu commands" +msgstr "Meniu \"Startuoti\" komandos" + +#: lazarusidestrconsts:liskmbuildprojectprogram +msgid "Build project/program" +msgstr "Daryti projektą/programą" + +#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram +msgid "Build all files of project/program" +msgstr "Daryti visus projekto/programos failus" + +#: lazarusidestrconsts:liskmquickcompilenolinking +msgid "Quick compile, no linking" +msgstr "Kompiliuoti greitai, nesaistyti" + +#: lazarusidestrconsts:liskmabortbuilding +msgid "Abort building" +msgstr "Nutraukti darymą" + +#: lazarusidestrconsts:liskmrunprogram +msgid "Run program" +msgstr "Startuoti programą" + +#: lazarusidestrconsts:liskmpauseprogram +msgid "Pause program" +msgstr "Pristabdyti veiką" + +#: lazarusidestrconsts:liskmviewprojectoptions +msgid "View project options" +msgstr "Rodyti projekto parinktis" + +#: lazarusidestrconsts:srkmcatcomponentsmenu +msgid "Components menu commands" +msgstr "Maniu \"Komponentės\" komandos" + +#: lazarusidestrconsts:srkmcattoolmenu +msgid "Tools menu commands" +msgstr "Meniu \"Įrankiai\" komandos" + +#: lazarusidestrconsts:liskmexternaltoolssettings +msgid "External Tools settings" +msgstr "Išorinių įrankių nuostatos" + +#: lazarusidestrconsts:srkmcatenvmenu +msgid "Environment menu commands" +msgstr "Meniu \"Aplinka\" komandos" + +#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage +msgid "Convert Delphi package to Lazarus package" +msgstr "Delphi paketą konvertuoti į Lazarus paketą" + +#: lazarusidestrconsts:srkmcarhelpmenu +msgid "Help menu commands" +msgstr "Meniu \"Žinynas\" komandos" + +#: lazarusidestrconsts:liskeycatdesigner +msgid "Designer commands" +msgstr "Konstruktoriaus komandos" + +#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard +msgid "Copy selected Components to clipboard" +msgstr "Kopijuoti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard +msgid "Cut selected Components to clipboard" +msgstr "Iškirpti pažymėtas komponentes į iškarpinę" + +#: lazarusidestrconsts:liskmpastecomponentsfromclipboard +msgid "Paste Components from clipboard" +msgstr "Įdėti komponentę iš iškarpinės" + +#: lazarusidestrconsts:liskeycatobjinspector +msgid "Object Inspector commands" +msgstr "Objetų inspektoriaus komandos" + +#: lazarusidestrconsts:liskeycatcustom +msgid "Custom commands" +msgstr "Kitos komandos" + +#: lazarusidestrconsts:rslanguageautomatic +msgid "Automatic (or english)" +msgstr "Automatiškai (arba anglų)" + +#: lazarusidestrconsts:rslanguageenglish +msgid "English" +msgstr "Anglų" + +#: lazarusidestrconsts:rslanguagegerman +msgid "German" +msgstr "Vokiečių" + +#: lazarusidestrconsts:rslanguagespanish +msgid "Spanish" +msgstr "Ispanų" + +#: lazarusidestrconsts:rslanguagefrench +msgid "French" +msgstr "Prancūzų" + +#: lazarusidestrconsts:rslanguagerussian +msgid "Russian" +msgstr "Rusų" + +#: lazarusidestrconsts:rslanguagepolish +msgid "Polish" +msgstr "Lenkų" + +#: lazarusidestrconsts:rslanguagepolishiso +msgid "Polish(ISO 8859-2)" +msgstr "Lenkų(ISO 8859-2)" + +#: lazarusidestrconsts:rslanguagepolishwin +msgid "Polish(CP1250)" +msgstr "Lenkų(CP1250)" + +#: lazarusidestrconsts:rslanguageitalian +msgid "Italian" +msgstr "Italų" + +#: lazarusidestrconsts:rslanguagecatalan +msgid "Catalan" +msgstr "Katalanų" + +#: lazarusidestrconsts:rslanguagefinnish +msgid "Finnish" +msgstr "Suomių" + +#: lazarusidestrconsts:rslanguagehebrew +msgid "Hebrew" +msgstr "Žydų" + +#: lazarusidestrconsts:rslanguagearabic +msgid "Arabic" +msgstr "Arabų" + +#: lazarusidestrconsts:rslanguageportugues +msgid "Portuguese" +msgstr "Portugalų" + +#: lazarusidestrconsts:rslanguageukrainian +msgid "Ukrainian" +msgstr "Ukrainiečių" + +#: lazarusidestrconsts:rslanguagedutch +msgid "Dutch" +msgstr "Olandų" + +#: lazarusidestrconsts:rslanguagejapanese +msgid "Japanese" +msgstr "Japonų" + +#: lazarusidestrconsts:rslanguagechinese +msgid "Chinese" +msgstr "Kiniečių" + +#: lazarusidestrconsts:rslanguageindonesian +msgid "Indonesian" +msgstr "Indoneziečių" + +#: lazarusidestrconsts:rslanguageafrikaans +msgid "Afrikaans" +msgstr "Afrikiečių" + +#: lazarusidestrconsts:rslanguagelithuanian +msgid "Lithuanian" +msgstr "Lietuvių" + +#: lazarusidestrconsts:dlgunitdepcaption +msgid "Unit dependencies" +msgstr "Modulio priklausomybės" + +#: lazarusidestrconsts:dlgunitdepbrowse +msgid "Open" +msgstr "Atverti" + +#: lazarusidestrconsts:dlgunitdeprefresh +msgid "Refresh" +msgstr "Atnaujinti" + +#: lazarusidestrconsts:listodogoto +msgid "Goto" +msgstr "Rodyk kur" + +#: lazarusidestrconsts:lisdocumentationeditor +msgid "Documentation Editor" +msgstr "Dokumentacijos redaktorius" + +#: lazarusidestrconsts:lisconfirmlazarusrebuild +msgid "Do you want to rebuild Lazarus?" +msgstr "Daryti Lazarus išnaujo?" + +#: lazarusidestrconsts:liscleanlazarussource +msgid "Clean Lazarus Source" +msgstr "Apvalyti Lazarus katalogus" + +#: lazarusidestrconsts:lismakenotfound +msgid "Make not found" +msgstr "Nerastas Make" + +#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla +msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" +msgstr "Nerasta programa %ssmake%s.%sŠi programa reikalinga Lazarus darymui.%s" + +#: lazarusidestrconsts:liscompileidewithoutlinking +msgid "Compile IDE (without linking)" +msgstr "Kompiliuoti IKA (nesaistant)" + +#: lazarusidestrconsts:lislcl +msgid "LCL" +msgstr "LCL" + +#: lazarusidestrconsts:liscomponent +msgid "Component" +msgstr "Komponentė" + +#: lazarusidestrconsts:liscodetools +msgid "CodeTools" +msgstr "CodeTools" + +#: lazarusidestrconsts:lissynedit +msgid "SynEdit" +msgstr "SynEdit" + +#: lazarusidestrconsts:lisideintf +msgid "IDE Interface" +msgstr "IKA interfeisas" + +#: lazarusidestrconsts:lisjitform +msgid "JIT Form" +msgstr "JITForm" + +#: lazarusidestrconsts:lispkgreg +msgid "Package Registration" +msgstr "Paketo registracija" + +#: lazarusidestrconsts:liside +msgid "IDE" +msgstr "IKA" + +#: lazarusidestrconsts:lisstarter +msgid "Starter" +msgstr "Paleidimo programa" + +#: lazarusidestrconsts:lisexamples +msgid "Examples" +msgstr "Pavyzdžiai" + +#: lazarusidestrconsts:lisconfigurebuildlazarus +msgid "Configure %sBuild Lazarus%s" +msgstr "Derinti %sDaryti Lazarus%s" + +#: lazarusidestrconsts:lislazbuildcleanall +msgid "Clean all" +msgstr "Visiškas apvalymas" + +#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools +msgid "Build Components (SynEdit, CodeTools)" +msgstr "Daryti komponentes (SynEdit, CodeTools)" + +#: lazarusidestrconsts:lislazbuildbuildsynedit +msgid "Build SynEdit" +msgstr "Daryti SynEdit" + +#: lazarusidestrconsts:lislazbuildbuildcodetools +msgid "Build CodeTools" +msgstr "Daryti CodeTools" + +#: lazarusidestrconsts:lislazbuildbuildide +msgid "Build IDE" +msgstr "Daryti IKA" + +#: lazarusidestrconsts:lislazbuildbuildexamples +msgid "Build Examples" +msgstr "Daryti pavyzdžius" + +#: lazarusidestrconsts:lislazbuildoptions +msgid "Options:" +msgstr "Parinktys:" + +#: lazarusidestrconsts:lislazbuildtargetos +msgid "Target OS:" +msgstr "Paskirties OS:" + +#: lazarusidestrconsts:lislazbuildtargetcpu +msgid "Target CPU:" +msgstr "Paskirties procesorius:" + +#: lazarusidestrconsts:lislazbuildtargetdirectory +msgid "Target Directory:" +msgstr "Paskirties katalogas:" + +#: lazarusidestrconsts:lislazbuildlclinterface +msgid "LCL interface" +msgstr "LCL interfeisas" + +#: lazarusidestrconsts:lislazbuildbuildjitform +msgid "Build JITForm" +msgstr "Daryti JITForm" + +#: lazarusidestrconsts:lislazbuildwithstaticpackages +msgid "With Packages" +msgstr "Su paketais" + +#: lazarusidestrconsts:lislazbuildrestartafterbuild +msgid "Restart After Successfull Build" +msgstr "Padarius sėkmingai startuoti išnaujo" + +#: lazarusidestrconsts:lislazbuildconfirmbuild +msgid "Confirm Before ReBuild Lazarus" +msgstr "Klausti sutikimo prieš darant Lazarus" + +#: lazarusidestrconsts:lislazbuildok +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:lisctdtemplates +msgid "Templates" +msgstr "Šablonai" + +#: lazarusidestrconsts:lissavesettings +msgid "Save Settings" +msgstr "Išsaugoti nuostatas" + +#: lazarusidestrconsts:lislazbuildcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lazarusidestrconsts:lislazbuildnone +msgid "None" +msgstr "Nieko" + +#: lazarusidestrconsts:lislazbuildbuild +msgid "Build" +msgstr "Daryti" + +#: lazarusidestrconsts:lislazbuildcleanbuild +msgid "Clean+Build" +msgstr "Apvalyti ir daryti" + +#: lazarusidestrconsts:liscompilererrorinvalidcompiler +msgid "Error: invalid compiler: %s" +msgstr "Klaida: klaidingas kompiliatorius: %s" + +#: lazarusidestrconsts:listcompilerinternalerror +msgid "Internal compiler error! (%d)" +msgstr "Vidinė kompiliatoriaus klaida! (%d)" + +#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath +msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" +msgstr "Užuomina: kompiliatoriaus programą galite nurodyti \"Aplinka -> Aplinkos parinktys -> Failai -> Kompiliatoriaus programa\"." + +#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile +msgid "NOTE: loading old codetools options file: " +msgstr "Pastaba: įkeliami senasis CodeTools parinkčių failas:" + +#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults +msgid "NOTE: codetools config file not found - using defaults" +msgstr "Pastaba: nerastas CodeTools nustatymų failas - naudojami numatytieji nustatymai." + +#: lazarusidestrconsts:liscodetoolsoptsok +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:liscodetoolsoptsnone +msgid "None" +msgstr "Niekas" + +#: lazarusidestrconsts:liscodetoolsoptskeyword +msgid "Keyword" +msgstr "Raktažodis" + +#: lazarusidestrconsts:liscodetoolsoptsidentifier +msgid "Identifier" +msgstr "Identifikatorius" + +#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp +msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" +msgstr "Ieškoti ir kituose failuose (pvz.: /path/*.pas;/path2/*.pp)" + +#: lazarusidestrconsts:lisfrifindreferences +msgid "Find References" +msgstr "Ieškoti įrašų" + +#: lazarusidestrconsts:lisfriinvalididentifier +msgid "Invalid Identifier" +msgstr "Klaidingas identifikatorius" + +#: lazarusidestrconsts:lisfrirenameto +msgid "Rename to" +msgstr "Pervardyti į" + +#: lazarusidestrconsts:lisfrirename +msgid "Rename" +msgstr "Pervardyti" + +#: lazarusidestrconsts:lisfrisearchincommentstoo +msgid "Search in comments too" +msgstr "Taip pat ir komentaruose" + +#: lazarusidestrconsts:lisfrisearchwhere +msgid "Search where" +msgstr "Kur ieškoti" + +#: lazarusidestrconsts:liscodetoolsoptscolon +msgid "Colon" +msgstr "Dvitaškis" + +#: lazarusidestrconsts:liscodetoolsoptssemicolon +msgid "Semicolon" +msgstr "Kabliataškis" + +#: lazarusidestrconsts:liscodetoolsoptscomma +msgid "Comma" +msgstr "Kablelis" + +#: lazarusidestrconsts:liscodetoolsoptspoint +msgid "Point" +msgstr "Taškas" + +#: lazarusidestrconsts:liscodetoolsoptsat +msgid "At" +msgstr "Simbolis eta" + +#: lazarusidestrconsts:liscodetoolsoptsnumber +msgid "Number" +msgstr "Skaičius" + +#: lazarusidestrconsts:liscodetoolsoptsstringconst +msgid "String constant" +msgstr "Eilutės konstanta" + +#: lazarusidestrconsts:liscodetoolsoptsnewline +msgid "Newline" +msgstr "Nauja eilutė" + +#: lazarusidestrconsts:liscodetoolsoptsspace +msgid "Space" +msgstr "Tarpo simbolis" + +#: lazarusidestrconsts:liscodetoolsoptssymbol +msgid "Symbol" +msgstr "Simbolis" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview +msgid "CodeTools Defines Preview" +msgstr "CodeTools apibrėžčių peržiūra" + +#: lazarusidestrconsts:liscodetoolsdefswriteerror +msgid "Write error" +msgstr "Klaida rašant" + +#: lazarusidestrconsts:lisstopdebugging2 +msgid "Stop debugging?" +msgstr "Sustabdyti derinimą?" + +#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject +msgid "Stop current debugging and rebuild project?" +msgstr "Sustabdyti šiuo metu vykdomą programos derinimą ir daryti projektą išnaujo?" + +#: lazarusidestrconsts:liserrorwritingpackagelisttofile +msgid "Error writing package list to file%s%s%s%s" +msgstr "Įvyko klaida rašant paketo sąrašą į failą%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting +msgid "Error while writing %s%s%s%s%s" +msgstr "Įvyko klaida rašant %s%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile +msgid "Error while writing project info file %s%s%s%s%s" +msgstr "Įvyko klaida rašant į informacijos apie projektą failą %s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefsreaderror +msgid "Read error" +msgstr "Klaida įkeliant" + +#: lazarusidestrconsts:liserrorreadingpackagelistfromfile +msgid "Error reading package list from file%s%s%s%s" +msgstr "Įvyko klaida įkeliant paketų sąrašą iš failo%s%s%s%s" + +#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits +msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." +msgstr "Dabartinis failo%s%s%s%s modulio kelias yra%s%s%s%s.%s%sTrūksta įrašo apie kelią iki LCL modulių %s%s%s.%s%sUžuomina naujokams:%ssukurkite Lazarus programą ir patalpinkite failą projekto kataloge." + +#: lazarusidestrconsts:lislclunitpathmissing +msgid "LCL unit path missing" +msgstr "Trūksta įrašo apie kelią iki LCL modulio" + +#: lazarusidestrconsts:lisnotadelphiunit +msgid "Not a Delphi unit" +msgstr "Ne Delhi modulis" + +#: lazarusidestrconsts:listhefileisnotadelphiunit +msgid "The file %s%s%s is not a Delphi unit." +msgstr "Failas %s%s%s nėra Delhi modulis." + +#: lazarusidestrconsts:liscodetoolsdefserrorreading +msgid "Error reading %s%s%s%s%s" +msgstr "Įvyko klaida įkeliant %s%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile +msgid "Error reading project info file %s%s%s%s%s" +msgstr "Įvyko klaida įkeliant informacijos apie projektą failą %s%s%s%s%s" + +#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly +msgid "Node is readonly" +msgstr "Mazgas tik skaitymui" + +#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited +msgid "Auto generated nodes can not be edited." +msgstr "Negalima keisti automatiškai sukurtų mazgų." + +#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode +msgid "Invalid previous node" +msgstr "Klaidingas ankstesnis mazgas" + +#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes +msgid "Previous node can not contain child nodes." +msgstr "Ankstesnis mazgas negali turėti mazgų-vaikų." + +#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory +msgid "Create FPC Macros and paths for a fpc project directory" +msgstr "Sukurti FPC makrokomandas ir kelius FPC projekto katalogui" + +#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory +msgid "Project directory" +msgstr "Projekto katalogas" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory +msgid "The Free Pascal project directory." +msgstr "FreePascal projekto katalogas." + +#: lazarusidestrconsts:liscodetoolsdefscompilerpath +msgid "compiler path" +msgstr "Kompiliatoriaus programa" + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject +msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." +msgstr "Šio projekto FreePascal kompiliatoriaus programa su keliu iki jos. Būtina įrašyti jei žemiau nurodysit FPC SVN pirminio kodo katalogą. Šis įrasa naudojamas automatiškai kuriant makrokomandas." + +#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory +msgid "FPC SVN source directory" +msgstr "FPC SVN pirminio kodo katalogas" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory +msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." +msgstr "FreePascal SVN pirminio teksto katalogas. Nebūtina, tačiau nurodžius tai pagerins paskelbimo kode paiešką bei programos derinimą." + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler +msgid "Create Defines for Free Pascal Compiler" +msgstr "Sukurti apibrėžtis FreePascal kompiliatoriui" + +#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample +msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." +msgstr "FreePascal kompiliatoriaus programa su keliu iki jos.%sPavyzdžiui: %s/usr/bin/%s -n%s arba %s/usr/local/bin/fpc @/etc/fpc.cfg%s." + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources +msgid "Create Defines for Free Pascal SVN Sources" +msgstr "Sukurti apibrėžtis FreePascal SVN pirminiam kodui" + +#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir +msgid "The Free Pascal SVN source directory." +msgstr "FreePascal SVN pirminio kodo katalogas." + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir +msgid "Create Defines for Lazarus Directory" +msgstr "Sukurti apibr4=tis Lazarus katalogui" + +#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory +msgid "Lazarus Directory" +msgstr "Lazarus katalogas" + +#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory +msgid "The Lazarus main directory." +msgstr "Lazarus pagrindinis katalogas." + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory +msgid "Create Defines for %s Directory" +msgstr "Sukurti apibrėžtis %s katalogui" + +#: lazarusidestrconsts:liscodetoolsdefsdirectory +msgid "%s directory" +msgstr "%s katalogas" + +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" + +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc +msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: /home/user/kylix%s" + +#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject +msgid "Create Defines for %s Project" +msgstr "Sukurti apibrėžtis projektui %s" + +#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 +msgid "%s project directory" +msgstr "%s projekto katalogas" + +#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory +msgid "The %s project directory,%swhich contains the .dpr, dpk file." +msgstr "%s projekto katalogas, kuriame yra .dpr ir .dpk failai." + +#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: C:/Programme/Borland/Delphi%s" + +#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject +msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" +msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: /home/user/kylix%s" + +#: lazarusidestrconsts:liscodetoolsdefsexit +msgid "Exit" +msgstr "Išeiti" + +#: lazarusidestrconsts:liscodetoolsdefssaveandexit +msgid "Save and Exit" +msgstr "Išsaugoti ir išeiti" + +#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave +msgid "Exit without Save" +msgstr "Išeiti neišsaugojus" + +#: lazarusidestrconsts:liscodetoolsdefsedit +msgid "Edit" +msgstr "Keisti" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeup +msgid "Move node up" +msgstr "Perkelti mazgą aukštyn" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodedown +msgid "Move node down" +msgstr "Perkelti mazgą žemyn" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup +msgid "Move node one level up" +msgstr "Mazgą perkelti vienu lygiu aukščiau" + +#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown +msgid "Move node one level down" +msgstr "Mazgą perkelti vienu lygiu žemiau" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow +msgid "Insert node below" +msgstr "Įterpti mazgą žemiau" + +#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild +msgid "Insert node as child" +msgstr "Įterpti mazgą kaip vaiką" + +#: lazarusidestrconsts:liscodetoolsdefsdeletenode +msgid "Delete node" +msgstr "Pašalinti mazgą" + +#: lazarusidestrconsts:liscodetoolsdefsconvertnode +msgid "Convert node" +msgstr "Konvertuoti mazgą" + +#: lazarusidestrconsts:liscodetoolsdefsdefine +msgid "Define" +msgstr "Apibrėžti" + +#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse +msgid "Define Recurse" +msgstr "Rekursyviai apibrėžti" + +#: lazarusidestrconsts:liscodetoolsdefsundefine +msgid "Undefine" +msgstr "Padaryti neapibrėžtu" + +#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse +msgid "Undefine Recurse" +msgstr "Rekursyviai padaryti neapibrėžtu" + +#: lazarusidestrconsts:liscodetoolsdefsundefineall +msgid "Undefine All" +msgstr "Visus padaryti neapibrėžtais" + +#: lazarusidestrconsts:liscodetoolsdefsblock +msgid "Block" +msgstr "Blokas" + +#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory +msgid "Directory" +msgstr "Katalogas" + +#: lazarusidestrconsts:liscodetoolsdefsif +msgid "If" +msgstr "If" + +#: lazarusidestrconsts:liscodetoolsdefsifdef +msgid "IfDef" +msgstr "IfDef" + +#: lazarusidestrconsts:liscodetoolsdefsifndef +msgid "IfNDef" +msgstr "IfNDef" + +#: lazarusidestrconsts:liscodetoolsdefselseif +msgid "ElseIf" +msgstr "ElseIf" + +#: lazarusidestrconsts:liscodetoolsdefselse +msgid "Else" +msgstr "Else" + +#: lazarusidestrconsts:lisctdefstools +msgid "Tools" +msgstr "Įrankiai" + +#: lazarusidestrconsts:lisctdefsopenpreview +msgid "Open Preview" +msgstr "Atverti peržiūros langą" + +#: lazarusidestrconsts:liscodetoolsdefsinserttemplate +msgid "Insert Template" +msgstr "Įterpti šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte +msgid "Insert Free Pascal Project Template" +msgstr "Įterpti FreePascal projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert +msgid "Insert Free Pascal Compiler Template" +msgstr "Įterpti FreePascal kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource +msgid "Insert Free Pascal SVN Source Template" +msgstr "Įterpti FreePascal SVN pirminio kodo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem +msgid "Insert Lazarus Directory Template" +msgstr "Įterpti Lazarus katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp +msgid "Insert Delphi 5 Compiler Template" +msgstr "Įterpti Delphi 5 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem +msgid "Insert Delphi 5 Directory Template" +msgstr "Įterpti Delphi 5 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl +msgid "Insert Delphi 5 Project Template" +msgstr "Įterpti Delphi 5 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp +msgid "Insert Delphi 6 Compiler Template" +msgstr "Įterpti Delphi 6 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem +msgid "Insert Delphi 6 Directory Template" +msgstr "Įterpti Delphi 6 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl +msgid "Insert Delphi 6 Project Template" +msgstr "Įterpti Delphi 6 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp +msgid "Insert Delphi 7 Compiler Template" +msgstr "Įterpti Delphi 7 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem +msgid "Insert Delphi 7 Directory Template" +msgstr "Įterpti Delphi 7 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl +msgid "Insert Delphi 7 Project Template" +msgstr "Įterpti Delphi 7 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp +msgid "Insert Kylix 3 Compiler Template" +msgstr "Įterpti Kylix 3 kompiliatoriaus šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem +msgid "Insert Kylix 3 Directory Template" +msgstr "Įterpti Kylix 3 katalogo šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl +msgid "Insert Kylix 3 Project Template" +msgstr "Įterpti Kylix 3 projekto šabloną" + +#: lazarusidestrconsts:liscodetoolsdefsselectednode +msgid "Selected Node:" +msgstr "Pažymėtas mazgas:" + +#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly +msgid "Node and its children are only valid for this project" +msgstr "Mazgas ir jo vaikai galioja tik šiam projektui" + +#: lazarusidestrconsts:liscodetoolsdefsname +msgid "Name:" +msgstr "Vardas:" + +#: lazarusidestrconsts:liscodetoolsdefsdescription +msgid "Description:" +msgstr "Aprašymas:" + +#: lazarusidestrconsts:liscodetoolsdefsvariable +msgid "Variable:" +msgstr "Kintamasis:" + +#: lazarusidestrconsts:liscodetoolsdefsvalueastext +msgid "Value as Text" +msgstr "Reikšmė teksto pavidalu" + +#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths +msgid "Value as File Paths" +msgstr "Reikšmė failų kelių pavidalu" + +#: lazarusidestrconsts:liscodetoolsdefsaction +msgid "Action: %s" +msgstr "Veiksmas: %s" + +#: lazarusidestrconsts:liscodetoolsdefsautogenerated +msgid "%s, auto generated" +msgstr "%s, sukurtas automatiškai" + +#: lazarusidestrconsts:liscodetoolsdefsprojectspecific +msgid "%s, project specific" +msgstr "%s, priklauso nuo projekto" + +#: lazarusidestrconsts:liscodetoolsdefsnoneselected +msgid "none selected" +msgstr "nėra pažymėtų elementų" + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparent +msgid "Invalid parent" +msgstr "Klaidingas tėvas" + +#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen +msgid "A %s can not hold TControls.%sYou can only put non visual components on it." +msgstr "%s negali turėti TControl klasių.%sĮ jį galima dėti tik nevizualines komponentes." + +#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly +msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." +msgstr "Negalima keisti automatiškai sukurtų mazgų,%stačiau jie gali turėti neautomatiškai sukurtų mazgų-sūnų." + +#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode +msgid "Invalid parent node" +msgstr "Klaidingas tėvinis mazgas" + +#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch +msgid "Parent node can not contain child nodes." +msgstr "Tėvinis mazgas negali turėti mazgų-sūnų." + +#: lazarusidestrconsts:liscodetoolsdefsnewnode +msgid "NewNode" +msgstr "Mazgas" + +#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor +msgid "CodeTools Defines Editor" +msgstr "CodeTools apibrėžčių redaktorius" + +#: lazarusidestrconsts:liscodetempladdcodetemplate +msgid "Add code template" +msgstr "Pridėti kodo šabloną" + +#: lazarusidestrconsts:liscodetempladd +msgid "Add" +msgstr "Pridėti" + +#: lazarusidestrconsts:liscodetempleditcodetemplate +msgid "Edit code template" +msgstr "Keisti kodo šabloną" + +#: lazarusidestrconsts:liscodetemplchange +msgid "Change" +msgstr "Pakeisti" + +#: lazarusidestrconsts:liscodetempltoken +msgid "Token:" +msgstr "Leksema:" + +#: lazarusidestrconsts:liscodetemplcomment +msgid "Comment:" +msgstr "Komentaras:" + +#: lazarusidestrconsts:liscodetemplatokenalreadyexists +msgid " A token %s%s%s already exists! " +msgstr "Leksema %s%s%s jau egzistuoja! " + +#: lazarusidestrconsts:liscodetemplerror +msgid "Error" +msgstr "Klaida" + +#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades +msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." +msgstr "Konstruktorių atverti neis.%s Klasė %s nepaveldi vizualinės klasės, pavyzdžiui tokios kaip TForm ar TDataModule." + +#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic +msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." +msgstr "Klasė konfliktuoja su .lfm failu:%smodulis %s%s naudoja modulį %s,%skuriame yra klasė %s, %stačiau ,lfm faile įrašyta visai kita klasė.%sModulyje gali būti tik viena vizualinė klasė.%s%sPekelkit į kitą modulį." + +#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass +msgid "Unable to find the unit of component class %s%s%s." +msgstr "Nepavyko rasti komponentės klasės %s%s%s modulio." + +#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits +msgid "Unable to load the component class %s%s%s, because it depends on itself." +msgstr "Įkelti komponentės klasės %s%s%s nepavyks, nes ji turi priklausomybę pačiai sau." + +#: lazarusidestrconsts:liscancelloadingthiscomponent +msgid "Cancel loading this component" +msgstr "Neįkelti šio komponento" + +#: lazarusidestrconsts:lisabortwholeloading +msgid "Abort whole loading" +msgstr "Nutraukti įkėlimą" + +#: lazarusidestrconsts:lisignoreusetformasancestor +msgid "Ignore, use TForm as ancestor" +msgstr "Ignoruoti, TForm naudoti kaip protėvį." + +#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor +msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." +msgstr "Resursų klasė %s%s%s paveldėjama nuo %s%s%s. Greičiausiai rašybos klaida TForm'ai." + +#: lazarusidestrconsts:lismakeresourcestring +msgid "Make ResourceString" +msgstr "Kurti resursų eilutę" + +#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect +msgid "Invalid Resourcestring section" +msgstr "Klaidinga resursų eilutės sekcija" + +#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring +msgid "Please choose a resourstring section from the list." +msgstr "Resursų eilutės sekciją pasirinkite iš sąrašo." + +#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis +msgid "Resourcestring already exists" +msgstr "Tokia resursų eilutė jau yra" + +#: lazarusidestrconsts:lismakeresstrchooseanothername +msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." +msgstr "Tokia resursų eilutė %s%s%s jau yra.%sParinkite kitokį vardą.%sNorint ją įdėti to nepaisant, spauskite \"Ignoruoti\"." + +#: lazarusidestrconsts:lismakeresstrstringconstantinsource +msgid "String constant in source" +msgstr "Teksto konstanta pirminiame kode" + +#: lazarusidestrconsts:lismakeresstrconversionoptions +msgid "Conversion Options" +msgstr "Konvertavimo parinktys" + +#: lazarusidestrconsts:lismakeresstridentifierprefix +msgid "Identifier prefix:" +msgstr "Identifikatoriaus prefiksas:" + +#: lazarusidestrconsts:lismakeresstridentifierlength +msgid "Identifier length:" +msgstr "Identifikatoriaus ilgis:" + +#: lazarusidestrconsts:lismakeresstrdialogidentifier +msgid "Identifier" +msgstr "Identifikatorius" + +#: lazarusidestrconsts:lismakeresstrcustomidentifier +msgid "Custom identifier" +msgstr "Naudotojo identifikatorius" + +#: lazarusidestrconsts:lismakeresstrresourcestringsection +msgid "Resourcestring section:" +msgstr "Išteklių eilutės sekcija:" + +#: lazarusidestrconsts:lismakeresstrstringswithsamevalue +msgid "Strings with same value:" +msgstr "Eilutės su tokia pat reikšme:" + +#: lazarusidestrconsts:lismakeresstrappendtosection +msgid "Append to section" +msgstr "Tiesiog pridėti" + +#: lazarusidestrconsts:lismakeresstrinsertalphabetically +msgid "Insert alphabetically" +msgstr "Įterpti pagal abėcėlę" + +#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive +msgid "Insert context sensitive" +msgstr "Įterpti pagal kontekstą" + +#: lazarusidestrconsts:lismakeresstrsourcepreview +msgid "Source preview" +msgstr "Pirminio kodo peržiūra" + +#: lazarusidestrconsts:lisnostringconstantfound +msgid "No string constant found" +msgstr "Nerasta teksto konstanta" + +#: lazarusidestrconsts:lissuccess +msgid "Success" +msgstr "Tvarka" + +#: lazarusidestrconsts:lisallblockslooksok +msgid "All blocks looks ok." +msgstr "Visi blokai geri." + +#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon +msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." +msgstr "Funkcijai \"Kurti išteklių eilutę\" reikia pažymėtos teksto konstantos.%sTad pažymėkite išraišką ir bandykite vėl." + +#: lazarusidestrconsts:lisdiffdlgtext1 +msgid "Text1" +msgstr "Tekstas1" + +#: lazarusidestrconsts:lisdiffdlgonlyselection +msgid "Only selection" +msgstr "Tik pažymėtoje srityje" + +#: lazarusidestrconsts:lisdiffdlgtext2 +msgid "Text2" +msgstr "Tekstas2" + +#: lazarusidestrconsts:lisdiffdlgcaseinsensitive +msgid "Case Insensitive" +msgstr "Skirti didžiąsias ir mažąsias raides" + +#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd +msgid "Ignore if empty lines were added or removed" +msgstr "Nepaisyti įdėtų ar pašalintų tuščių eilučių" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline +msgid "Ignore spaces at start of line" +msgstr "Nepaisyti tarpo simbolių eilutės pradžioje" + +#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline +msgid "Ignore spaces at end of line" +msgstr "Nepaisyti tarpo simbolių eilutės gale" + +#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe +msgid "Ignore difference in line ends (e.g. #10 = #13#10)" +msgstr "Nepaisyti naujos eilutės tipų (pvz.: #10 = #13#10)" + +#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd +msgid "Ignore amount of space chars" +msgstr "Nepaisyti tam tikro tarpo simbolių kiekio" + +#: lazarusidestrconsts:lisdiffdlgignorespaces +msgid "Ignore spaces (newline chars not included)" +msgstr "Nepaisyti tarpo simbolių (neskaitant naujos eilutės simbolių)" + +#: lazarusidestrconsts:lisdiffdlgopendiffineditor +msgid "Open Diff in editor" +msgstr "Diff atverti redaktoriuje" + +#: lazarusidestrconsts:lissave +msgid "Save ..." +msgstr "Išsaugoti" + +#: lazarusidestrconsts:listodolistcaption +msgid "ToDo List" +msgstr "ToDo sąrašas" + +#: lazarusidestrconsts:listodolistrefresh +msgid "Refresh todo items" +msgstr "Atnaujinti ToDo sąrašą" + +#: lazarusidestrconsts:listodolistgotoline +msgid "Goto selected source line" +msgstr "Rodyti eilutę pirminiame kode" + +#: lazarusidestrconsts:listodolistprintlist +msgid "Print todo items" +msgstr "Spauzdinti ToDo sąrašą" + +#: lazarusidestrconsts:listodolistoptions +msgid "ToDo options..." +msgstr "ToDo parinktys..." + +#: lazarusidestrconsts:listodoldescription +msgid "Description" +msgstr "Aprašymas" + +#: lazarusidestrconsts:lisctinsertmacro +msgid "Insert Macro" +msgstr "Įterpti makrokomandą" + +#: lazarusidestrconsts:listodolfile +msgid "File" +msgstr "Failas" + +#: lazarusidestrconsts:listodolline +msgid "Line" +msgstr "Eilutė" + +#: lazarusidestrconsts:lispkgfiletypeunit +msgid "Unit" +msgstr "Modulis" + +#: lazarusidestrconsts:lispkgfiletypevirtualunit +msgid "Virtual Unit" +msgstr "Virtualus modulis" + +#: lazarusidestrconsts:lispkgfiletypelfm +msgid "LFM - Lazarus form text" +msgstr "LFM - Lazarus formos kodas" + +#: lazarusidestrconsts:lispkgfiletypelrs +msgid "LRS - Lazarus resource" +msgstr "LRS - Lazarus ištekliai" + +#: lazarusidestrconsts:lispkgfiletypeinclude +msgid "Include file" +msgstr "Įtraukiamasis" + +#: lazarusidestrconsts:lispkgfiletypetext +msgid "Text" +msgstr "Teksto" + +#: lazarusidestrconsts:lispkgfiletypebinary +msgid "Binary" +msgstr "Dvejetainis" + +#: lazarusidestrconsts:lisviewprojectunits +msgid "View Project Units" +msgstr "Projekto moduliai" + +#: lazarusidestrconsts:lisinformationaboutunit +msgid "Information about %s" +msgstr "Informacija apie modulį %s" + +#: lazarusidestrconsts:lisuidyes +msgid "yes" +msgstr "taip" + +#: lazarusidestrconsts:lisuidno +msgid "no" +msgstr "ne" + +#: lazarusidestrconsts:lisuidbytes +msgid "%s bytes" +msgstr "% baitų" + +#: lazarusidestrconsts:lisuidname +msgid "Name:" +msgstr "Vardas:" + +#: lazarusidestrconsts:lisuidtype +msgid "Type:" +msgstr "Tipas:" + +#: lazarusidestrconsts:lisuidinproject +msgid "in Project:" +msgstr "Projekte:" + +#: lazarusidestrconsts:lisuidincludedby +msgid "Included by:" +msgstr "Jį įtraukia:" + +#: lazarusidestrconsts:lisuidclear +msgid "Clear" +msgstr "Išvalyti" + +#: lazarusidestrconsts:lisuidpathsreadonly +msgid "Paths (Read Only)" +msgstr "Keliai (tik skaitymui)" + +#: lazarusidestrconsts:lisuidunit +msgid "Unit" +msgstr "Modulis" + +#: lazarusidestrconsts:lisuidsrc +msgid "Src" +msgstr "pirm.kod." + +#: lazarusidestrconsts:lisuidok +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:lisuidsize +msgid "Size:" +msgstr "Dydis:" + +#: lazarusidestrconsts:lisuidlines +msgid "Lines:" +msgstr "Eilučių:" + +#: lazarusidestrconsts:lisuishowcodetoolsvalues +msgid "Show CodeTools Values" +msgstr "Rodyti CodeTools reikšmes" + +#: lazarusidestrconsts:lisueerrorinregularexpression +msgid "Error in regular expression" +msgstr "Klaidingas reguliarusis reiškinys" + +#: lazarusidestrconsts:lissearchfor +msgid "Search For " +msgstr "Ko ieškoti" + +#: lazarusidestrconsts:lisuenotfound +msgid "Not found" +msgstr "Nerasta" + +#: lazarusidestrconsts:lisuesearchstringnotfound +msgid "Search string '%s' not found!" +msgstr "Ieškomasis tekstas %s nerastas!" + +#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith +msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" +msgstr "Pakeisti rastąjį %s%s%s%s į %s%s%s?" + +#: lazarusidestrconsts:lisuesearching +msgid "Searching: %s" +msgstr "Ieškoma: %s" + +#: lazarusidestrconsts:lisuereadonly +msgid "%s/ReadOnly" +msgstr "%s/Tik skaitymui" + +#: lazarusidestrconsts:lisuegotoline +msgid "Goto line :" +msgstr "Rodyti eilutę:" + +#: lazarusidestrconsts:listmfunctionextractfileextension +msgid "Function: extract file extension" +msgstr "Funkcija: ištraukti tik failo prievardį" + +#: lazarusidestrconsts:listmfunctionextractfilepath +msgid "Function: extract file path" +msgstr "Funkcija: ištraukti tik kelią" + +#: lazarusidestrconsts:listmfunctionextractfilenameextension +msgid "Function: extract file name+extension" +msgstr "Funkcija: ištraukti failo vardą ir prievardį" + +#: lazarusidestrconsts:listmfunctionextractfilenameonly +msgid "Function: extract file name only" +msgstr "Funkcija: ištraukti tik failo vardą" + +#: lazarusidestrconsts:listmfunctionappendpathdelimiter +msgid "Function: append path delimiter" +msgstr "Funkcija: kelio gale pridėti kelio skirtuką" + +#: lazarusidestrconsts:listmfunctionchomppathdelimiter +msgid "Function: chomp path delimiter" +msgstr "Funkcija: pašalinti kelio gale esantį skirtuką" + +#: lazarusidestrconsts:listmunknownmacro +msgid "(unknown macro: %s)" +msgstr "(nežinoma makrokomanda: %s)" + +#: lazarusidestrconsts:lissvuoinvalidvariablename +msgid "Invalid variable name" +msgstr "Klaidingas kintamojo vardas" + +#: lazarusidestrconsts:lissvuoisnotavalididentifier +msgid "%s%s%s is not a valid identifier." +msgstr "Identifikatorius %s%s%s klaidingas." + +#: lazarusidestrconsts:lisfriidentifier +msgid "Identifier: %s" +msgstr "Identifikatorius: %s" + +#: lazarusidestrconsts:lissvuooverridesystemvariable +msgid "Override system variable" +msgstr "Kurti viršesnį sistemos kintamąjį" + +#: lazarusidestrconsts:lissvuook +msgid "Ok" +msgstr "Tinka" + +#: lazarusidestrconsts:lissortselsortselection +msgid "Sort selection" +msgstr "Rūšiuoti pažymėtą" + +#: lazarusidestrconsts:lissortselpreview +msgid "Preview" +msgstr "Peržiūra" + +#: lazarusidestrconsts:lissortselascending +msgid "Ascending" +msgstr "Didėjanti" + +#: lazarusidestrconsts:lissortseldescending +msgid "Descending" +msgstr "Mažėjanti" + +#: lazarusidestrconsts:lissortseldomain +msgid "Domain" +msgstr "Sritis" + +#: lazarusidestrconsts:lissortsellines +msgid "Lines" +msgstr "Eilutės" + +#: lazarusidestrconsts:lissortselwords +msgid "Words" +msgstr "Žodžiai" + +#: lazarusidestrconsts:lissortselparagraphs +msgid "Paragraphs" +msgstr "Pastraipos" + +#: lazarusidestrconsts:lissortseloptions +msgid "Options" +msgstr "Parinktys" + +#: lazarusidestrconsts:lissortselcasesensitive +msgid "Case Sensitive" +msgstr "Atsižvelgti į raidžių lygį" + +#: lazarusidestrconsts:lissortselignorespace +msgid "Ignore Space" +msgstr "Tarpai nesvarbūs" + +#: lazarusidestrconsts:lissortselsort +msgid "Accept" +msgstr "Rūšiuoti" + +#: lazarusidestrconsts:lissortselcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lazarusidestrconsts:lispublprojinvalidincludefilter +msgid "Invalid Include filter" +msgstr "Klaidingas įtraukiamųjų filtras" + +#: lazarusidestrconsts:lispublprojinvalidexcludefilter +msgid "Invalid Exclude filter" +msgstr "Klaidingas neįtraukiamųjų filtras" + +#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist +msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." +msgstr "Programos pirminiame kode nepavyko pakeisti automatiškai kuriamų formų sąrašą.%sSusimildami, pirmiausiai ištaisykit klaidas." + +#: lazarusidestrconsts:lisprojoptserror +msgid "Error" +msgstr "Klaida" + +#: lazarusidestrconsts:lispatheditselectdirectory +msgid "Select directory" +msgstr "Rinkitės katalogą" + +#: lazarusidestrconsts:lispatheditsearchpaths +msgid "Search paths:" +msgstr "Ieškos keliai:" + +#: lazarusidestrconsts:lispatheditmovepathdown +msgid "Move path down" +msgstr "Perkelti kelią žemyn" + +#: lazarusidestrconsts:lispatheditmovepathup +msgid "Move path up" +msgstr "Perkelti kelią aukštyn" + +#: lazarusidestrconsts:lispatheditbrowse +msgid "Browse" +msgstr "Naršyti" + +#: lazarusidestrconsts:lispatheditpathtemplates +msgid "Path templates" +msgstr "Kelio šablonai" + +#: lazarusidestrconsts:lisnewdlgnoitemselected +msgid "No item selected" +msgstr "Nėra pažymėtų elementų" + +#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst +msgid "Please select an item first." +msgstr "Būtina pažymėti kurį nors iš elementų." + +#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype +msgid "Create a new editor file.%sChoose a type." +msgstr "Kurti naują redaktoriaus failą.%sNurodykite jo tipą." + +#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype +msgid "Create a new project.%sChoose a type." +msgstr "Kurti naują projektą.%sNurodykite jo tipą." + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile +msgid "Choose one of these items to create a new File" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują failą" + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject +msgid "Choose one of these items to create a new Project" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują projektą" + +#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage +msgid "Choose one of these items to create a new Package" +msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują paketą" + +#: lazarusidestrconsts:lispackage +msgid "Package" +msgstr "Paketas" + +#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit +msgid "Create a new pascal unit." +msgstr "Kurti naują paskalio modulį." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform +msgid "Create a new unit with a LCL form." +msgstr "Kurti naują modulį su LCL forma." + +#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule +msgid "Create a new unit with a datamodule." +msgstr "Kurti naują modulį su duomenų moduliu." + +#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile +msgid "Create a new empty text file." +msgstr "Kurti naują tuščią teksto failą." + +#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi +msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." +msgstr "Įprastas Paskalio programos failas.%sŠitai galite naudoti greitam bei grubiam testui.%sGeriau kurkite naują projektą." + +#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication +msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują grafinę programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateanewprogram +msgid "Create a new program.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram +msgid "Create a new program." +msgstr "Kurti naują programą." + +#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained +msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." +msgstr "Kurti naują cgi programą.%sProgramos failu rūpinsis Lazarus." + +#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun +msgid "Create a new standard package.%sA package is a collection of units and components." +msgstr "Kurti naują standartinį paketą.%sPaketas- tai modulių bei komponentų rinkinys." + +#: lazarusidestrconsts:lisunabletocreatefile +msgid "Unable to create file" +msgstr "Failas nesiduoda sukuriamas" + +#: lazarusidestrconsts:liscannotcreatefile +msgid "Can not create file %s%s%s" +msgstr "Nepavyksta sukurti failą %s%s%s" + +#: lazarusidestrconsts:lisextendunitpath +msgid "Extend unit path?" +msgstr "Išplėsti modulio kelią?" + +#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit +msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" +msgstr "Katalogas %s%s%s nefigūruoja modulio kelyje.%sPridėti katalogą prie modulio kelio?" + +#: lazarusidestrconsts:lisunabletocreatefilename +msgid "Unable to create file %s%s%s." +msgstr "Nepavyko sukurti failą %s%s%s." + +#: lazarusidestrconsts:lisunabletowritefile +msgid "Unable to write file" +msgstr "Nepavyko rašyti į failą" + +#: lazarusidestrconsts:lisunabletowritefile2 +msgid "Unable to write file %s%s%s" +msgstr "Nepavyko rašyti į failą %s%s%s" + +#: lazarusidestrconsts:lisfileisnotwritable +msgid "File is not writable" +msgstr "Failas tik skaitymui" + +#: lazarusidestrconsts:lisunabletowritetofile2 +msgid "Unable to write to file %s%s%s" +msgstr "Neįmanoma rašyti į failą %s%s%s" + +#: lazarusidestrconsts:lisunabletowritefilename +msgid "Unable to write file %s%s%s." +msgstr "Nepavyko rašyti į failą %s%s%s." + +#: lazarusidestrconsts:lisunabletoreadfile +msgid "Unable to read file" +msgstr "Nepavyko įkelti failą" + +#: lazarusidestrconsts:lisunabletoreadfilename +msgid "Unable to read file %s%s%s." +msgstr "Nepavyko įkelti failą %s%s%s." + +#: lazarusidestrconsts:liserrordeletingfile +msgid "Error deleting file" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:lisunabletodeleteambiguousfile +msgid "Unable to delete ambiguous file %s%s%s" +msgstr "Nepavyko ištrinti neaiškųjį failą %s%s%s" + +#: lazarusidestrconsts:liserrorrenamingfile +msgid "Error renaming file" +msgstr "Nepavyko pervardyti failą" + +#: lazarusidestrconsts:lisunabletorenameambiguousfileto +msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" +msgstr "Nepavyko neaiškųjį failą %s%s%s%spervardyti į %s%s%s" + +#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis +msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" +msgstr "Dėmesio: rastas neaiškus failas: %s%s%s. Pirminio kodo failas: %s%s%s" + +#: lazarusidestrconsts:lisambiguousfilefound +msgid "Ambiguous file found" +msgstr "Rastas neaiškus failas" + +#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension +msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" +msgstr "Rastas kitas failas tokiu pat vardu bei panašiu prievardžiu.%sFailas: %s%sNeaiškusis failas: %s%s%sPašalinti neaiškųjį failą?" + +#: lazarusidestrconsts:lisprojaddinvalidminmaxversion +msgid "Invalid Min-Max version" +msgstr "Klaidingos versijos ribos" + +#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion +msgid "The Maximum Version is lower than the Minimim Version." +msgstr "Maksimali versija žemesnė nei minimali" + +#: lazarusidestrconsts:lisprojaddinvalidpackagename +msgid "Invalid packagename" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag +msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." +msgstr "Paketo vardas %s%s%s klaidingas%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisprojadddependencyalreadyexists +msgid "Dependency already exists" +msgstr "Priklausomybė jau yra" + +#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency +msgid "The project has already a dependency for the package %s%s%s." +msgstr "Projektas jau turi priklausomybe paketui %s%s%s." + +#: lazarusidestrconsts:lisprojaddpackagenotfound +msgid "Package not found" +msgstr "Paketas nerastas" + +#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage +msgid "This file is not in any loaded package." +msgstr "Failas nerastas nėviename įkeltame pakete" + +#: lazarusidestrconsts:lisprojaddthedependencywasnotfound +msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." +msgstr "Priklausinys %s%s%s nerastas.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisprojaddinvalidversion +msgid "Invalid version" +msgstr "Klaidinga versija" + +#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid +msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" + +#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid +msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Maksimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" + +#: lazarusidestrconsts:lisprojaddinvalidpascalunitname +msgid "Invalid pascal unit name" +msgstr "Klaidingas paskalio modulio vardas" + +#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier +msgid "The unit name %s%s%s is not a valid pascal identifier." +msgstr "Modulio vardas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lisprojaddunitnamealreadyexists +msgid "Unit name already exists" +msgstr "Modulio vardas jau egzistuoja" + +#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject +msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." +msgstr "Pridedamojo modulio vardas %s%s%s jau figūruoja šiame projekte,%sžvilgterėkit į projekto failą: %s%s%s." + +#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection +msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." +msgstr "Pridedamųjų failų sąraše yra keli moduliai tokiu pat vardu %s%s%s,%svieno iš jų failas: %s%s%s." + +#: lazarusidestrconsts:lisprojaddtoproject +msgid "Add to project" +msgstr "Įdėti į projektą" + +#: lazarusidestrconsts:lisprojaddnewrequirement +msgid "New Requirement" +msgstr "Nauja priklausomybė" + +#: lazarusidestrconsts:lisprojaddfiles +msgid "Add files" +msgstr "Pridėti failus" + +#: lazarusidestrconsts:lisprojaddeditorfile +msgid "Add editor files" +msgstr "Pridėti redaktoriaus failus" + +#: lazarusidestrconsts:lisprojaddaddfiletoproject +msgid "Add file to project:" +msgstr "Įdėti failą į projektą:" + +#: lazarusidestrconsts:lisprojaddpackagename +msgid "Package Name:" +msgstr "Paketo vardas:" + +#: lazarusidestrconsts:lisprojaddminimumversionoptional +msgid "Minimum Version (optional):" +msgstr "Minimali versija (nebūtina):" + +#: lazarusidestrconsts:lisprojaddmaximumversionoptional +msgid "Maximum Version (optional):" +msgstr "Maksimali versija (nebūtina)" + +#: lazarusidestrconsts:liscomppalopenpackage +msgid "Open package" +msgstr "Atverti paketą" + +#: lazarusidestrconsts:liskmopenpackagefile +msgid "Open package file" +msgstr "Atverti paketo failą" + +#: lazarusidestrconsts:liscpopenpackage +msgid "Open Package %s" +msgstr "Atverti paketą %s" + +#: lazarusidestrconsts:liscpopenunit +msgid "Open Unit %s" +msgstr "Atverti modulį %s" + +#: lazarusidestrconsts:liscomppalopenunit +msgid "Open unit" +msgstr "Atverti modulį" + +#: lazarusidestrconsts:liscomppalfindcomponent +msgid "Find component" +msgstr "Ieškoti komponentės" + +#: lazarusidestrconsts:lismacropromptenterdata +msgid "Enter data" +msgstr "Įveskite duomenis" + +#: lazarusidestrconsts:lismacropromptenterrunparameters +msgid "Enter run parameters" +msgstr "Įveskite starto parametrus" + +#: lazarusidestrconsts:lisdebuggererror +msgid "Debugger error" +msgstr "Derintuvės klaida" + +#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate +msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." +msgstr "Derintuvės klaida%sAmen! Derintuvė praranda stabilumą!%sNedelsdami išsaugokite darbo rezultatus!%sSpauskite \"Stabdyti\", ir tikėkitės kad viskas baigsis laimingai..." + +#: lazarusidestrconsts:lisexecutionstopped +msgid "Execution stopped" +msgstr "Veika sustabdyta" + +#: lazarusidestrconsts:lisexecutionstoppedon +msgid "Execution stopped%s" +msgstr "Veika sustabdyta%s" + +#: lazarusidestrconsts:lisexecutionpaused +msgid "Execution paused" +msgstr "Veika pristabdyta" + +#: lazarusidestrconsts:lisexecutionpausedadress +msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" +msgstr "Veika pristabdyta%s Adresas: $%s%s Procedūra: %s%s Failas: %s%s(Tarp kitko, kadanors čia turėtų pasirodyti asemblerio langas :)%s" + +#: lazarusidestrconsts:lisfilenotfound +msgid "File not found" +msgstr "Failas nerastas" + +#: lazarusidestrconsts:liscleanupunitpath +msgid "Clean up unit path?" +msgstr "Apvalyti modulio kelią?" + +#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit +msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" +msgstr "Katalogo įrašas %s%s%s nebebūtinas modulio kelyje.%sPašalinti katalogo įrašą?" + +#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself +msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" +msgstr "Failas %s%s%s%s nerastas.%sIeškosite patys?%s" + +#: lazarusidestrconsts:lisruntofailed +msgid "Run-to failed" +msgstr "Nepavyko Startuoti-Iki" + +#: lazarusidestrconsts:lisdbgmangnodebuggerspecified +msgid "No debugger specified" +msgstr "Nenurodyta derintuvė" + +#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno +msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." +msgstr "Nenurodyta derintuvė.%sStabdos taškai neveiks kol nebus nurodyta derintuvė. Ji nurodoma menių esančiame derintuvės parinkčių dialoge." + +#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway +msgid "Set the breakpoint anyway" +msgstr "Vistiek padėti stabdos tašką" + +#: lazarusidestrconsts:lislaunchingapplicationinvalid +msgid "Launching application invalid" +msgstr "Netinkama paleidžiančioji programa" + +#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta +msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" +msgstr "Nerasta paleidžiančioji programa%s%s%s%s, arba ji nėra paleidžiamasis failas.%s%sŽvilgterėkit į \"Startuoti -> Startavimo parametrai -> Vietiniai\"." + +#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists +msgid "The launching Application Bundle %s%s%s%sdoes not exist or is not executable.%s%sSee Project -> Project options -> Application." +msgstr "Paleidžiančioji programa-rišulys %s%s%s%s nerasta, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Projektas -> Projekto parinktys -> Programa\"." + +#: lazarusidestrconsts:lisdebuggerinvalid +msgid "Debugger invalid" +msgstr "Netinkama derintuvė" + +#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro +msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" +msgstr "Nerasta derintuvė %s%s%s%s, arba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Aplinka -> Derintuvės parinktys\"." + +#: lazarusidestrconsts:lispleaseopenaunitbeforerun +msgid "Please open a unit before run." +msgstr "Prieš startuojant atverkite modulį." + +#: lazarusidestrconsts:lisdiskdifferrorreadingfile +msgid "Error reading file: %s" +msgstr "Klaida skaitant failą: %s" + +#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk +msgid "Some files have changed on disk:" +msgstr "Kai kurie failai buvo pakeisti iš išorės:" + +#: lazarusidestrconsts:lisdiskdiffchangedfiles +msgid "Changed files:" +msgstr "Pakeisti failai:" + +#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff +msgid "Click on one of the above items to see the diff" +msgstr "Spustelėjus ant elemento bus parodytas jo diff" + +#: lazarusidestrconsts:lisdiskdiffrevertall +msgid "Reload from disk" +msgstr "Įkelti išnaujo" + +#: lazarusidestrconsts:lisdiskdiffignorediskchanges +msgid "Ignore disk changes" +msgstr "Ignoruoti pasikeitimus diske" + +#: lazarusidestrconsts:lisedtdefcurrentproject +msgid "Current Project" +msgstr "Veikiamasis projektas" + +#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory +msgid "Current Project Directory" +msgstr "Veikiamasis projekto katalogas" + +#: lazarusidestrconsts:lisedtdefprojectsrcpath +msgid "Project SrcPath" +msgstr "Projekto SrcPath" + +#: lazarusidestrconsts:lisedtdefprojectincpath +msgid "Project IncPath" +msgstr "Projekto IncPath" + +#: lazarusidestrconsts:lisedtdefprojectunitpath +msgid "Project UnitPath" +msgstr "Projekto UnitPath" + +#: lazarusidestrconsts:lisedtdefallpackages +msgid "All packages" +msgstr "Visi paketai" + +#: lazarusidestrconsts:lisedtdefsallprojects +msgid "All projects" +msgstr "Visi projektai" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi +msgid "set FPC mode to DELPHI" +msgstr "perjungti FPC veikseną į DELPHI" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetotp +msgid "set FPC mode to TP" +msgstr "perjungti FPC veikseną į TP" + +#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc +msgid "set FPC mode to GPC" +msgstr "perjungti FPC veikseną į GPC" + +#: lazarusidestrconsts:lisedtdefsetiocheckson +msgid "set IOCHECKS on" +msgstr "Įjungti IOCHECKS" + +#: lazarusidestrconsts:lisedtdefsetrangecheckson +msgid "set RANGECHECKS on" +msgstr "Įjungti RANGECHECKS" + +#: lazarusidestrconsts:lisedtdefsetoverflowcheckson +msgid "set OVERFLOWCHECKS on" +msgstr "Įjungti OVERFLOWCHECKS" + +#: lazarusidestrconsts:lisedtdefuselineinfounit +msgid "use LineInfo unit" +msgstr "naudoti LineInfo modulį" + +#: lazarusidestrconsts:lisedtdefuseheaptrcunit +msgid "use HeapTrc unit" +msgstr "naudoti HeapTrc modulį" + +#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition +msgid "Global Source Path addition" +msgstr "Priedas prie pradinio kodo globalaus katalogo" + +#: lazarusidestrconsts:lisexttoolfailedtoruntool +msgid "Failed to run tool" +msgstr "Nepavyko startuoti įrankį" + +#: lazarusidestrconsts:lisexttoolunabletorunthetool +msgid "Unable to run the tool %s%s%s:%s%s" +msgstr "Nepavyko startuoti įrankį %s%s%s:%s%s" + +#: lazarusidestrconsts:lisexttoolexternaltools +msgid "External tools" +msgstr "Išorės įrankiai" + +#: lazarusidestrconsts:lisexttoolremove +msgid "Remove" +msgstr "Pašalinti" + +#: lazarusidestrconsts:liskeepthemandcontinue +msgid "Keep them and continue" +msgstr "Jį palikti ir tęsti" + +#: lazarusidestrconsts:lisremovethem +msgid "Remove them" +msgstr "Pašalinti elementą" + +#: lazarusidestrconsts:lisexttoolmoveup +msgid "Up" +msgstr "Viršun" + +#: lazarusidestrconsts:lisexttoolmovedown +msgid "Down" +msgstr "Apačion" + +#: lazarusidestrconsts:lisexttoolmaximumtoolsreached +msgid "Maximum Tools reached" +msgstr "Perdaug įrankių" + +#: lazarusidestrconsts:lisexttoolthereisamaximumoftools +msgid "There is a maximum of %s tools." +msgstr "Čia daugiausia gali būti %s įrankių." + +#: lazarusidestrconsts:lisedtexttooledittool +msgid "Edit Tool" +msgstr "Keisti įrankį" + +#: lazarusidestrconsts:lisedtexttoolprogramfilename +msgid "Programfilename:" +msgstr "Programos failo vardas:" + +#: lazarusidestrconsts:lisedtexttoolparameters +msgid "Parameters:" +msgstr "Parametrai:" + +#: lazarusidestrconsts:lisedtexttoolworkingdirectory +msgid "Working Directory:" +msgstr "Darbinis katalogas:" + +#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages +msgid "Scan output for Free Pascal Compiler messages" +msgstr "Išvestyje ieškoti FreePascalCompiler pranešimų" + +#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages +msgid "Scan output for make messages" +msgstr "Išvestyje ieškoti make pranešimų" + +#: lazarusidestrconsts:lisedtexttoolkey +msgid "Key" +msgstr "Klavišas" + +#: lazarusidestrconsts:lisedtexttoolctrl +msgid "Ctrl" +msgstr "Ctrl" + +#: lazarusidestrconsts:lisedtexttoolalt +msgid "Alt" +msgstr "Alt" + +#: lazarusidestrconsts:lisedtexttoolshift +msgid "Shift" +msgstr "Shift" + +#: lazarusidestrconsts:lisedtexttoolmacros +msgid "Macros" +msgstr "Makrokomandos" + +#: lazarusidestrconsts:lisworkingdirectoryforbuilding +msgid "Working directory for building" +msgstr "Darbinis katalogas darant" + +#: lazarusidestrconsts:lisworkingdirectoryforrun +msgid "Working directory for run" +msgstr "Darbinis katalogas startuojant" + +#: lazarusidestrconsts:lisconfigurebuild +msgid "Configure Build %s" +msgstr "Derinti %s daryklę" + +#: lazarusidestrconsts:lisedtexttoolinsert +msgid "Insert" +msgstr "Įterpti" + +#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired +msgid "Title and Filename required" +msgstr "Reikia pavadinimo ir failo vardo" + +#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename +msgid "A valid tool needs at least a title and a filename." +msgstr "Įrankiui mažų mažiausia reikia pavadinimo ir failo vardo." + +#: lazarusidestrconsts:lisfindfiletexttofind +msgid "Text to find:" +msgstr "Ieškoti teksto:" + +#: lazarusidestrconsts:lisfindfilecasesensitive +msgid "Case sensitive" +msgstr "Svarbu raidžių lygis" + +#: lazarusidestrconsts:lisfindfilewholewordsonly +msgid "Whole words only" +msgstr "Tik visų žodžių" + +#: lazarusidestrconsts:lisfindfileregularexpressions +msgid "Regular expressions" +msgstr "Reguliarusis reiškinys" + +#: lazarusidestrconsts:lisfindfilemultiline +msgid "Multiline pattern" +msgstr "Kelių eilučių modelis" + +#: lazarusidestrconsts:lisfindfilewhere +msgid "Where" +msgstr "Kur" + +#: lazarusidestrconsts:lisfindfilesearchallfilesinproject +msgid "search all files in project" +msgstr "ieškoti visuose projekto failuose" + +#: lazarusidestrconsts:lisfindfilesearchallopenfiles +msgid "search all open files" +msgstr "ieškoti visuose atvertuose failuose" + +#: lazarusidestrconsts:lisfindfilesearchindirectories +msgid "search in directories" +msgstr "ieškoti kataloguose" + +#: lazarusidestrconsts:lisfindfiledirectoryoptions +msgid "Directory options" +msgstr "Katalogo parinktys" + +#: lazarusidestrconsts:lisfindfilefilemaskbak +msgid "File mask (*;*.*;*.bak?)" +msgstr "Failų vardų kaukė (*;*.*;*.bak?)" + +#: lazarusidestrconsts:lisfindfileincludesubdirectories +msgid "Include sub directories" +msgstr "Ir pakatologiuose" + +#: lazarusidestrconsts:lisfindfileonlytextfiles +msgid "Only text files" +msgstr "Tik teksto failai" + +#: lazarusidestrconsts:lispkgmangpackage +msgid "Package: %s" +msgstr "Paketui: %s" + +#: lazarusidestrconsts:lispkgmangproject +msgid "Project: %s" +msgstr "Projektui: %s" + +#: lazarusidestrconsts:lispkgmanglazarus +msgid "Lazarus" +msgstr "Lazarus" + +#: lazarusidestrconsts:lispkgmangdependencywithoutowner +msgid "Dependency without Owner: %s" +msgstr "Priklausomybė neturi šeimininko: %s" + +#: lazarusidestrconsts:lispkgmangsavepackagelpk +msgid "Save Package %s (*.lpk)" +msgstr "Išsaugoti paketą %s (*.lpk)" + +#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension +msgid "Invalid package file extension" +msgstr "Klaidingas paketo failo prievardis" + +#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk +msgid "Packages must have the extension .lpk" +msgstr "Paketų failų prievardis turi būti .lpk" + +#: lazarusidestrconsts:lispkgmanginvalidpackagename +msgid "Invalid package name" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean +msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" +msgstr "Paketo vardas %s%s%s yra klaidingas.%sParinkite kitokį vardą (pvz.: paketas.lpk)" + +#: lazarusidestrconsts:lispkgmangrenamefilelowercase +msgid "Rename File lowercase?" +msgstr "Failo varde vien mažosios raidės?" + +#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto +msgid "Should the file be renamed lowercase to%s%s%s%s?" +msgstr "Failo vardą rašyti vien mažosiomis raidėmis:%s%s%s%s?" + +#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists +msgid "Package name already exists" +msgstr "Paketas šiuo vardu jau egzistuoja" + +#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename +msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" +msgstr "Aptiktas paketas jau naudojantis vardą %s%s%s.%sKonfliktinis paketas: %s%s%s%sFailas: %s%s%s" + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject +msgid "Filename is used by project" +msgstr "Failo vardą naudoja projektas" + +#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject +msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." +msgstr "Failo vardas %s%s%s yra šio projekto dalis%sProjektai ir paketai neturėtų dalintis failais." + +#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage +msgid "Filename is used by other package" +msgstr "Failo vardą naudoja kitas paketas" + +#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile +msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." +msgstr "Failo vardą %s%s%s naudoja%spaketas %s%s%s%s, esantis faile %s%s%s." + +#: lazarusidestrconsts:lispkgmangreplacefile +msgid "Replace File" +msgstr "Pakeisti failą" + +#: lazarusidestrconsts:lispkgmangreplaceexistingfile +msgid "Replace existing file %s%s%s?" +msgstr "Pakeisti esamą failą %s%s%s?" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile +msgid "Delete Old Package File?" +msgstr "Ištrinti seną paketo failą?" + +#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 +msgid "Delete old package file %s%s%s?" +msgstr "Ištrinti seną paketo failą %s%s%s?" + +#: lazarusidestrconsts:lispkgmangdeletefailed +msgid "Delete failed" +msgstr "Nepavyko ištrinti" + +#: lazarusidestrconsts:lisambiguousunitfound +msgid "Ambiguous Unit found" +msgstr "Rastas neaiškus modulis" + +#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac +msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" +msgstr "Failas %s%s%s%s rastas viename iš paketo %s pradinio kodo katalogų. Panašu kad failas yra kompiliuotas modulis. Kompiliuoti moduliai turi būti paketo išvesties kataloge, kitaip gali kilti problemų kitiems paketams naudojant šį paketą.%s%sPašalinti šį neaiškųjį failą?" + +#: lazarusidestrconsts:lispkgmangunabletodeletefile +msgid "Unable to delete file %s%s%s." +msgstr "Nepavyko ištrinti failą %s%s%s." + +#: lazarusidestrconsts:lisdeleteallthesefiles +msgid "Delete all these files?" +msgstr "Pašalinti visus šiuos failus?" + +#: lazarusidestrconsts:lispkgmangunsavedpackage +msgid "Unsaved package" +msgstr "Neišsaugotas paketas" + +#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages +msgid "There is an unsaved package in the required packages. See package graph." +msgstr "Reikiamuose paketuose aptiktas neišsaugotas paketas. Žvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lispkgmangbrokendependency +msgid "Broken dependency" +msgstr "Sugadinta priklausomybė" + +#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound +msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." +msgstr "Projektui reikia paketo %s%s%s.%sTačiau jo nepavyko rasti. Žvilgterėkit į \"Projektas -> Projekto inspektorius\"." + +#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound +msgid "A required packages was not found. See package graph." +msgstr "Nerasti reikiami paketai. Žvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies +msgid "Circle in package dependencies" +msgstr "Ratas paketo priklausiniuose" + +#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages +msgid "There is a circle in the required packages. See package graph." +msgstr "Reikiamuose paketuose rastas ratas. Žvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from +msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" +msgstr "Rasti du moduliai tuo pačiu vardu:%s%s1. %s%s%s iš %s%s2. %s%s%s iš %s%s%s" + +#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 +msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" +msgstr "Rastas modulis tuo pačiu vardu kaip ir paketas:%s%s1. %s%s%s iš %s%s2. %s%s%s%s" + +#: lazarusidestrconsts:lispkgmangambiguousunitsfound +msgid "Ambiguous units found" +msgstr "Rasti neaiškūs moduliai" + +#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu +msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." +msgstr "%sAbu paketai yra susiję. Tai reiškia, kad kažkuris iš paketų naudoja kitą, arba juos abu naudoja kažkuris kitas paketas." + +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom +msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" +msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir:%s%s%s%s%s%s iš %s%s%s" + +#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage +msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" +msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir paketas:%s%s%s%s%s%s" + +#: lazarusidestrconsts:lispkgmangerrorwritingfile +msgid "Error writing file" +msgstr "Klaida rašant į failą" + +#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror +msgid "Unable to write state file for project %s%sError: %s" +msgstr "Nepavyko rašyti į projektui %s priklausantį failą.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror +msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" +msgstr "Nepavyko rašyti į failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangerrorreadingfile +msgid "Error reading file" +msgstr "Klaida įkeliant failą" + +#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror +msgid "Unable to read state file %s of project %s%sError: %s" +msgstr "Nepavyko įkelti būsenos failą %s, priklausantį projektui%s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror +msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" +msgstr "Nepavyko įkelti būsenos failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangunabletocreatedirectory +msgid "Unable to create directory" +msgstr "Nepavyko sukurti katalogą" + +#: lazarusidestrconsts:lisunabletocreatedirectory2 +msgid "Unable to create directory %s%s%s" +msgstr "Nepavyko sukurti katalogą %s%s%s" + +#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage +msgid "Unable to create output directory %s%s%s%sfor package %s." +msgstr "Nepavyko sukurti išvesties katalogą %s%s%s%s, skirtą paketui %s." + +#: lazarusidestrconsts:lispkgmangunabletodeletefilename +msgid "Unable to delete file" +msgstr "Nepavyko ištrinti failą" + +#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage +msgid "Unable to delete old state file %s%s%s%sfor package %s." +msgstr "Nepavyko ištrinti senąjį būsenos failą %s%s%s%s, priklausantį paketui %s." + +#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage +msgid "Unable to create package source directory %s%s%s%sfor package %s." +msgstr "Nepavyko sukurti katalogą %s%s%s%s paketo %s pradiniam kodui." + +#: lazarusidestrconsts:lispkgmangunabletoloadpackage +msgid "Unable to load package" +msgstr "Įkelti paketą nepavyko" + +#: lazarusidestrconsts:lispkgmangunabletoopenthepackage +msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." +msgstr "Nepavyko įkelti paketą %s%s%s.%sŠis paketas paženklintas diegimui." + +#: lazarusidestrconsts:lispkgmanginvalidpackagename2 +msgid "Invalid Package Name" +msgstr "Klaidingas paketo vardas" + +#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid +msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." +msgstr "Paketo vardas %s%s%s, įrašytas faile %s%s%s, yra klaidingas." + +#: lazarusidestrconsts:lispkgmangpackageconflicts +msgid "Package conflicts" +msgstr "Paketų konfliktas" + +#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile +msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." +msgstr "Paketas %s%s%s jau yra įkeltas%siš failo %s%s%s.%sŽvilgterėkit į \"Components -> Paketų grafas\".%sPakeitimas neįmanomas." + +#: lazarusidestrconsts:lispkgmangsavepackage +msgid "Save Package?" +msgstr "Išsaugoti paketą?" + +#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage +msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" +msgstr "%keliant paketą %s bus pakeistas paketas %s%s, esanti faile %s.%sSenojo paketo turinys yra pakeistas.%s%sIšsaugoti senojo paketo %s pakeitimus?" + +#: lazarusidestrconsts:lispkgmangnewpackage +msgid "NewPackage" +msgstr "Naujas paketas" + +#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti +msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" +msgstr "Prieš tesiant reiktų įdiegti kai kuriuos paketus.%sDėmesio:%sProjektas priklauso nuo kai kurių paketų, kuriuose yra moduliai su Register procedūra. Įprastai Register procedūra naudojama komponentėms diegti į IKA. Tačiau šie moduliai priklauso paketams, kurie dar nėra įdiegti į IKA. Bandant IKA atverti formą, kuri naudoja šias komponentes, bus pranešta kad trūksta komponenčių ir tolesnis formos įkėlimas gali pridaryti nepageidautinų nemalonumų.%s%sTai neatsilieps projekto atvėrimui ar jo pirminiam kodui.%s%sTai rik reiškia, kad nėra gerai prieš diegiant trūkstamus paketu atverti formas kūrimui.%s%s" + +#: lazarusidestrconsts:lispackageneedsinstallation +msgid "Package needs installation" +msgstr "Paketą reikia įdiegti" + +#: lazarusidestrconsts:lispkgmangskipthispackage +msgid "Skip this package" +msgstr "Praleisti šį paketą" + +#: lazarusidestrconsts:lispkgmanginvalidfileextension +msgid "Invalid file extension" +msgstr "Klaidingas failo prievardis" + +#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage +msgid "The file %s%s%s is not a lazarus package." +msgstr "Failas %s%s%s nėra Lazarus paketas." + +#: lazarusidestrconsts:lispkgmanginvalidpackagefilename +msgid "Invalid package filename" +msgstr "Klaidingas paketo failo vardas" + +#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename +msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." +msgstr "Paketo failo vardas %s%s%s, įrašytas %s%s%s%s, nėra tinkamas Lazarus paketo vardas." + +#: lazarusidestrconsts:lispkgmangfilenotfound +msgid "File %s%s%s not found." +msgstr "Failas %s%s%s nerastas." + +#: lazarusidestrconsts:lispkgmangerrorreadingpackage +msgid "Error Reading Package" +msgstr "Klaida skaitant paketo failą" + +#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror +msgid "Unable to read package file %s%s%s.%sError: %s" +msgstr "Nepavyko skaityti paketo failą %s%s%s.%sKlaida: %s" + +#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename +msgid "Filename differs from Packagename" +msgstr "Failo ir paketo vardai skiriasi" + +#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage +msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" +msgstr "Failo vardas %s%s%s ir paketo vardas %s%s%s, įrašytas šiame faile, skiriasi.%sPakeisti paketo vardą į %s%s%s?" + +#: lazarusidestrconsts:lispkgmangsavepackage2 +msgid "Save package?" +msgstr "Išsaugoti paketą?" + +#: lazarusidestrconsts:lispkgmangpackagefilemissing +msgid "Package file missing" +msgstr "Trūksta paketo failo" + +#: lazarusidestrconsts:lispkgmangthefileofpackageismissing +msgid "The file %s%s%s%sof package %s is missing." +msgstr "Trūksta failo %s%s%s%s, priklausančio paketui %s." + +#: lazarusidestrconsts:lispkgmangpackagefilenotsaved +msgid "Package file not saved" +msgstr "Paketo failas neišsaugotas" + +#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst +msgid "The file %s%s%s%sof package %s needs to be saved first." +msgstr "Pirma reikia išsaugoti failą %s%s%s%s, priklausantį paketui %s." + +#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow +msgid "Ignore and save package now" +msgstr "Ignoruoti ir projektą išsaugoti dabar" + +#: lazarusidestrconsts:lispkgmangpackagechangedsave +msgid "Package %s%s%s changed. Save?" +msgstr "Paketas %s%s%s pakeistas. Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:lispkgmangerrorwritingpackage +msgid "Error Writing Package" +msgstr "Klaida išsaugant paketą" + +#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror +msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" +msgstr "Nepavyko paketą %s%s%s%sįrašyti į failą %s%s%s.%sKlaida: %s" + +#: lazarusidestrconsts:lisseeprojectprojectinspector +msgid "%sSee Project -> Project Inspector" +msgstr "%sŽiūrėkit \"Projektas -> Projekto inspektorius\"" + +#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload +msgid "The following package failed to load:" +msgstr "Nepavyko įkelti šio paketo:" + +#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload +msgid "The following packages failed to load:" +msgstr "Nepavyko įkelti šių paketų:" + +#: lazarusidestrconsts:lismissingpackages +msgid "Missing Packages" +msgstr "Trūksta paketų" + +#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename +msgid "invalid Compiler filename" +msgstr "Klaidingas kompiliatoriaus failo vardas" + +#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable +msgid "The compiler file for package %s is not a valid executable:%s%s" +msgstr "Paketo %s kompiliatoriaus failas nėra vykdomasis:%s%s" + +#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory +msgid "Package %s%s%s has no valid output directory:%s%s%s%s" +msgstr "Paketui %s%s%s nurodytas blogas katalogas:%s%s%s%s" + +#: lazarusidestrconsts:lispkgmangpackagemainsourcefile +msgid "package main source file" +msgstr "paketo pagrindinis pirminio kodo failas" + +#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit +msgid "This file was automatically created by Lazarus. Do not edit!" +msgstr "Šį failą automatiškai sukūrė Lazarus. Nekeiskite jo!" + +#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage +msgid "This source is only used to compile and install the package." +msgstr "Šis pirminis kodas skirtas tik paketo kompiliavimui ir diegimui." + +#: lazarusidestrconsts:lispkgmangrenamefileinpackage +msgid "Rename file in package?" +msgstr "Pervardinti failą pakete?" + +#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed +msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" +msgstr "Paketui %s priklauso failas%s%s%s%s.%sFailą pervardinti ir pakete?" + +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage +msgid "%sAdding new Dependency for project %s: package %s%s" +msgstr "%sProjektui %s priskiriamas naujas priklausinys: paketas %s%s" + +#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage +msgid "%sAdding new Dependency for package %s: package %s%s" +msgstr "%sPaketui %s priskiriamas naujas priklausinys: paketas %s%s" + +#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof +msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" +msgstr "%sŠie moduliai bus įtraukti į naudojamųjų modulių sąrašą%s%s:%s%s%s" + +#: lazarusidestrconsts:lisconfirmchanges +msgid "Confirm changes" +msgstr "Patvirtinkit pakeitimus" + +#: lazarusidestrconsts:lispkgmangfilenotsaved +msgid "File not saved" +msgstr "Failas neišsaugotas" + +#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage +msgid "Please save the file before adding it to a package." +msgstr "Failą būtina išsaugoti prieš dedant jį į paketą." + +#: lazarusidestrconsts:lispkgmangfileisinproject +msgid "File is in Project" +msgstr "Projekto failas" + +#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject +msgid "Warning: The file %s%s%s%sbelongs to the current project." +msgstr "Dėmesio: failas %s%s%s%s jau priklauso šiam projektui." + +#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage +msgid "File is already in package" +msgstr "Pakete yra toks failas" + +#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage +msgid "The file %s%s%s%sis already in the package %s." +msgstr "Failas %s%s%s%s jau yra pakete %s." + +#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage +msgid "Package is no designtime package" +msgstr "Paketas nėra skirtas modeliavimo rėžimui" + +#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages +msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." +msgstr "Paketas %s skirtas tik veikos rėžimui.%s Veikos rėžimo paketų negalima diegti į IKA." + +#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages +msgid "Automatically installed packages" +msgstr "Automatiškai įdiegti paketai" + +#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 +msgid "Installing the package %s will automatically install the packages:" +msgstr "Diegiant paketą %s automatiškai bus įdiegti paketai:" + +#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac +msgid "Installing the package %s will automatically install the package:" +msgstr "Diegiant paketą %s automatiškai bus įdiegtas ir paketas:" + +#: lazarusidestrconsts:lispkgmangrebuildlazarus +msgid "Rebuild Lazarus?" +msgstr "Daryti Lazarus išnaujo?" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus +msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "Paketas %s%s%s paženklintas diegimui.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad diegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus iš naujo dabar?" + +#: lazarusidestrconsts:lispkgmangpackageisrequired +msgid "Package is required" +msgstr "Paketas reikalingas" + +#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation +msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." +msgstr "Paketo %s reikia %s, kuris paženklintas kaip diegiamasis.%sŽvilgterėkit į paketų grafą." + +#: lazarusidestrconsts:lispkgmanguninstallpackage +msgid "Uninstall package?" +msgstr "Išdiegti paketą?" + +#: lazarusidestrconsts:lispkgmanguninstallpackage2 +msgid "Uninstall package %s?" +msgstr "Išdiegti paketą %s?" + +#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus +msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" +msgstr "Paketas %s%s%s paženklintas.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad išdiegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus išnaujo dabar?" + +#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe +msgid "This is a virtual package. It has no source yet. Please save the package first." +msgstr "Tai virtualus paketas. Jis kolkas dar neturi pirminio kodo. Todėl pirma išsaugokite paketą." + +#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst +msgid "Please save the package first." +msgstr "Pirma išsaugokite paketą." + +#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound +msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" +msgstr "Paketas %s%s%s paženklintas kaip diegiamasis, tačiau jo nepavyko rasti.%sPašalinti priklausinį iš paketų diegimo sąrašo?" + +#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile +msgid "static packages config file" +msgstr "statinio paketo nustatymų failas" + +#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus +msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." +msgstr "Nepavyko sukurti Lazarus skirto tikslo katalogo:%s%s%s%s.%sŠis katalogas reikalingas naujam pakeistam IKA su įdiegtais jūsų paketais." + +#: lazarusidestrconsts:lispkgsysinvalidunitname +msgid "Invalid Unitname: %s" +msgstr "Klaidingas modulio vardas: %s" + +#: lazarusidestrconsts:lispkgsysunitnotfound +msgid "Unit not found: %s%s%s" +msgstr "Modulis nerastas: %s%s%s" + +#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage +msgid "Unit %s%s%s was removed from package" +msgstr "Modulis %s%s%s pašalintas iš paketo" + +#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit +msgid "Can not register components without unit" +msgstr "Negalima registruoti komponenčių be modulio" + +#: lazarusidestrconsts:lispkgsysinvalidcomponentclass +msgid "Invalid component class" +msgstr "Klaidinga komponentės klasė" + +#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined +msgid "Component Class %s%s%s already defined" +msgstr "Komponentės klasė %s%s%s jau paskelbta" + +#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering +msgid "RegisterUnit was called, but no package is registering." +msgstr "Paleistas RegisterUnit, tačiau paketas nėra registruojamas." + +#: lazarusidestrconsts:lispkgsysunitname +msgid "%s%sUnit Name: %s%s%s" +msgstr "%s%sModulio vardas: %s%s%s" + +#: lazarusidestrconsts:lispkgsysfilename +msgid "%s%sFile Name: %s%s%s" +msgstr "%s%sFailo vardas: %s%s%s" + +#: lazarusidestrconsts:lispkgsysregistrationerror +msgid "Registration Error" +msgstr "Klaida registruojant" + +#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase +msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." +msgstr "RTL - biblioteka veikos rėžimui, tai visų FreePascal programų bazė." + +#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase +msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." +msgstr "FCL - FreePascal komponenčių biblioteka, pateikia visas objektinio paskalio bazines klases." + +#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase +msgid "The LCL - Lazarus Component Library contains all base components for form editing." +msgstr "LCL - Lazarus komponenčių biblioteka, turinti visas pagrindines komponentes reikalingas formos kūrimui." + +#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus +msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" +msgstr "SynEdit - Lazarus naudojama redagavimo komponentė.\nhttp://sourceforge.net/projects/synedit/" + +#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc +msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" +msgstr "CodeTools - funkcijos ir įrankiai, skirti nagrinėti, naršyti ir keisti paskalio pirminį tekstą" + +#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents +msgid "This is the default package. Used only for components without a package. These components are outdated." +msgstr "Tai numatytasis paketas. Naudojamas komponenčių be paketo. Tos komponentės yra pasenusios." + +#: lazarusidestrconsts:lispkgsysregisterprocedureisnil +msgid "Register procedure is nil" +msgstr "Procedūra Register yra nil" + +#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound +msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." +msgstr "Šis paketas įdiegtas, tačiau nerastas jo lpk failas. Pasyvinami visi jo komponentai. Ištaisykite tai." + +#: lazarusidestrconsts:lispkgsyspackagefilenotfound +msgid "Package file not found" +msgstr "Nerastas paketo failas" + +#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound +msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." +msgstr "Paketas %s%s%s įdiegtas, tačiau nerastas paketo failas (.lpk).%sTodėl sukurtas tuščias paketas." + +#: lazarusidestrconsts:lispkgdefsoutputdirectory +msgid "Output directory" +msgstr "Išvesties katalogas" + +#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition +msgid "CompiledSrcPath addition" +msgstr "Priedas prie CompiledSrcPath" + +#: lazarusidestrconsts:lispkgdefsunitpath +msgid "Unit Path" +msgstr "Kelias iki modulio" + +#: lazarusidestrconsts:lisprojprojectsourcedirectorymark +msgid "Project Source Directory Mark" +msgstr "Projekto pradinio katalogo žymė" + +#: lazarusidestrconsts:lispkgdefssrcdirmark +msgid "Package Source Directory Mark" +msgstr "Paketo pradinio katalogo žymė" + +#: lazarusidestrconsts:lisaf2pinvalidpackage +msgid "Invalid Package" +msgstr "Klaidingas paketas" + +#: lazarusidestrconsts:lisaf2pinvalidpackageid +msgid "Invalid package ID: %s%s%s" +msgstr "Klaidingas paketo ID: %s%s%s" + +#: lazarusidestrconsts:lisaf2ppackagenotfound +msgid "Package %s%s%s not found." +msgstr "Paketas %s%s%s nerastas." + +#: lazarusidestrconsts:lisaf2ppackageisreadonly +msgid "Package is read only" +msgstr "Paketas tik skaitymui" + +#: lazarusidestrconsts:lisaf2pthepackageisreadonly +msgid "The package %s is read only." +msgstr "Paketas %s tik skaitymui." + +#: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage +msgid "The file %s%s%s%sis already in the package %s." +msgstr "Failas %s%s%s%sjau yra pakete %s." + +#: lazarusidestrconsts:lisaf2punitname +msgid "Unit Name: " +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lisaf2phasregisterprocedure +msgid "Has Register procedure" +msgstr "Turi procedūra Register" + +#: lazarusidestrconsts:lisaf2pisvirtualunit +msgid "Virtual unit (source is not in package)" +msgstr "Virtualus modulis (pakete nėra pirminio kodo)" + +#: lazarusidestrconsts:lisaf2pfiletype +msgid "File Type" +msgstr "Failo tipas" + +#: lazarusidestrconsts:lisaf2pdestinationpackage +msgid "Destination Package" +msgstr "Paskirties paketas" + +#: lazarusidestrconsts:lisaf2pshowall +msgid "Show All" +msgstr "Rodyti visus" + +#: lazarusidestrconsts:lisaf2paddfiletoapackage +msgid "Add file to a package" +msgstr "Įdėti į paketą" + +#: lazarusidestrconsts:lisa2pinvalidfilename +msgid "Invalid filename" +msgstr "Klaidingas failo vardas" + +#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename +msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." +msgstr "Neaiškus failo vardas %s%s%s, nes paketas dar neturi nustatyto katalogo.%sNurodykite pilną kelią iki failo." + +#: lazarusidestrconsts:lisa2pfilenotunit +msgid "File not unit" +msgstr "Failas nėra modulis" + +#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas +msgid "Pascal units must have the extension .pp or .pas" +msgstr "Paskalio modulių failų prievardis turi būti .pp arba .pas" + +#: lazarusidestrconsts:lisa2pisnotavalidunitname +msgid "%s%s%s is not a valid unit name." +msgstr "%s%s%s yra klaidingas modulio vardas." + +#: lazarusidestrconsts:lisa2punitnamealreadyexists +msgid "Unitname already exists" +msgstr "Modulio vardas egzistuoja" + +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage +msgid "The unitname %s%s%s already exists in this package." +msgstr "Modulio vardas %s%s%s jau yra pakete." + +#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage +msgid "The unitname %s%s%s already exists in the package:%s%s" +msgstr "Modulio vardas %s%s%s jau yra pakete:%s%s" + +#: lazarusidestrconsts:lisa2pambiguousunitname +msgid "Ambiguous Unit Name" +msgstr "Neaiškus modulio vardas" + +#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent +msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." +msgstr "Modulio vardas %s%s%s tokspat kaip ir užregistruota komponentė.%sDėlto galite sulaukti keistų pranešimų apie klaidas." + +#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject +msgid "File %s%s%s already exists in the project." +msgstr "Failas %s%s%s projekte jau yra." + +#: lazarusidestrconsts:lisa2pexistingfile +msgid "%sExisting file: %s%s%s" +msgstr "%sEgzistuojantis failas: %s%s%s" + +#: lazarusidestrconsts:lisa2pfilealreadyexists +msgid "File already exists" +msgstr "Failas jau egzistuoja" + +#: lazarusidestrconsts:lisa2pfileisused +msgid "File is used" +msgstr "Failas jau naudojamas" + +#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea +msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." +msgstr "Failas %s%s%s yra šio projekto dalis.%sDalintis failais tarp projektų bei paketų nėra gerai." + +#: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion +msgid "The Maximum Version is lower than the Minimim Version." +msgstr "Maksimali versija žemesnė nei minimali." + +#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting +msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." +msgstr "Klaidingas paketo vardas %s%s%s.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe +msgid "The package has already a dependency for the package %s%s%s." +msgstr "Paketas jau priklauso nuo paketo %s%s%s." + +#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting +msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." +msgstr "%s%s%s priklausiniui nerastas paketas.%sNurodykite egzistuojantį paketą." + +#: lazarusidestrconsts:lisa2pinvalidunitname +msgid "Invalid Unit Name" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer +msgid "The unit name %s%s%s%sand filename %s%s%s differ." +msgstr "Modulio %s%s%s%s ir failo %s%s%s vardai skiriasi." + +#: lazarusidestrconsts:lisa2pfilealreadyinpackage +msgid "File already in package" +msgstr "Pakete jau yra toks failas" + +#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage +msgid "The file %s%s%s is already in the package." +msgstr "Failas %s%s%s jau yra pakete" + +#: lazarusidestrconsts:lisa2pinvalidfile +msgid "Invalid file" +msgstr "Klaidingas failo vardas" + +#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas +msgid "A pascal unit must have the extension .pp or .pas" +msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas" + +#: lazarusidestrconsts:lisa2pinvalidancestortype +msgid "Invalid Ancestor Type" +msgstr "Klaidingas protėvio tipas" + +#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier +msgid "The ancestor type %s%s%s is not a valid pascal identifier." +msgstr "Protėvio tipas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lisa2ppagenametoolong +msgid "Page Name too long" +msgstr "Perilgas vardas" + +#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars +msgid "The page name %s%s%s is too long (max 100 chars)." +msgstr "Perilgas lapo vardas %s%s%s (gali būti nedaugiau 100 simbolių)" + +#: lazarusidestrconsts:lisa2punitnameinvalid +msgid "Unit Name Invalid" +msgstr "Klaidingas modulio vardas" + +#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename +msgid "The unit name %s%s%s does not correspond to the filename." +msgstr "Modulio %s%s%s ir failo vardai neatitinka." + +#: lazarusidestrconsts:lisa2pinvalidclassname +msgid "Invalid Class Name" +msgstr "Klaidingas klasės vardas" + +#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier +msgid "The class name %s%s%s is not a valid pascal identifier." +msgstr "Klasės vardas %s%s%s nėra paskalio identifikatorius." + +#: lazarusidestrconsts:lisa2pinvalidcircle +msgid "Invalid Circle" +msgstr "Klaidingas ratas" + +#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame +msgid "The class name %s%s%s and ancestor type %s%s%s are the same." +msgstr "Klasės vardas %s%s%stokspat kaip ir protėvio tipo %s%s%s." + +#: lazarusidestrconsts:lisa2pambiguousancestortype +msgid "Ambiguous Ancestor Type" +msgstr "Neaiškus protėvio tipas" + +#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit +msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "Protėvio tipo %s%s%s vardas tokspat kaip ir%smodulio %s%s%s." + +#: lazarusidestrconsts:lisa2pambiguousclassname +msgid "Ambiguous Class Name" +msgstr "Neaiškus klasės vardas" + +#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit +msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." +msgstr "Klasės vardas %s%s%s tokspat kaip ir%smodulio %s%s%s." + +#: lazarusidestrconsts:lisa2pclassnamealreadyexists +msgid "Class Name already exists" +msgstr "Dubliuojasi klasės vardas " + +#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile +msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" +msgstr "Klasės vardas %s%s%s jau figūruoja%spaketo %s%sfaile: %s%s%s" + +#: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor +msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" + +#: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor +msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" +msgstr "Maksimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10" + +#: lazarusidestrconsts:lisa2paddunit +msgid "Add Unit" +msgstr "Pridėti modulį" + +#: lazarusidestrconsts:lisa2pnewfile +msgid "New File" +msgstr "Naujas failas" + +#: lazarusidestrconsts:lisa2pnewcomponent +msgid "New Component" +msgstr "Nauja komponentė" + +#: lazarusidestrconsts:lisa2paddfile +msgid "Add File" +msgstr "Pridėti failą" + +#: lazarusidestrconsts:lisa2paddfiles +msgid "Add Files" +msgstr "Pridėti failus" + +#: lazarusidestrconsts:lisa2punitfilename +msgid "Unit file name:" +msgstr "Modulio failo vardas:" + +#: lazarusidestrconsts:lisa2pchooseanexistingfile +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist +msgid "Add LFM, LRS files, if they exist" +msgstr "Pridėti esamus LFM bei LRS failus" + +#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure +msgid "Scan Unit for Unit Name and Register procedure" +msgstr "Modulyje ieškoti modulio vardo ir užregistruoti procedūrą" + +#: lazarusidestrconsts:lisa2pancestortype +msgid "Ancestor Type" +msgstr "Protėvio tipas" + +#: lazarusidestrconsts:lisa2pshowall +msgid "Show all" +msgstr "Rodyti visus" + +#: lazarusidestrconsts:lisa2pnewclassname +msgid "New class name:" +msgstr "Naujos klasės vardaas:" + +#: lazarusidestrconsts:lisa2ppalettepage +msgid "Palette Page:" +msgstr "Paletės lapas:" + +#: lazarusidestrconsts:lisa2punitfilename2 +msgid "Unit File Name:" +msgstr "Modulio failo vardas:" + +#: lazarusidestrconsts:lisa2punitname +msgid "Unit Name:" +msgstr "Modulio vardas:" + +#: lazarusidestrconsts:lisa2pshortenorexpandfilename +msgid "Shorten or expand filename" +msgstr "Suskleisti ar išplėsti failo vardą" + +#: lazarusidestrconsts:lisa2psavefiledialog +msgid "Save file dialog" +msgstr "Išsaugoti failą" + +#: lazarusidestrconsts:lisa2pfilename +msgid "File name:" +msgstr "Failo vardas:" + +#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies +msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." +msgstr "Keičiant paketo vardą ar versiją bus sugadintos priklausomybės. Keisti šias priklausomybes kaip priklauso?%sPaspaudus \"Taip\" bus pakeistos visos pateiktos priklausomybės.%sPaspaudus \"Ignoruoti\" priklausomybės bus sugadintos." + +#: lazarusidestrconsts:lisa2pdependency +msgid "Dependency" +msgstr "Priklausomybės" + +#: lazarusidestrconsts:lisa2pbrokendependencies +msgid "Broken Dependencies" +msgstr "Sugadintos priklausomybės" + +#: lazarusidestrconsts:lisoipfilename +msgid "Filename: %s" +msgstr "Failo vardas: %s" + +#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated +msgid "%sThis package was automatically created" +msgstr "%sŠis paketas sukurtas automatiškai" + +#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound +msgid "%sThis package is installed, but the lpk file was not found" +msgstr "%sŠis paketas įdiegtas, tačiau nerastas lpk failas" + +#: lazarusidestrconsts:lisoipdescriptiondescription +msgid "%sDescription: %s" +msgstr "%sAprašymas: %s" + +#: lazarusidestrconsts:lisoipdescription +msgid "Description: " +msgstr "Aprašymas:" + +#: lazarusidestrconsts:lisoippleaseselectapackage +msgid "Please select a package" +msgstr "Pažymėkite paketą" + +#: lazarusidestrconsts:lisoipnopackageselected +msgid "No package selected" +msgstr "Paketas nepažymėtas" + +#: lazarusidestrconsts:lisoippleaseselectapackagetoopen +msgid "Please select a package to open" +msgstr "Nurodykit kurį paketą atverti" + +#: lazarusidestrconsts:lisoippackagename +msgid "Package Name" +msgstr "Paketo vardas" + +#: lazarusidestrconsts:lisoipstate +msgid "State" +msgstr "Būsena" + +#: lazarusidestrconsts:lisoipmodified +msgid "modified" +msgstr "pakeistas" + +#: lazarusidestrconsts:lisoipmissing +msgid "missing" +msgstr "trūksta" + +#: lazarusidestrconsts:lisoipinstalledstatic +msgid "installed static" +msgstr "įdiegtas kaip statinis" + +#: lazarusidestrconsts:lisoipinstalleddynamic +msgid "installed dynamic" +msgstr "įdiektas kaip dinaminis" + +#: lazarusidestrconsts:lisoipautoinstallstatic +msgid "auto install static" +msgstr "automatiškai diegti kaip statišką" + +#: lazarusidestrconsts:lisoipautoinstalldynamic +msgid "auto install dynamic" +msgstr "automatiškai diegti kaip dinamišką" + +#: lazarusidestrconsts:lisoipreadonly +msgid "readonly" +msgstr "tik skaitymui" + +#: lazarusidestrconsts:lisoipopenloadedpackage +msgid "Open loaded package" +msgstr "Atverti įkeltą paketą" + +#: lazarusidestrconsts:lispckeditremovefile +msgid "Remove file" +msgstr "Pašalinti failą" + +#: lazarusidestrconsts:lispckeditreaddfile +msgid "Re-Add file" +msgstr "Išnaujo talpinti failą" + +#: lazarusidestrconsts:lispckeditremovedependency +msgid "Remove dependency" +msgstr "Pašalinti priklausinį" + +#: lazarusidestrconsts:lispckeditmovedependencyup +msgid "Move dependency up" +msgstr "Perkelti priklausinį aukštyn" + +#: lazarusidestrconsts:lispckeditmovedependencydown +msgid "Move dependency down" +msgstr "Perkelti priklausinį žemyn" + +#: lazarusidestrconsts:lispckeditreadddependency +msgid "Re-Add dependency" +msgstr "Išnaujo talpinti priklausinį" + +#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename +msgid "Store dependency filename" +msgstr "Talpinti priklausomo failo vardą" + +#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename +msgid "Clear dependency filename" +msgstr "Išvalyti priklausomo failo vardą" + +#: lazarusidestrconsts:lispckeditcompile +msgid "Compile" +msgstr "Kompiliuoti" + +#: lazarusidestrconsts:lispckeditrecompileclean +msgid "Recompile clean" +msgstr "Kompiliuoti išvalant" + +#: lazarusidestrconsts:lispckeditrecompileallrequired +msgid "Recompile all required" +msgstr "Kompiliuoti visus būtinus" + +#: lazarusidestrconsts:lispckeditcreatemakefile +msgid "Create Makefile" +msgstr "Sukurti Makefile" + +#: lazarusidestrconsts:lispckeditaddtoproject +msgid "Add to project" +msgstr "Įdėti į projektą" + +#: lazarusidestrconsts:lispckeditinstall +msgid "Install" +msgstr "Įdiegti" + +#: lazarusidestrconsts:lispckedituninstall +msgid "Uninstall" +msgstr "Išdiegti" + +#: lazarusidestrconsts:lispckeditviewpackgesource +msgid "View Package Source" +msgstr "Rodyti paketo pirminį kodą" + +#: lazarusidestrconsts:lispckeditgeneraloptions +msgid "General Options" +msgstr "Pagrindinės parinktys" + +#: lazarusidestrconsts:lispckeditsavechanges +msgid "Save Changes?" +msgstr "Išsaugoti pakeitimus?" + +#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage +msgid "Package %s%s%s has changed.%sSave package?" +msgstr "Paketas %s%s%s pakeistas.%sIšsaugoti paketą?" + +#: lazarusidestrconsts:lispckeditpage +msgid "%s, Page: %s" +msgstr "%s, lapas: %s" + +#: lazarusidestrconsts:lisfpfindpalettecomponent +msgid "Find palette component" +msgstr "Ieškoti komponentės paletėje" + +#: lazarusidestrconsts:lisfpcomponents +msgid "Components" +msgstr "Komponentės" + +#: lazarusidestrconsts:lispckeditremovefile2 +msgid "Remove file?" +msgstr "Išmesti failą?" + +#: lazarusidestrconsts:lispckeditremovefilefrompackage +msgid "Remove file %s%s%s%sfrom package %s%s%s?" +msgstr "Išmesti failą %s%s%s%siš paketo %s%s%s?" + +#: lazarusidestrconsts:lispckeditremovedependency2 +msgid "Remove Dependency?" +msgstr "Panaikinti priklausomybę?" + +#: lazarusidestrconsts:lispckeditremovedependencyfrompackage +msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" +msgstr "Panaikinti priklausomybę %s%s%s%spaketui %s%s%s?" + +#: lazarusidestrconsts:lispckeditinvalidminimumversion +msgid "Invalid minimum version" +msgstr "Klaidinga minimali versija" + +#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion +msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "Minimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" + +#: lazarusidestrconsts:lispckeditinvalidmaximumversion +msgid "Invalid maximum version" +msgstr "Klaidinga maksimali versija" + +#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion +msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" +msgstr "Maksimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)" + +#: lazarusidestrconsts:lispckeditcompileeverything +msgid "Compile everything?" +msgstr "Kompiliuoti viską?" + +#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages +msgid "Re-Compile this and all required packages?" +msgstr "Kompiliuoti išnaujo šį ir kitus reikiamus paketus?" + +#: lazarusidestrconsts:lispckeditcompileroptionsforpackage +msgid "Compiler Options for Package %s" +msgstr "Paketo %s kompiliavimo parinktys" + +#: lazarusidestrconsts:lispckeditsavepackage +msgid "Save package" +msgstr "Išsaugoti paketą" + +#: lazarusidestrconsts:lispckeditcompilepackage +msgid "Compile package" +msgstr "Kompiliuoti paketą" + +#: lazarusidestrconsts:lispckeditaddanitem +msgid "Add an item" +msgstr "Pridėti elementą" + +#: lazarusidestrconsts:lispckeditremoveselecteditem +msgid "Remove selected item" +msgstr "Pašalinti pažymėtą elementą" + +#: lazarusidestrconsts:lispckeditinstallpackageintheide +msgid "Install package in the IDE" +msgstr "Įdiegti paketą į IKA" + +#: lazarusidestrconsts:lispckediteditgeneraloptions +msgid "Edit General Options" +msgstr "Keisti pagrindines parinktis" + +#: lazarusidestrconsts:lispckeditcompopts +msgid "Compiler Options" +msgstr "Kompiliatoriaus parinktys" + +#: lazarusidestrconsts:lispckedithelp +msgid "Help" +msgstr "Žinynas" + +#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu +msgid "There are more functions in the popupmenu" +msgstr "Daugiau funkcijų yra iškylančiame menių" + +#: lazarusidestrconsts:lispckeditmore +msgid "More ..." +msgstr "Daugiau..." + +#: lazarusidestrconsts:lispckediteditoptionstocompilepackage +msgid "Edit Options to compile package" +msgstr "Keisti paketo kompiliavimo parinktis" + +#: lazarusidestrconsts:lispckeditrequiredpackages +msgid "Required Packages" +msgstr "Būtini paketai" + +#: lazarusidestrconsts:lispckeditfileproperties +msgid "File Properties" +msgstr "Failo savybės" + +#: lazarusidestrconsts:lispckeditregisterunit +msgid "Register unit" +msgstr "Registruoti modulį" + +#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit +msgid "Call %sRegister%s procedure of selected unit" +msgstr "Iškviesti pažymėto modulio %sRegister%s procedūrą" + +#: lazarusidestrconsts:lispckeditregisteredplugins +msgid "Registered plugins" +msgstr "Registruoti įskiepiai" + +#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit +msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." +msgstr "Pridėti modulį prie paketo naudojamų modulių. Pasyvinkite tik tiems moduliams, kurių jokiu būdu nereikia kompiliuoti." + +#: lazarusidestrconsts:lispkgmanguseunit +msgid "Use unit" +msgstr "Naudoti modulį" + +#: lazarusidestrconsts:lispckeditminimumversion +msgid "Minimum Version:" +msgstr "Minimali versija:" + +#: lazarusidestrconsts:lispckeditmaximumversion +msgid "Maximum Version:" +msgstr "Maksimali versija:" + +#: lazarusidestrconsts:lispckeditapplychanges +msgid "Apply changes" +msgstr "Pritaikyti keitimus" + +#: lazarusidestrconsts:lispckeditpackage +msgid "Package %s" +msgstr "Paketas %s" + +#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile +msgid "Removed Files (these entries are not saved to the lpk file)" +msgstr "Pašalinti failai (šie įrašai lpk faile neįrašyti)" + +#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved +msgid "Removed required packages (these entries are not saved to the lpk file)" +msgstr "Pašalinti reikiami paketai (šie įrašai lpk faile neįrašyti)" + +#: lazarusidestrconsts:lispckeditdependencyproperties +msgid "Dependency Properties" +msgstr "Priklausomybių savybės" + +#: lazarusidestrconsts:lispckeditpackagenotsaved +msgid "package %s not saved" +msgstr "paketas %s neišsaugotas" + +#: lazarusidestrconsts:lispckeditreadonly +msgid "Read Only: %s" +msgstr "Tik skaitymui: %s" + +#: lazarusidestrconsts:lispckeditmodified +msgid "Modified: %s" +msgstr "Pakeista: %s" + +#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath +msgid "New unit not in unitpath" +msgstr "Naujojo modulio nėra modulių kelyje" + +#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage +msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" +msgstr "Failas %s%s%s%s yra ne paketo modulių kelyje.%s%s%s%s%s įtraukti kaip modulių kelią?" + +#: lazarusidestrconsts:lispkgeditrevertpackage +msgid "Revert package?" +msgstr "Atstatyti paketą?" + +#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand +msgid "Do you really want to forget all changes to package %s and reload it from file?" +msgstr "Ar ištikro norite panaikinti visus keitimus pakete %s ir jį įkelti išnaujo?" + +#: lazarusidestrconsts:lispckoptsusage +msgid "Usage" +msgstr "Naudojimas" + +#: lazarusidestrconsts:lispochoosepofiledirectory +msgid "Choose .po file directory" +msgstr "Nurodykit .po failo katalogą" + +#: lazarusidestrconsts:lispckoptsideintegration +msgid "IDE Integration" +msgstr "IKA dalis" + +#: lazarusidestrconsts:lispckoptsdescriptionabstract +msgid "Description/Abstract" +msgstr "Aprašymas/Santrauka" + +#: lazarusidestrconsts:lispckoptsauthor +msgid "Author:" +msgstr "Autorius:" + +#: lazarusidestrconsts:lispckoptslicense +msgid "License:" +msgstr "Licenzija:" + +#: lazarusidestrconsts:lispckoptsmajor +msgid "Major" +msgstr "Didysis" + +#: lazarusidestrconsts:lispckoptsminor +msgid "Minor" +msgstr "Mažasis" + +#: lazarusidestrconsts:lispckoptsrelease +msgid "Release" +msgstr "Laida" + +#: lazarusidestrconsts:lisbuildnumber +msgid "Build Number" +msgstr "Darymo numeris" + +#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild +msgid "Automatically increment version on build" +msgstr "Padarius, automatiškai didinti versijos numerį" + +#: lazarusidestrconsts:lispckoptspackagetype +msgid "PackageType" +msgstr "Paketo tipas" + +#: lazarusidestrconsts:lispckoptsdesigntimeonly +msgid "Designtime only" +msgstr "Tik konstravimo metu" + +#: lazarusidestrconsts:lispckoptsruntimeonly +msgid "Runtime only" +msgstr "Tik vykdymo metu" + +#: lazarusidestrconsts:lispckoptsdesigntimeandruntime +msgid "Designtime and Runtime" +msgstr "Konstravimo bei vykdymo metu" + +#: lazarusidestrconsts:lispckoptsupdaterebuild +msgid "Update/Rebuild" +msgstr "Atnaujinti/Daryti" + +#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded +msgid "Automatically rebuild as needed" +msgstr "Automatiškai daryti kai reikia" + +#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall +msgid "Auto rebuild when rebuilding all" +msgstr "Daryti automatiškai kai daromi visi" + +#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically +msgid "Manual compilation (never automatically)" +msgstr "Kompiliuoti rankiniu būdu (ne automatiškai)" + +#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects +msgid "Add paths to dependent packages/projects" +msgstr "Įdėti kelius į priklausomus paketus/projektus" + +#: lazarusidestrconsts:lispckoptsinclude +msgid "Include" +msgstr "Įtraukti" + +#: lazarusidestrconsts:lispckoptsobject +msgid "Object" +msgstr "Objektas" + +#: lazarusidestrconsts:lispckoptslibrary +msgid "Library" +msgstr "Biblioteka" + +#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects +msgid "Add options to dependent packages and projects" +msgstr "Įdėti parinktis į priklausomus paketus bei projektus" + +#: lazarusidestrconsts:lispckoptslinker +msgid "Linker" +msgstr "Saistyklė" + +#: lazarusidestrconsts:lispckoptscustom +msgid "Custom" +msgstr "Naudotojo" + +#: lazarusidestrconsts:lispckoptsinvalidpackagetype +msgid "Invalid package type" +msgstr "Klaidingas paketo tipas" + +#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans +msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." +msgstr "Paketas %s%s%s nustatytas automatiniam diegimui.%sTai reiškia, kad jis bus įdiegtas į IKA. Diegimo paketai%sturi būti designtime tipo." + +#: lazarusidestrconsts:lispckoptspackageoptions +msgid "Package Options" +msgstr "Paketo parinktys" + +#: lazarusidestrconsts:lispckexplloadedpackages +msgid "Loaded Packages:" +msgstr "Įkelti paketai:" + +#: lazarusidestrconsts:lispckexplisrequiredby +msgid "Selected package is required by:" +msgstr "Pažymėtojo paketo reikia:" + +#: lazarusidestrconsts:lispckexplpackagenotfound +msgid "Package %s not found" +msgstr "%s paketas nerastas" + +#: lazarusidestrconsts:lispckexplstate +msgid "%sState: " +msgstr "%sBūsena: " + +#: lazarusidestrconsts:lispckexplautocreated +msgid "AutoCreated" +msgstr "sukurtas automatiškai" + +#: lazarusidestrconsts:lispckexplinstalled +msgid "Installed" +msgstr "įdiegtas" + +#: lazarusidestrconsts:lispckexplinstallonnextstart +msgid "Install on next start" +msgstr "Įdiegti kitąkart startuojant" + +#: lazarusidestrconsts:lispckexpluninstallonnextstart +msgid "Uninstall on next start" +msgstr "Išdiegti kitąkart startuojant" + +#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency +msgid "Confirm deleting dependency" +msgstr "Patvirtinimas naikinat priklausomybę" + +#: lazarusidestrconsts:lisprojinspconfirmremovingfile +msgid "Confirm removing file" +msgstr "Patvirtinimas šalinant failą" + +#: lazarusidestrconsts:lisprojinspdeletedependencyfor +msgid "Delete dependency for %s?" +msgstr "Naikinti %s priklausomybę?" + +#: lazarusidestrconsts:lisprojinspremovefilefromproject +msgid "Remove file %s from project?" +msgstr "Pašalinti failą %s iš projekto?" + +#: lazarusidestrconsts:lisprojinspremovedrequiredpackages +msgid "Removed required packages" +msgstr "Pašalinti reikiami paketai" + +#: lazarusidestrconsts:lisprojinspprojectinspector +msgid "Project Inspector - %s" +msgstr "Projekto inspektorius - %s" + +#: lazarusidestrconsts:lismenueditormenueditor +msgid "Menu Editor" +msgstr "Meniu redaktorius" + +#: lazarusidestrconsts:lismenueditorselectmenu +msgid "Select Menu:" +msgstr "Rinkitės menių:" + +#: lazarusidestrconsts:lismenueditorselecttemplate +msgid "Select Template:" +msgstr "Rinkitės šabloną:" + +#: lazarusidestrconsts:lismenueditortemplatepreview +msgid "Template Preview" +msgstr "Šablono peržiūra" + +#: lazarusidestrconsts:lismenueditornewtemplatedescription +msgid "New Template Description..." +msgstr "Naujas šablono aprašymas..." + +#: lazarusidestrconsts:lismenueditorcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lazarusidestrconsts:lismenueditorinsertnewitemafter +msgid "Insert New Item (after)" +msgstr "Įterpti naują elementą (po)" + +#: lazarusidestrconsts:lismenueditorinsertnewitembefore +msgid "Insert New Item (before)" +msgstr "Įterpti naują elementą (prieš)" + +#: lazarusidestrconsts:lismenueditordeleteitem +msgid "Delete Item" +msgstr "Pašalinti elementą" + +#: lazarusidestrconsts:lismenueditorcreatesubmenu +msgid "Create Submenu" +msgstr "Sukurti pomenių" + +#: lazarusidestrconsts:lismenueditorhandleonclickevent +msgid "Handle OnClick Event" +msgstr "Apdoroti OnClick įvykį" + +#: lazarusidestrconsts:lismenueditormoveup +msgid "Move Up (or left)" +msgstr "Stumti viršun (arba kairėn)" + +#: lazarusidestrconsts:lismenueditormovedown +msgid "Move Down (or right)" +msgstr "Stumti žemyn (arba dešinėn)" + +#: lazarusidestrconsts:lismenueditorinsertfromtemplate +msgid "Insert From Template..." +msgstr "Įterpti iš šablono..." + +#: lazarusidestrconsts:lismenueditorsaveastemplate +msgid "Save As Template..." +msgstr "Išsaugoti kaip šabloną..." + +#: lazarusidestrconsts:lismenueditordeletefromtemplate +msgid "Delete From Template..." +msgstr "Pašalinti iš šablono..." + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu +msgid "Standard File Menu" +msgstr "Standartinis failo meniu" + +#: lazarusidestrconsts:lismenutemplatefile +msgid "File" +msgstr "Failas" + +#: lazarusidestrconsts:lismenutemplatenew +msgid "New" +msgstr "Naujas" + +#: lazarusidestrconsts:liskmnewunit +msgid "New Unit" +msgstr "Naujas modulis" + +#: lazarusidestrconsts:lismenutemplateopen +msgid "Open" +msgstr "Atverti" + +#: lazarusidestrconsts:lismenutemplateopenrecent +msgid "Open Recent" +msgstr "Atverti paskiausiuosius" + +#: lazarusidestrconsts:lismenutemplatesave +msgid "Save" +msgstr "Išsaugoti" + +#: lazarusidestrconsts:lismenutemplatesaveas +msgid "Save As" +msgstr "Išsaugoti kaip" + +#: lazarusidestrconsts:lismenutemplateclose +msgid "Close" +msgstr "Užverti" + +#: lazarusidestrconsts:lismenutemplateexit +msgid "Exit" +msgstr "Baigti darbą" + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu +msgid "Standard Edit Menu" +msgstr "Standartinis redaktoriaus meniu" + +#: lazarusidestrconsts:lismenutemplateedit +msgid "Edit" +msgstr "Keisti" + +#: lazarusidestrconsts:lismenutemplateundo +msgid "Undo" +msgstr "Grąžinti" + +#: lazarusidestrconsts:lismenutemplateredo +msgid "Redo" +msgstr "Pakartoti" + +#: lazarusidestrconsts:lismenutemplatecut +msgid "Cut" +msgstr "Iškirpti" + +#: lazarusidestrconsts:lismenutemplatecopy +msgid "Copy" +msgstr "Kopijuoti" + +#: lazarusidestrconsts:lismenutemplatepaste +msgid "Paste" +msgstr "Įdėti" + +#: lazarusidestrconsts:lismenutemplatefind +msgid "Find" +msgstr "Ieškoti" + +#: lazarusidestrconsts:lismenutemplatefindnext +msgid "Find Next" +msgstr "Ieškoti toliau" + +#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu +msgid "Standard Help Menu" +msgstr "Standartinis žinyno meniu" + +#: lazarusidestrconsts:lismenutemplatehelp +msgid "Help" +msgstr "Žinynas" + +#: lazarusidestrconsts:lismenutemplatecontents +msgid "Contents" +msgstr "Turinys" + +#: lazarusidestrconsts:lismenutemplatetutorial +msgid "Tutorial" +msgstr "Pavyzdys" + +#: lazarusidestrconsts:lismenutemplateabout +msgid "About" +msgstr "Apie" + +#: lazarusidestrconsts:liscontributors +msgid "Contributors" +msgstr "Talkininkai" + +#: lazarusidestrconsts:lisacknowledgements +msgid "Acknowledgements" +msgstr "Padėkos" + +#: lazarusidestrconsts:lischaractermap +msgid "Character Map" +msgstr "Simbolių lentelė" + +#: lazarusidestrconsts:lisctdefchoosedirectory +msgid "Choose Directory" +msgstr "Parinkite katalogą" + +#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues +msgid "CodeTools Directory Values" +msgstr "CodeTools katalogo reikšmės" + +#: lazarusidestrconsts:lisctdefvariable +msgid "Variable: %s" +msgstr "Kintamasis: %s" + +#: lazarusidestrconsts:lisctdefnovariableselected +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisctdefvariablename +msgid "Variable Name" +msgstr "Kintamojo vardas" + +#: lazarusidestrconsts:liscldircleansubdirectories +msgid "Clean sub directories" +msgstr "Valyti pakatalogius" + +#: lazarusidestrconsts:liscldirremovefilesmatchingfilter +msgid "Remove files matching filter" +msgstr "Pašalinti nurodytus failus" + +#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof +msgid "Simple Syntax (e.g. * instead of .*)" +msgstr "Paprasta sintaksė (pvz.: * vietoje .*)" + +#: lazarusidestrconsts:liscldirkeepalltextfiles +msgid "Keep all text files" +msgstr "Palikti visus tekstinius failus" + +#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter +msgid "Keep files matching filter" +msgstr "Palikti filtre nurodytus failus" + +#: lazarusidestrconsts:liscldircleandirectory +msgid "Clean Directory" +msgstr "Valyti katalogą" + +#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis +msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." +msgstr "LFM (Lazarus forma) faile aptikta klaidų. Pavyzdžiui, jame yra savybių/klasių, kurių nėra dabartiniame LCL. Yra įprasta šias savybes/klases pašalinti ir po to paskalio kodą taisyti rankiniu būdu." + +#: lazarusidestrconsts:lisfixlfmfile +msgid "Fix LFM file" +msgstr "LFM failo taisa" + +#: lazarusidestrconsts:lismissingevents +msgid "Missing Events" +msgstr "Trūksta įvykių" + +#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth +msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" +msgstr "Šių metodų, kuriuos naudoja %s, nėra pirminiame kode%s%s%s%s%s%sPašalinti betikslius įrašus?" + +#: lazarusidestrconsts:lisnocodeselected +msgid "No code selected" +msgstr "Kodas nepažymėtas" + +#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod +msgid "Please select some code to extract a new procedure/method." +msgstr "Prieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." + +#: lazarusidestrconsts:lisinvalidselection +msgid "Invalid selection" +msgstr "Klaidingas žymėjimas" + +#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode +msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." +msgstr "Sakinį ištraukti neis.%sPrieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo." + +#: lazarusidestrconsts:lisextractprocedure +msgid "Extract Procedure" +msgstr "Ištraukti procedūrą" + +#: lazarusidestrconsts:lisnameofnewprocedure +msgid "Name of new procedure" +msgstr "Naujos procedūros vardas" + +#: lazarusidestrconsts:lisextract +msgid "Extract" +msgstr "Ištraukti" + +#: lazarusidestrconsts:lisinvalidprocname +msgid "Invalid proc name" +msgstr "Klaidingas procedūros vardas" + +#: lazarusidestrconsts:lispublicmethod +msgid "Public Method" +msgstr "Public metodas" + +#: lazarusidestrconsts:lisprivatemethod +msgid "Private Method" +msgstr "Private metodas" + +#: lazarusidestrconsts:lisprotectedmethod +msgid "Protected Method" +msgstr "Protected metodas" + +#: lazarusidestrconsts:lispublishedmethod +msgid "Published Method" +msgstr "Published metodas" + +#: lazarusidestrconsts:lisprocedure +msgid "Procedure" +msgstr "Procedūra" + +#: lazarusidestrconsts:lisprocedurewithinterface +msgid "Procedure with interface" +msgstr "Procedūra su interfeisu" + +#: lazarusidestrconsts:lissubprocedure +msgid "Sub Procedure" +msgstr "Vidinė procedūra" + +#: lazarusidestrconsts:lissubprocedureonsamelevel +msgid "Sub Procedure on same level" +msgstr "Vidinė procedūra tame pačiame lygyje" + +#: lazarusidestrconsts:lisfreepascalcompilernotfound +msgid "Free Pascal Compiler not found" +msgstr "Nerastas FreePascal kompiliatorius" + +#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm +msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." +msgstr "Nerastas FreePascal kompiliatorius (failas: %s).%sRekomenduotina instaliuoti fpc." + +#: lazarusidestrconsts:lisinvalidcompilerfilename +msgid "Invalid Compiler Filename" +msgstr "Blogas kompiliatoriaus vardas" + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" +msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:lisfreepascalsourcesnotfound +msgid "Free Pascal Sources not found" +msgstr "Nerasti FreePascal pirminiai kodai" + +#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun +msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" +msgstr "Nerastas FreePascal pirminių kodų katalogas.%sKai kurios funkcijos neveiks.%sRekomenduotina įdiegti FreePascal pirminius kodus ir nurodyti kelią iki jų%s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory +msgid "Invalid Free Pascal source directory" +msgstr "Klaidingas FreePascal pirminio kodo katalogas" + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" +msgstr "Dabartinis FreePascal pirminio kodo katalogas %s%s%s%s nėra geras.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:lislazarusdirectorynotfound +msgid "Lazarus directory not found" +msgstr "Nerastas Lazarus katalogas" + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" +msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou +msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr +msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" +msgstr "Nerastas Lazarus katalogas %s%s%s%s.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr +msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis FreePascal pirminių kodų katalogas %s%s%s%s nėra geras.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti %s\"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho +msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" +msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"." + +#: lazarusidestrconsts:lishlpoptshelpoptions +msgid "Help Options" +msgstr "Žinyno parinktys" + +#: lazarusidestrconsts:lishlpoptsviewers +msgid "Viewers" +msgstr "Žiūriklės" + +#: lazarusidestrconsts:lishofpcdochtmlpath +msgid "FPC Doc HTML Path" +msgstr "FPC Doc HTML kelias" + +#: lazarusidestrconsts:lishlpoptsproperties +msgid "Properties:" +msgstr "Savybės:" + +#: lazarusidestrconsts:lishlpoptsdatabases +msgid "Databases" +msgstr "Duomenų bazės" + +#: lazarusidestrconsts:lisencloseselection +msgid "Enclose Selection" +msgstr "Apgaubti pažymėtąjį" + +#: lazarusidestrconsts:lisenclose +msgid "Enclose" +msgstr "Apgaubti" + +#: lazarusidestrconsts:lischoosestructuretoencloseselection +msgid "Choose structure to enclose selection" +msgstr "Nurodykite kokią struktūrą apgaubti pažymėtąjį kodą" + +#: lazarusidestrconsts:liserrors +msgid "Errors" +msgstr "Klaidos" + +#: lazarusidestrconsts:lislfmfile +msgid "LFM file" +msgstr "LFM failas" + +#: lazarusidestrconsts:lisremoveallinvalidproperties +msgid "Remove all invalid properties" +msgstr "Pašalinti klaidingas savybes" + +#: lazarusidestrconsts:liscomptest +msgid "Test" +msgstr "Testas" + +#: lazarusidestrconsts:lisa2pswitchpaths +msgid "Switch Paths" +msgstr "Kitoks kelias" + +#: lazarusidestrconsts:lisa2paddfilestopackage +msgid "Add files to package" +msgstr "Įdėti failus į paketą" + +#: lazarusidestrconsts:lisa2paddtopackage +msgid "Add to package" +msgstr "Įdėti į paketą" + +#: lazarusidestrconsts:lisa2pfilename2 +msgid "Filename" +msgstr "Failo vardas" + +#: lazarusidestrconsts:lisfrifindorrenameidentifier +msgid "Find or Rename Identifier" +msgstr "Ieškoti identifikatoriaus arba jį pervardyti" + +#: lazarusidestrconsts:lishelpselectordialog +msgid "Help selector" +msgstr "Žinyno parinktys" + +#: lazarusidestrconsts:lisselectahelpitem +msgid "Select a help item:" +msgstr "Rinkitės žinyno elementą:" + +#: lazarusidestrconsts:liserrormovingcomponent +msgid "Error moving component" +msgstr "Klaida perkeliant komponentę" + +#: lazarusidestrconsts:liserrormovingcomponent2 +msgid "Error moving component %s:%s" +msgstr "Įvyko klaida perkeliant komponentę %s:%s" + +#: lazarusidestrconsts:lisinstalledpackages +msgid "Installed Packages" +msgstr "Įdiegti paketai" + +#: lazarusidestrconsts:lisavailablepackages +msgid "Available packages" +msgstr "Galimi paketai" + +#: lazarusidestrconsts:lisexportlist +msgid "Export list" +msgstr "Eksportuoti sąrašą" + +#: lazarusidestrconsts:lisimportlist +msgid "Import list" +msgstr "Importuoti sąrašą" + +#: lazarusidestrconsts:lisuninstallselection +msgid "Uninstall selection" +msgstr "Išdiegti pažymėtą" + +#: lazarusidestrconsts:lispackagestoinstallintheide +msgid "Packages to install in the IDE" +msgstr "Į IKA diegtini paketai" + +#: lazarusidestrconsts:lisinstallselection +msgid "Install selection" +msgstr "Įdiegti pažymėtą" + +#: lazarusidestrconsts:lispackageinfo +msgid "Package Info" +msgstr "Informacija apie paketą" + +#: lazarusidestrconsts:lissaveandrebuildide +msgid "Save and rebuild IDE" +msgstr "Išsaugoti ir daryti IKA" + +#: lazarusidestrconsts:lissaveandexitdialog +msgid "Save and exit dialog" +msgstr "Išsaugoti ir uždaryti" + +#: lazarusidestrconsts:lisalignment +msgid "Alignment" +msgstr "Lygiuotė" + +#: lazarusidestrconsts:lishorizontal +msgid "Horizontal" +msgstr "Horizontaliai" + +#: lazarusidestrconsts:lisnochange +msgid "No change" +msgstr "Nekeisti" + +#: lazarusidestrconsts:listops +msgid "Tops" +msgstr "Sutapdinti viršutinius kraštus" + +#: lazarusidestrconsts:lisleftsides +msgid "Left sides" +msgstr "Sutapdinti kairiuosius kraštus" + +#: lazarusidestrconsts:liscenters +msgid "Centers" +msgstr "Sutapdinti centrus" + +#: lazarusidestrconsts:lisbottoms +msgid "Bottoms" +msgstr "Sutapdinti apatinius kraštus" + +#: lazarusidestrconsts:lisrightsides +msgid "Right sides" +msgstr "Sutapdinti dešiniuosius kraštus" + +#: lazarusidestrconsts:liscenterinwindow +msgid "Center in window" +msgstr "Centruoti lange" + +#: lazarusidestrconsts:lisspaceequally +msgid "Space equally" +msgstr "Vienodais tarpais tarp elementu" + +#: lazarusidestrconsts:listopspaceequally +msgid "Top space equally" +msgstr "Tolygiai rikiuoti pagal viršutinius kraštus" + +#: lazarusidestrconsts:lisbottomspaceequally +msgid "Bottom space equally" +msgstr "Tolygiai rikiuoti pagal apatinius kraštus" + +#: lazarusidestrconsts:lisleftspaceequally +msgid "Left space equally" +msgstr "Tolygiai rikiuoti pagal kairiuosius kraštus" + +#: lazarusidestrconsts:lisrightspaceequally +msgid "Right space equally" +msgstr "Tolygiai rikiuoti pagal dešiniuosius kraštus" + +#: lazarusidestrconsts:lisvertical +msgid "Vertical" +msgstr "Vertikaliai " + +#: lazarusidestrconsts:lisscalingfactor +msgid "Scaling factor:" +msgstr "Santykinis mastelis:" + +#: lazarusidestrconsts:liscustomprogram +msgid "Custom Program" +msgstr "naudotojo programa" + +#: lazarusidestrconsts:lisprogram +msgid "Program" +msgstr "Programa" + +#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic +msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." +msgstr "Programa%sFreePascal programa. Lazarus automatiškai rūpinsis programos failu." + +#: lazarusidestrconsts:liscustomprogramafreepascalprogram +msgid "Custom Program%sA freepascal program." +msgstr "Naudotojo programa%sFreePascal programa." + +#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin +msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." +msgstr "Biblioteka%sFreePascal biblioteka (.dll Windows aplinkoje, .so Linux aplinkoje, .dylib MacOsX aplinkoje). Lazarus automatiškai rūpinsis bibliotekos pirminio kodo failu." + +#: lazarusidestrconsts:lisnpselectaprojecttype +msgid "Select a project type" +msgstr "Pasirinkite projekto tipą" + +#: lazarusidestrconsts:lisnpcreateanewproject +msgid "Create a new project" +msgstr "Kurti naują projektą" + +#: lazarusidestrconsts:lisnpcreate +msgid "Create" +msgstr "Sukurti" + +#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty +msgid "Choose a base class for the favourite property %s%s%s." +msgstr "Mėgstamiausiąjai savybei %s%s%s parinkite bazinę klasę." + +#: lazarusidestrconsts:lisoifaddtofavouriteproperties +msgid "Add to favourite properties" +msgstr "Pridėti prie mėgstamiausiųjų savybių" + +#: lazarusidestrconsts:lisoifremovefromfavouriteproperties +msgid "Remove from favourite properties" +msgstr "Pašalinti iš mėgstamiausiųjų savybių" + +#: lazarusidestrconsts:lisreplacingselectionfailed +msgid "Replacing selection failed." +msgstr "Pakeisti pažymėtąjį nepavyko." + +#: lazarusidestrconsts:lisunabletofindinlfmstream +msgid "Unable to find %s in LFM Stream." +msgstr "LFM sraute nepavyko rasti %s." + +#: lazarusidestrconsts:liserrorparsinglfmcomponentstream +msgid "Error parsing lfm component stream." +msgstr "Įvyko klaida analizuojant lfm komponentės srautą." + +#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer +msgid "Unable to create temporary lfm buffer." +msgstr "Nepavyko sukurti laikino lfm buferio." + +#: lazarusidestrconsts:lisunabletogetsourcefordesigner +msgid "Unable to get source for designer." +msgstr "Nepavyko gauti pirminio kodo, skirto konstruktoriui." + +#: lazarusidestrconsts:lisunabletogathereditorchanges +msgid "Unable to gather editor changes." +msgstr "Nepavyko susekti pokyčių redaktoriuje." + +#: lazarusidestrconsts:lisunabletostreamselectedcomponents2 +msgid "Unable to stream selected components." +msgstr "Nepavyko pasirinktas komponentes nusiųsti srautu." + +#: lazarusidestrconsts:lisunabletochangeclassofto +msgid "%s%sUnable to change class of %s to %s" +msgstr "%s%sNepavyko %s klasę pakeisti į %s" + +#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents +msgid "Can only change the class of TComponents." +msgstr "Galima keisti tik TComponen'ų klasę." + +#: lazarusidestrconsts:lisoldclass +msgid "Old Class" +msgstr "Buvusi klasė" + +#: lazarusidestrconsts:lisnewclass +msgid "New Class" +msgstr "Nauja klasė" + +#: lazarusidestrconsts:lisoldancestors +msgid "Old Ancestors" +msgstr "Buvęs protėvis" + +#: lazarusidestrconsts:lisnewancestors +msgid "New Ancestors" +msgstr "Naujas protėvis" + +#: lazarusidestrconsts:lisceocodeexplorer +msgid "CodeExplorer Options" +msgstr "Kodo tyrinėtojo parinktys" + +#: lazarusidestrconsts:lisceoupdate +msgid "Update" +msgstr "Atnaujinimas" + +#: lazarusidestrconsts:lisceorefreshautomatically +msgid "Refresh automatically" +msgstr "Atnaujinti automatiškai" + +#: lazarusidestrconsts:lisceoneveronlymanually +msgid "Never, only manually" +msgstr "Niekada, tik rankiniu būdu" + +#: lazarusidestrconsts:lisceowhenswitchingfile +msgid "When switching file in source editor" +msgstr "Perjungiant failą kodo redaktoriuje" + +#: lazarusidestrconsts:lisceoonidle +msgid "On idle" +msgstr "Neveikos metu" + +#: lazarusidestrconsts:liscefollowcursor +msgid "Follow cursor" +msgstr "Sekti žymeklį" + +#: lazarusidestrconsts:lismenulazdoc +msgid "LazDoc Editor" +msgstr "LazDoc redaktorius" + +#: lazarusidestrconsts:lislazdocmainformcaption +msgid "LazDoc editor" +msgstr "LazDoc redaktorius" + +#: lazarusidestrconsts:lislazdocnotagcaption +msgid "" +msgstr "" + +#: lazarusidestrconsts:lislazdocnodocumentation +msgid "Documentation entry does not exist" +msgstr "Dokumento įrašas neegzistuoja" + +#: lazarusidestrconsts:lislazdocinherited +msgid "Inherited" +msgstr "Paveldas" + +#: lazarusidestrconsts:lislazdocshorttag +msgid "Short" +msgstr "Santrumpa" + +#: lazarusidestrconsts:lislazdocdescrtag +msgid "Description" +msgstr "Aprašymas" + +#: lazarusidestrconsts:lislazdocerrorstag +msgid "Errors" +msgstr "Klaidos" + +#: lazarusidestrconsts:lislazdocseealsotag +msgid "See also" +msgstr "Taip pat žiūrėkite" + +#: lazarusidestrconsts:lislazdocaddpathbutton +msgid "Add path" +msgstr "Pridėti kelią" + +#: lazarusidestrconsts:lislazdocdeletepathbutton +msgid "Remove path" +msgstr "Pašalinti kelią" + +#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow +msgid "NOTE: only absolute paths are supported now" +msgstr "Pastaba: šiuo metu palaikomi tik absoliutūs keliai" + +#: lazarusidestrconsts:lislazdocpathsgroupbox +msgid "LazDoc settings" +msgstr "LazDoc nuostatos" + +#: lazarusidestrconsts:lislazdochintboldformat +msgid "Insert bold formatting tag" +msgstr "Įterpti pusjuodžio formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintitalicformat +msgid "Insert italic formatting tag" +msgstr "Įterpti kursyvo formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintunderlineformat +msgid "Insert underline formatting tag" +msgstr "Įterpti pabraukimo formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintinsertcodetag +msgid "Insert code formatting tag" +msgstr "Įterpti kodo formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintremarktag +msgid "Insert remark formatting tag" +msgstr "Įterpti pastabos formatavimo gairę" + +#: lazarusidestrconsts:lislazdochintvartag +msgid "Insert var formatting tag" +msgstr "Įterpti kintamojo formatavimo gairę" + +#: lazarusidestrconsts:lislazdocaddlinkbutton +msgid "Add link" +msgstr "Pridėti nuorodą" + +#: lazarusidestrconsts:lislazdocdeletelinkbutton +msgid "Delete link" +msgstr "Pašalinti nuorodą" + +#: lazarusidestrconsts:lislazdocexampletag +msgid "Example" +msgstr "Pavyzdys" + +#: lazarusidestrconsts:lislazdocbrowseexamplebutton +msgid "Browse" +msgstr "Naršyti" + +#: lazarusidestrconsts:lisldmoveentriestoinherited +msgid "Move entries to inherited" +msgstr "Įrašus perkelti į paveldą" + +#: lazarusidestrconsts:lisldcopyfrominherited +msgid "Copy from inherited" +msgstr "Kopijuoti iš paveldo" + +#: lazarusidestrconsts:lisenablemacros +msgid "Enable Macros" +msgstr "Įgalinti makrokomandas" + +#: lazarusidestrconsts:lisctselectcodemacro +msgid "Select Code Macro" +msgstr "Išrink kodo makrokomandą" + +#: lazarusidestrconsts:lispdprogress +msgid "Progress" +msgstr "Eiga" + +#: lazarusidestrconsts:lispdabort +msgid "Abort" +msgstr "Nutraukti" + +#: lazarusidestrconsts:lisposaveinlpifil +msgid "Save in .lpi file" +msgstr "Išsaugoti .lpi faile" + +#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory +msgid "Save in .lps file in project directory" +msgstr "Išsaugoti .lps faile, projekto kataloge" + +#: lazarusidestrconsts:lisposaveinideconfigdirectory +msgid "Save in IDE config directory" +msgstr "Išsaugoti IKA nustatymų kataloge" + +#: lazarusidestrconsts:lispodonotsaveanysessioninfo +msgid "Do not save any session info" +msgstr "Sesijos informacijos neišsaugoti" + +#: lazarusidestrconsts:lisposavesessioninformationin +msgid "Save session information in" +msgstr "Sesijos informaciją išsaugoti į" + +#: lazarusidestrconsts:lismvsavemessagestofiletxt +msgid "Save messages to file (*.txt)" +msgstr "Išsaugoti pranešimus faile (*.txt)" + +#: lazarusidestrconsts:lisshowoldtaborder +msgid "Show old tab order" +msgstr "Rodyti buvusią vietą tabuliatoriaus eilėje" + +#: lazarusidestrconsts:listaborderof +msgid "Tab Order of" +msgstr "Vieta tabuliatoriaus eilėje" + +#: lazarusidestrconsts:lisanchorenabledhint +msgid "Enabled = Include %s in Anchors" +msgstr "Veiksnus = %s įtraukti į prieraišų sąrašą" + +#: lazarusidestrconsts:lisaroundborderspacehint +msgid "Borderspace around the control. The other four borderspaces are added to this value." +msgstr "Pagrindinis kraštinės plotis apie komponentę.\nŠi reikšmė bus pridedama prie kitų kraštinių pločių" + +#: lazarusidestrconsts:listopborderspacespinedithint +msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." +msgstr "Viršutinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą viršutinės kraštinės plotį" + +#: lazarusidestrconsts:lisbottomborderspacespinedithint +msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." +msgstr "Apatinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą apatinės kraštinės plotį" + +#: lazarusidestrconsts:lisleftborderspacespinedithint +msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." +msgstr "Kairės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą kairiosios kraštinės plotį" + +#: lazarusidestrconsts:lisrightborderspacespinedithint +msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." +msgstr "Dešinės kraštinės plotis.\nŠi reikšmė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą dešiniosios kraštinės plotį" + +#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling +msgid "Center control vertically relative to the given sibling" +msgstr "Komponentę centruoti vertikaliai pagal nurodytą kaimyną" + +#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling +msgid "Center control horizontally relative to the given sibling" +msgstr "Komponentę centruoti horizontaliai pagal nurodytą kaimyną" + +#: lazarusidestrconsts:lisanchortotopsidekeepborderspace +msgid "Anchor to top side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno viršutiniojo krašto" + +#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace +msgid "Anchor to bottom side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno apatiniojo krašto" + +#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace +msgid "Anchor to left side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno kairiojo krašto" + +#: lazarusidestrconsts:lisanchortorightsidekeepborderspace +msgid "Anchor to right side of sibling, keep border space" +msgstr "Kraštinės pločio atstumu pririšti prie kaimyno dešiniojo krašto" + +#: lazarusidestrconsts:listopsiblingcomboboxhint +msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." +msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas viršutinis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisbottomsiblingcomboboxhint +msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." +msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas apatinis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisrightsiblingcomboboxhint +msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." +msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas dešinysis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisleftsiblingcomboboxhint +msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." +msgstr "Tai kaimyninė komponentė, prie kurios bus pririštas kairysis kraštas.\nJei reikalingas tėvas, palikite lauką tuščia." + +#: lazarusidestrconsts:lisborderspace +msgid "BorderSpace" +msgstr "Kraštinės plotis" + +#: lazarusidestrconsts:lissibling +msgid "Sibling" +msgstr "Kaimynas" + +#: lazarusidestrconsts:lisenabled +msgid "Enabled" +msgstr "Veiksnus" + +#: lazarusidestrconsts:lisrightanchoring +msgid "Right anchoring" +msgstr "Dešinės prieraiša" + +#: lazarusidestrconsts:listopanchoring +msgid "Top anchoring" +msgstr "Viršaus prieraiša" + +#: lazarusidestrconsts:lisleftgroupboxcaption +msgid "Left anchoring" +msgstr "Kairės prieraiša" + +#: lazarusidestrconsts:lisbottomgroupboxcaption +msgid "Bottom anchoring" +msgstr "Apačios prieraiša" + +#: lazarusidestrconsts:lisunabletosetanchorsidecontrolŠ +msgid "Unable to set AnchorSide Control" +msgstr "Kraštą pririšti prie komponentės neįmanoma" + +#: lazarusidestrconsts:lisanchoreditornocontrolselected +msgid "Anchor Editor - no control selected" +msgstr "Prieraišų redaktorius - nėra pažymėtų komponenčių" + +#: lazarusidestrconsts:lisanchorsofselectedcontrols +msgid "Anchors of selected controls" +msgstr "Pažymėtos komponentės prieraišos" + +#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath +msgid "Additional search path" +msgstr "Papildomi paieškos keliai" + +#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions +msgid "Debugger general options" +msgstr "Derintuvės pagrindinės parinktys" + +#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop +msgid "Show message on stop" +msgstr "Rodyti pranešimą sustabdžius" + +#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific +msgid "Debugger specific options (depends on type of debugger)" +msgstr "Derintuvės specifinės parinktys (priklauso nuo derintuvės tipo)" + +#: lazarusidestrconsts:lisdebugoptionsfrmeventlog +msgid "Event Log" +msgstr "Įvykių žurnalas" + +#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun +msgid "Clear log on run" +msgstr "Išvalyti žurnalą paleidžiant" + +#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto +msgid "Limit linecount to" +msgstr "Riboti eilučių kiekį iki" + +#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint +msgid "Breakpoint" +msgstr "Stabdos taškas" + +#: lazarusidestrconsts:lisdebugoptionsfrmprocess +msgid "Process" +msgstr "Procesas" + +#: lazarusidestrconsts:lisdebugoptionsfrmthread +msgid "Thread" +msgstr "Gija" + +#: lazarusidestrconsts:lisdebugoptionsfrmmodule +msgid "Module" +msgstr "Modulis" + +#: lazarusidestrconsts:lisdebugoptionsfrmoutput +msgid "Output" +msgstr "Išvestis" + +#: lazarusidestrconsts:lisdebugoptionsfrmwindow +msgid "Window" +msgstr "Langas" + +#: lazarusidestrconsts:lisdebugoptionsfrminterface +msgid "Interface" +msgstr "Interfeisas" + +#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions +msgid "Language Exceptions" +msgstr "Kalbos išimtinės situacijos" + +#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions +msgid "Ignore these exceptions" +msgstr "Ignoruoti šias išimtines situacijas" + +#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions +msgid "Break on Lazarus Exceptions" +msgstr "Stabdyti esant Lazarus išimtinei situacijai" + +#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions +msgid "OS Exceptions" +msgstr "OS išimtinės situacijos" + +#: lazarusidestrconsts:lisdebugoptionsfrmsignals +msgid "Signals" +msgstr "Signalai" + +#: lazarusidestrconsts:lisdebugoptionsfrmname +msgid "Name" +msgstr "Vardas" + +#: lazarusidestrconsts:lisdebugoptionsfrmid +msgid "ID" +msgstr "ID" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledby +msgid "Handled by" +msgstr "Apdoroja" + +#: lazarusidestrconsts:lisdebugoptionsfrmresume +msgid "Resume" +msgstr "Tęsti" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram +msgid "Handled by Program" +msgstr "Apdoroja programa" + +#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger +msgid "Handled by Debugger" +msgstr "Apdoroja derintuvė" + +#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled +msgid "Resume Handled" +msgstr "Tęsti apdorojant" + +#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled +msgid "Resume Unhandled" +msgstr "Tęsti praleidžiant" + +#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage +msgid "Help for FreePascal Compiler message" +msgstr "Informacija apie FreePascal Compiler pranešimą" + +#: lazarusidestrconsts:lisrelativepaths +msgid "Relative paths" +msgstr "Santykiniai keliai" + +#: lazarusidestrconsts:lislazbuildsavesettings +msgid "Save settings" +msgstr "Išsaugoti nuostatas" + +#: lazarusidestrconsts:rsformdatafiledfm +msgid "Form data file (*.dfm)|*.dfm" +msgstr "Formos duomenų failas (*.dfm)|*.dfm" + +#: lazarusidestrconsts:liswlwatchlist +msgid "Watch list" +msgstr "Stebimų sąrašas" + +#: lazarusidestrconsts:liswlexpression +msgid "Expression" +msgstr "Išraiška" + +#: lazarusidestrconsts:liskmchoosekeymappingscheme +msgid "Choose Keymapping scheme" +msgstr "Rinkitės klavišų priskyrimo schemą" + +#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme +msgid "Note: All keys will be set to the values of the choosen scheme." +msgstr "Pastaba: visi klavišai bus nustatyti pagal pasirinktą schemą" + +#: lazarusidestrconsts:liskmkeymappingscheme +msgid "Keymapping Scheme" +msgstr "Klavišų priskyrimo schema" + +#: lazarusidestrconsts:lisifdok +msgid "OK" +msgstr "Tinka" + +#: lazarusidestrconsts:lispvueditvirtualunit +msgid "Edit virtual unit" +msgstr "Keisti virtualų modulį" + +#: lazarusidestrconsts:versioninfotitle +msgid "Version Info" +msgstr "Versijos informacija" + +#: lazarusidestrconsts:lisplistobjects +msgid "&Objects" +msgstr "&Objektai" + +#: lazarusidestrconsts:lisplistjumptoselection +msgid "Jump To Selection" +msgstr "Rodyti žymėjimą" + +#: lazarusidestrconsts:lisplistfilterany +msgid "Filter by matching any part of method" +msgstr "Filtruoti pagal bet kurią metodo dalį" + +#: lazarusidestrconsts:lisplistfilterstart +msgid "Filter by matching with start of method" +msgstr "Filtruoti pagal metodo pradžią" + +#: lazarusidestrconsts:lisplistchangefont +msgid "Change Font" +msgstr "Keisti šriftą" + +#: lazarusidestrconsts:lisplistcopymethodtoclipboard +msgid "Copy method name to the clipboard" +msgstr "Metodo vardą kopijuoti į iškarpinę" + +#: lazarusidestrconsts:lisplisttype +msgid "Type" +msgstr "Tipas" + +#: lazarusidestrconsts:lisplistall +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisplistnone +msgid "" +msgstr "" + +#: lazarusidestrconsts:lisuiclearincludedbyreference +msgid "Clear include cache" +msgstr "Išvalyti įtraukiamų failų podėlį" + +#: lazarusidestrconsts:lischangeparent +msgid "Change parent ..." +msgstr "Pakeisti tėvą..." + +#: lazarusidestrconsts:lislazaruside +msgid "Lazarus IDE" +msgstr "Lazarus IKA" + diff --git a/lcl/languages/lclstrconsts.lt.po b/lcl/languages/lclstrconsts.lt.po new file mode 100644 index 0000000000..b7e1512c0b --- /dev/null +++ b/lcl/languages/lclstrconsts.lt.po @@ -0,0 +1,833 @@ +# translation of lclstrconsts.po to Lithuanian +# Header entry was created by KBabel! +# +#: lclstrconsts:snomdiform +# Valdas Jankūnas , 2007. +msgid "" +msgstr "" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Mime-Version: 1.0Last-Translator: Valdas Jankūnas \n" +"PO-Revision-Date: 2007-08-26 14:51+0300\n" +"Project-Id-Version: lclstrconsts\n" +"Language-Team: Lithuanian\n" +"X-Generator: KBabel 1.11.4\n" +"MIME-Version: 1.0\n" +"Last-Translator: Valdas Jankūnas \n" + +#: lclstrconsts:snomdiform +msgid "No MDI form present." +msgstr "MDI formos nėra." + +#: lclstrconsts:rsmbyes +msgid "&Yes" +msgstr "T&aip" + +#: lclstrconsts:rsmbno +msgid "&No" +msgstr "&Ne" + +#: lclstrconsts:rsmbok +msgid "&OK" +msgstr "&Tinka" + +#: lclstrconsts:rsmbcancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lclstrconsts:rsmbabort +msgid "Abort" +msgstr "Nutraukti" + +#: lclstrconsts:rsmbretry +msgid "&Retry" +msgstr "Ka&rtoti" + +#: lclstrconsts:rsmbignore +msgid "&Ignore" +msgstr "&Ignoruoti" + +#: lclstrconsts:rsmball +msgid "&All" +msgstr "&Visi" + +#: lclstrconsts:rsmbnotoall +msgid "No to all" +msgstr "Visiada ne" + +#: lclstrconsts:rsmbyestoall +msgid "Yes to &All" +msgstr "Visa&da taip" + +#: lclstrconsts:rsmbhelp +msgid "&Help" +msgstr "Žin&ynas" + +#: lclstrconsts:rsmbclose +msgid "&Close" +msgstr "&Užverti" + +#: lclstrconsts:rsmtwarning +msgid "Warning" +msgstr "Perspėjimas" + +#: lclstrconsts:rsmterror +msgid "Error" +msgstr "Klaida" + +#: lclstrconsts:rsmtinformation +msgid "Information" +msgstr "Informacija" + +#: lclstrconsts:rsmtconfirmation +msgid "Confirmation" +msgstr "Patvirtinimas" + +#: lclstrconsts:rsmtcustom +msgid "Custom" +msgstr "Naudotojo" + +#: lclstrconsts:rsfdopenfile +msgid "Open existing file" +msgstr "Atverti egzistuojanti failą" + +#: lclstrconsts:rsfdoverwritefile +msgid "Overwrite file ?" +msgstr "Perrašyti failą?" + +#: lclstrconsts:rsfdfilealreadyexists +msgid "The file \"%s\" already exists. Overwrite ?" +msgstr "Toks failas \"%s\" jayu yra. Rašyti ant viršaus?" + +#: lclstrconsts:rsfdpathmustexist +msgid "Path must exist" +msgstr "Kelias turi egzistuoti" + +#: lclstrconsts:rsfdpathnoexist +msgid "The path \"%s\" does not exist." +msgstr "Kelias \"%s\" neegzistuoja." + +#: lclstrconsts:rsfdfilemustexist +msgid "File must exist" +msgstr "Failas turi egzistuoti" + +#: lclstrconsts:rsfddirectorymustexist +msgid "Directory must exist" +msgstr "Katalogas turi egzistuoti" + +#: lclstrconsts:rsfdfilenotexist +msgid "The file \"%s\" does not exist." +msgstr "Failas \"%s\" neegzistuoja." + +#: lclstrconsts:rsfddirectorynotexist +msgid "The directory \"%s\" does not exist." +msgstr "Katalogas \"%s\" neegzistuoja." + +#: lclstrconsts:rsfind +msgid "Find" +msgstr "Ieškoti" + +#: lclstrconsts:rsfdfilereadonlytitle +msgid "File is not writable" +msgstr "Failas ne rašymui" + +#: lclstrconsts:rsfdfilereadonly +msgid "The file \"%s\" is not writable." +msgstr "Failas \"%s\" nėra skirtas rašymui." + +#: lclstrconsts:rsfdfilesaveas +msgid "Save file as" +msgstr "Išsaugoti failą kaip" + +#: lclstrconsts:rsallfiles +msgid "All files (%s)|%s|%s" +msgstr "Visi failai (%s)|%s|%s" + +#: lclstrconsts:rsfdselectdirectory +msgid "Select Directory" +msgstr "Nurodykit katalogą" + +#: lclstrconsts:rsdirectory +msgid "&Directory" +msgstr "&Katalogas" + +#: lclstrconsts:rsselectcolortitle +msgid "Select color" +msgstr "Nurodykit spalvą" + +#: lclstrconsts:rsselectfonttitle +msgid "Select a font" +msgstr "Nurodykit šriftą" + +#: lclstrconsts:rsfindmore +msgid "Find more" +msgstr "Ieškoti toliau" + +#: lclstrconsts:rsreplace +msgid "Replace" +msgstr "Pakeisti" + +#: lclstrconsts:rsreplaceall +msgid "Replace all" +msgstr "Pakeisti visus" + +#: lclstrconsts:rswarningunremovedpaintmessages +msgid " WARNING: There are %s unremoved LM_PAINT/LM_GtkPAINT message links left." +msgstr " Perspėjimas: liko %s nepašalintos nuorodos į LM_PAINT/LM_GtkPAINT pranešimus." + +#: lclstrconsts:rswarningunreleaseddcsdump +msgid " WARNING: There are %d unreleased DCs, a detailed dump follows:" +msgstr " Perspėjimas: liko %d neatlaisvinti \"DC\", išsamiau:" + +#: lclstrconsts:rswarningunreleasedgdiobjectsdump +msgid " WARNING: There are %d unreleased GDIObjects, a detailed dump follows:" +msgstr " Perspėjimas: liko %d neatlaisvinti \"GDIObject\", išsamiau:" + +#: lclstrconsts:rswarningunreleasedmessagesinqueue +msgid " WARNING: There are %d messages left in the queue! I'll free them" +msgstr " Perspėjimas: eilėje dar yra %d pranešimų, jie bus pašalinti." + +#: lclstrconsts:rswarningunreleasedtimerinfos +msgid " WARNING: There are %d TimerInfo structures left, I'll free them" +msgstr " Perspėjimas: dar liko %d \"TimerInfo\" struktūrų, jos bus sunaikintos." + +#: lclstrconsts:rsfileinformation +msgid "File information" +msgstr "Informacija apie failą" + +#: lclstrconsts:rsgtkfilter +msgid "Filter:" +msgstr "Filtras:" + +#: lclstrconsts:rsgtkhistory +msgid "History:" +msgstr "Istorija:" + +#: lclstrconsts:rsdefaultfileinfovalue +msgid "permissions user group size date time" +msgstr "leidimai naudotojas grupė dydis data laikas" + +#: lclstrconsts:rsblank +msgid "Blank" +msgstr "Tuščias" + +#: lclstrconsts:rsunabletoloaddefaultfont +msgid "Unable to load default font" +msgstr "Nepavyko įkelti numatytą šriftą" + +#: lclstrconsts:rsfileinfofilenotfound +msgid "(file not found: \"%s\")" +msgstr "(failas nerastas: \"%s\")" + +#: lclstrconsts:rsgtkoptionnotransient +msgid "--lcl-no-transient Do not set transient order for modal forms" +msgstr "--lcl-no-transient Modalinių formų eilę nedaryti trumpalaikę." + +#: lclstrconsts:rsgtkoptionmodule +msgid "--gtk-module module Load the specified module at startup." +msgstr "--gtk-module modulis Starto metu įkelti nurodytą modulį." + +#: lclstrconsts:rsgoptionfatalwarnings +msgid "--g-fatal-warnings Warnings and errors generated by Gtk+/GDK will halt the application." +msgstr "--g-fatal-warnings GTK+ ar GDK sugeneravus perspėjimą arba klaidą, programa bus sustabdyta." + +#: lclstrconsts:rsgtkoptiondebug +msgid "--gtk-debug flags Turn on specific Gtk+ trace/debug messages." +msgstr "--gtk-debug žymės Įjungiami nurodyti GTK+ sekimo/derinimo pranešimai." + +#: lclstrconsts:rsgtkoptionnodebug +msgid "--gtk-no-debug flags Turn off specific Gtk+ trace/debug messages." +msgstr "--gtk-no-debug žymės Išungiami nurodyti GTK+ sekimo/derinimo pranešimai." + +#: lclstrconsts:rsgdkoptiondebug +msgid "--gdk-debug flags Turn on specific GDK trace/debug messages." +msgstr "--gdk-debug žymės Įjungiami nurodyti GDK sekimo/derinimo pranešimai." + +#: lclstrconsts:rsgdkoptionnodebug +msgid "--gdk-no-debug flags Turn off specific GDK trace/debug messages." +msgstr "--gdk-no-debug žymės Išjungiami nurodyti GDK sekimo/derinimo pranešimai." + +#: lclstrconsts:rsgtkoptiondisplay +msgid "--display h:s:d Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used." +msgstr "--display h:s:d Prisijunti prie nurodyto X serverio, čia \"h\" yra hostname, \"s\" - serverio numeris (paprastai 0), ir \"d\" - ekrano numeris (dažniausia praleidžiamas). Jei --display nenurodytas, tada naudojamas DISPLAY aplinkos kintamasis." + +#: lclstrconsts:rsgtkoptionsync +msgid "--sync Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediatey after the protocol request that generated the error has been processed by the X server." +msgstr "--sync Kai XServer ryšys sukurtas, vykdyti \"XSynchronize (display, True)\". Tai padarys lengvesnį X protokolo klaidų derinimą, nes bus išjungtas X kreipinių buferis ir X serveriui protokolo kreipinio apdorojimo metu įvykusi klaida bus gauta iškart." + +#: lclstrconsts:rsgtkoptionnoxshm +msgid "--no-xshm Disable use of the X Shared Memory Extension." +msgstr "--no-xshm Nenaudoti \"X Shared Memory\" plėtinio." + +#: lclstrconsts:rsgtkoptionname +msgid "--name programe Set program name to \"progname\". If not specified, program name will be set to ParamStr(0)." +msgstr "--name programos_vardas Programos vardas tampa \"programos_vardas\". Jei nenurodyta, tai programos vardas bus gautas iš ParamStr(0)." + +#: lclstrconsts:rsgtkoptionclass +msgid "--class classname Following Xt conventions, the class of a program is the program name with the initial character capitalized. For example, the classname for gimp is \"Gimp\". If --class is specified, the class of the program will be set to \"classname\"." +msgstr "--class klasės_vardas Pagal Xt susitarimą, programos klasė yra programos vardas, kuriame pirmoji raidė yra didžioji. Pavyzdžiui: GIMP programos klasė yra \"Gimp\". Jei --class nurodytas, tai klasės vardas bus priskirtas \"classname\"." + +#: lclstrconsts:rswin32warning +msgid "Warning:" +msgstr "Perspėjimas:" + +#: lclstrconsts:rswin32error +msgid "Error:" +msgstr "Klaida:" + +#: lclstrconsts:sinvalidactionregistration +msgid "Invalid action registration" +msgstr "Klaidingas veiksmo registravimas" + +#: lclstrconsts:sinvalidactionunregistration +msgid "Invalid action unregistration" +msgstr "Klaidingas veiksmo išregravimas" + +#: lclstrconsts:sinvalidactionenumeration +msgid "Invalid action enumeration" +msgstr "Klaidinga veiksmo enumeracija" + +#: lclstrconsts:sinvalidactioncreation +msgid "Invalid action creation" +msgstr "Klaidingas veiksmo kūrimas" + +#: lclstrconsts:smenunotfound +msgid "Sub-menu is not in menu" +msgstr "Pomeniu nėra įdėtas į menių" + +#: lclstrconsts:smenuindexerror +msgid "Menu index out of range" +msgstr "Meniu indeksas peržengia ribas" + +#: lclstrconsts:smenuitemisnil +msgid "MenuItem is nil" +msgstr "\"MenuItem\" reikšmė yra nil" + +#: lclstrconsts:snotimers +msgid "No timers available" +msgstr "Nėra laikmačių" + +#: lclstrconsts:sinvalidindex +msgid "Invalid ImageList Index" +msgstr "Klaidingas \"ImageList\" indeksas" + +#: lclstrconsts:sinvalidimagesize +msgid "Invalid image size" +msgstr "Klaidingas paveikslo dydis" + +#: lclstrconsts:sduplicatemenus +msgid "Duplicate menus" +msgstr "Meniu dubliuojasi" + +#: lclstrconsts:scannotfocus +msgid "Cannot focus a disabled or invisible window" +msgstr "Neįgalintą arba nematomą langą suaktyvinti negalima" + +#: lclstrconsts:sinvalidcharset +msgid "The char set in mask \"%s\" is not valid!" +msgstr "Klaidinga kaukės \"%s\" koduotė!" + +#: lclstrconsts:rslistmustbeempty +msgid "List must be empty" +msgstr "Sąrašas turi būti tuščias" + +#: lclstrconsts:rsinvalidpropertyvalue +msgid "Invalid property value" +msgstr "Klaidinga savybės reikšmė" + +#: lclstrconsts:rspropertydoesnotexist +msgid "Property %s does not exist" +msgstr "Savybė %s neegzistuoja" + +#: lclstrconsts:rsinvalidstreamformat +msgid "Invalid stream format" +msgstr "Klaidingas srauto formatas" + +#: lclstrconsts:rserrorreadingproperty +msgid "Error reading %s%s%s: %s" +msgstr "Įvyko klaida skaitant %s%s%s: %s" + +#: lclstrconsts:rsinvalidformobjectstream +msgid "invalid Form object stream" +msgstr "klaidingas formos objekto srautas" + +#: lclstrconsts:rsscrollbaroutofrange +msgid "ScrollBar property out of range" +msgstr "Savybės \"ScrollBar\" vertė peržengia ribas" + +#: lclstrconsts:rsinvaliddate +msgid "Invalid Date : %s" +msgstr "Klaidinga data: %s" + +#: lclstrconsts:rsinvaliddaterangehint +msgid "Invalid Date: %s. Must be between %s and %s" +msgstr "Klaidinga data: %s. Ji turi būti tarp %s ir %s" + +#: lclstrconsts:rserroroccurredinataddressframe +msgid "Error occurred in %s at %sAddress %s%s Frame %s" +msgstr "%s įvyko klaida:%sadresas %s%s, kadras %s" + +#: lclstrconsts:rsexception +msgid "Exception" +msgstr "Išimtinė situacija" + +#: lclstrconsts:rsformstreamingerror +msgid "Form streaming \"%s\" error: %s" +msgstr "Formą siunčiant srautu \"%s\" įvyko klaida: %s" + +#: lclstrconsts:rsfixedcolstoobig +msgid "FixedCols can't be >= ColCount" +msgstr "\"FixedCols\" reikšmė negali būti lygi ar didesnė nei \"ColCount\"" + +#: lclstrconsts:rsfixedrowstoobig +msgid "FixedRows can't be >= RowCount" +msgstr "\"FixedRows\" reikšmė negali būti lygi ar didesnė nei \"RowCount\"" + +#: lclstrconsts:rsgridfiledoesnotexists +msgid "Grid file doesn't exists" +msgstr "Tinklelio failas neegzistuoja" + +#: lclstrconsts:rsnotavalidgridfile +msgid "Not a valid grid file" +msgstr "Klaidingas tinklelio failas" + +#: lclstrconsts:rsindexoutofrange +msgid "Index Out of range Cell[Col=%d Row=%d]" +msgstr "Langelio [stulpelis = %d, eilutė = %d] indeksas peržengia ribas" + +#: lclstrconsts:rsgridindexoutofrange +msgid "Grid index out of range." +msgstr "Tinklelio indeksas peržengia ribas" + +#: lclstrconsts:rserrorinlcl +msgid "ERROR in LCL: " +msgstr "LCL klaida:" + +#: lclstrconsts:rscreatinggdbcatchableerror +msgid "Creating gdb catchable error:" +msgstr "Kuriama GDB aptinkama klaida:" + +#: lclstrconsts:rsacontrolcannothaveitselfasparent +msgid "A control can't have itself as parent" +msgstr "Valdiklio tėvas negali būti jis pats" + +#: lclstrconsts:lislclresourcesnotfound +msgid "Resource %s not found" +msgstr "Resursas %s nerastas" + +#: lclstrconsts:rserrorcreatingdevicecontext +msgid "Error creating device context for %s.%s" +msgstr "Įvyko klaida kuriant įrenginio turinį, skirtą %s.%s" + +#: lclstrconsts:rsindexoutofbounds +msgid "%s Index %d out of bounds 0-%d" +msgstr "%s indeksas %d peržengia ribas 0-%d" + +#: lclstrconsts:rsunknownpictureextension +msgid "Unknown picture extension" +msgstr "Nežinomas paveikslo prievardis" + +#: lclstrconsts:rsbitmaps +msgid "Bitmaps" +msgstr "Bitmap" + +#: lclstrconsts:rspixmap +msgid "Pixmap" +msgstr "Pixmap" + +#: lclstrconsts:rsportablenetworkgraphic +msgid "Portable Network Graphic" +msgstr "Portable Network Graphic" + +#: lclstrconsts:rsicon +msgid "Icon" +msgstr "Piktograma" + +#: lclstrconsts:rsunsupportedclipboardformat +msgid "Unsupported clipboard format: %s" +msgstr "Nepalaikomas iškarpinės formatas: %s" + +#: lclstrconsts:rsgroupindexcannotbelessthanprevious +msgid "GroupIndex cannot be less than a previous menu item's GroupIndex" +msgstr "\"GroupIndex\" negali būti mažesnis už ankstesnių menių punktų \"GroupIndex\"" + +#: lclstrconsts:rsisalreadyassociatedwith +msgid "%s is already associated with %s" +msgstr "%s jau yra asocijuotas su %s" + +#: lclstrconsts:rscanvasdoesnotallowdrawing +msgid "Canvas does not allow drawing" +msgstr "Į \"Canvas\" negalima piešti" + +#: lclstrconsts:rsunsupportedbitmapformat +msgid "Unsupported bitmap format." +msgstr "Nepalaikomas rastrinio paveikslo formatas." + +#: lclstrconsts:rserrorwhilesavingbitmap +msgid "Error while saving bitmap." +msgstr "Įrašant rastrinį paveikslą įvyko klaida." + +#: lclstrconsts:rsnowidgetset +msgid "No widgetset object. Plz check if the unit \"interfaces\" was added to the programs uses clause." +msgstr "Nevaldiklio objektas. Patikrinkite ar modulis \"interfaces\" yra paminėtas programos naudojamų modulių sąraše." + +#: lclstrconsts:rspressoktoignoreandriskdatacorruptionpresscanceltok +msgid "%s%sPress Ok to ignore and risk data corruption.%sPress Cancel to kill the program." +msgstr "%s%sPaspaude \"Tinka\" ignoruosite, tačiau rizikuosite duomenimis.%sPaspaude \"Atsisakyti\" sustabdysite programą." + +#: lclstrconsts:rscannotfocus +msgid "Can not focus" +msgstr "Suaktyvinti negalima" + +#: lclstrconsts:rslistindexexceedsbounds +msgid "List index exceeds bounds (%d)" +msgstr "Sąrašo indeksas peržengė ribas (%d)" + +#: lclstrconsts:rsresourcenotfound +msgid "Resource %s not found" +msgstr "Resursas %s nerastas" + +#: lclstrconsts:rscalculator +msgid "Calculator" +msgstr "Skaičiuotuvas" + +#: lclstrconsts:rserror +msgid "Error" +msgstr "Klaida" + +#: lclstrconsts:rspickdate +msgid "Select a date" +msgstr "Nurodykite datą" + +#: lclstrconsts:rssize +msgid " size " +msgstr "dydis" + +#: lclstrconsts:rsmodified +msgid " modified " +msgstr "pakeista" + +#: lclstrconsts:ifsvk_unknown +msgid "Unknown" +msgstr "Nežinomas" + +#: lclstrconsts:ifsvk_lbutton +msgid "Mouse Button Left" +msgstr "Kairys peles klavišas" + +#: lclstrconsts:ifsvk_rbutton +msgid "Mouse Button Right" +msgstr "Dešinys pelės klavišas" + +#: lclstrconsts:ifsvk_cancel +msgid "Cancel" +msgstr "Atsisakyti" + +#: lclstrconsts:ifsvk_mbutton +msgid "Mouse Button Middle" +msgstr "Vidurinis pelės klavišas" + +#: lclstrconsts:ifsvk_back +msgid "Backspace" +msgstr "Backspace" + +#: lclstrconsts:ifsvk_tab +msgid "Tab" +msgstr "Tab" + +#: lclstrconsts:ifsvk_clear +msgid "Clear" +msgstr "Clear" + +#: lclstrconsts:ifsvk_return +msgid "Return" +msgstr "Return" + +#: lclstrconsts:ifsvk_shift +msgid "Shift" +msgstr "Shift" + +#: lclstrconsts:ifsvk_control +msgid "Control" +msgstr "Ctrl" + +#: lclstrconsts:ifsvk_menu +msgid "Menu" +msgstr "Menu" + +#: lclstrconsts:ifsvk_pause +msgid "Pause key" +msgstr "Pause" + +#: lclstrconsts:ifsvk_capital +msgid "Capital" +msgstr "Caps Lock" + +#: lclstrconsts:ifsvk_kana +msgid "Kana" +msgstr "Kana" + +#: lclstrconsts:ifsvk_junja +msgid "Junja" +msgstr "Junja" + +#: lclstrconsts:ifsvk_final +msgid "Final" +msgstr "Final" + +#: lclstrconsts:ifsvk_hanja +msgid "Hanja" +msgstr "Hanja" + +#: lclstrconsts:ifsvk_escape +msgid "Escape" +msgstr "Esc" + +#: lclstrconsts:ifsvk_convert +msgid "Convert" +msgstr "Convert" + +#: lclstrconsts:ifsvk_nonconvert +msgid "Nonconvert" +msgstr "Nonconvert" + +#: lclstrconsts:ifsvk_accept +msgid "Accept" +msgstr "Accept" + +#: lclstrconsts:ifsvk_modechange +msgid "Mode Change" +msgstr "Mode Change" + +#: lclstrconsts:ifsvk_space +msgid "Space key" +msgstr "Space" + +#: lclstrconsts:ifsvk_prior +msgid "Prior" +msgstr "Prior" + +#: lclstrconsts:ifsvk_next +msgid "Next" +msgstr "Next" + +#: lclstrconsts:ifsvk_end +msgid "End" +msgstr "End" + +#: lclstrconsts:ifsvk_home +msgid "Home" +msgstr "Home" + +#: lclstrconsts:ifsvk_left +msgid "Left" +msgstr "Left" + +#: lclstrconsts:ifsvk_up +msgid "Up" +msgstr "Up" + +#: lclstrconsts:ifsvk_right +msgid "Right" +msgstr "Right" + +#: lclstrconsts:ifsvk_down +msgid "Down" +msgstr "Down" + +#: lclstrconsts:ifsvk_select +msgid "Select" +msgstr "Select" + +#: lclstrconsts:ifsvk_print +msgid "Print" +msgstr "Print" + +#: lclstrconsts:ifsvk_execute +msgid "Execute" +msgstr "Execute" + +#: lclstrconsts:ifsvk_snapshot +msgid "Snapshot" +msgstr "Snapshot" + +#: lclstrconsts:ifsvk_insert +msgid "Insert" +msgstr "Insert" + +#: lclstrconsts:ifsvk_delete +msgid "Delete" +msgstr "Delete" + +#: lclstrconsts:ifsvk_help +msgid "Help" +msgstr "Help" + +#: lclstrconsts:ifsctrl +msgid "Ctrl" +msgstr "Ctrl" + +#: lclstrconsts:ifsalt +msgid "Alt" +msgstr "Alt" + +#: lclstrconsts:rswholewordsonly +msgid "Whole words only" +msgstr "Tik visų žodžių" + +#: lclstrconsts:rscasesensitive +msgid "Case sensitive" +msgstr "Paisyti raidžių lygio" + +#: lclstrconsts:rstext +msgid "Text" +msgstr "Tekstas" + +#: lclstrconsts:rsdirection +msgid "Direction" +msgstr "Kryptis" + +#: lclstrconsts:rsforward +msgid "Forward" +msgstr "Pirmyn" + +#: lclstrconsts:rsbackward +msgid "Backward" +msgstr "Atgal" + +#: lclstrconsts:ifsvk_lwin +msgid "left windows key" +msgstr "Kairysis windows klavišas" + +#: lclstrconsts:ifsvk_rwin +msgid "right windows key" +msgstr "Dešinysis windows klavišas" + +#: lclstrconsts:ifsvk_apps +msgid "application key" +msgstr "Programos klavišas" + +#: lclstrconsts:ifsvk_numpad +msgid "Numpad %d" +msgstr "Numpad %d" + +#: lclstrconsts:ifsvk_numlock +msgid "Numlock" +msgstr "Numlock" + +#: lclstrconsts:ifsvk_scroll +msgid "Scroll" +msgstr "Scroll" + +#: lclstrconsts:rsdocking +msgid "Docking" +msgstr "Pritvirtinimas" + +#: lclstrconsts:rshelphelpnodehasnohelpdatabase +msgid "Help node %s%s%s has no Help Database" +msgstr "Žynyno mazgas %s%s%s neturi žinyno duomenų bazės." + +#: lclstrconsts:rshelpthereisnoviewerforhelptype +msgid "There is no viewer for help type %s%s%s" +msgstr "Nerasta žiūriklė %s%s%s žinyno tipui." + +#: lclstrconsts:rshelphelpdatabasedidnotfoundaviewerforahelppageoftype +msgid "Help Database %s%s%s did not found a viewer for a help page of type %s" +msgstr "Žinyno duomenų bazė %s%s%s nerado žiūriklės %s tipo žinyno lapui." + +#: lclstrconsts:rshelpalreadyregistered +msgid "%s: Already registered" +msgstr "%s: jau yra registruotas" + +#: lclstrconsts:rshelpnotregistered +msgid "%s: Not registered" +msgstr "%s: neregistruotas" + +#: lclstrconsts:rshelphelpdatabasenotfound +msgid "Help Database %s%s%s not found" +msgstr "Žinyno duomenų bazė %s%s%s nerasta." + +#: lclstrconsts:rshelphelpkeywordnotfoundindatabase +msgid "Help keyword %s%s%s not found in Database %s%s%s." +msgstr "Žinyno raktažodis %s%s%s duomenų bazėje %s%s%s nerastas." + +#: lclstrconsts:rshelphelpkeywordnotfound +msgid "Help keyword %s%s%s not found." +msgstr "Žinyno raktažodis %s%s%s nerastas." + +#: lclstrconsts:rshelphelpcontextnotfoundindatabase +msgid "Help context %s not found in Database %s%s%s." +msgstr "Žinyno turinys %s duomenų bazėje %s%s%s nerastas." + +#: lclstrconsts:rshelphelpcontextnotfound +msgid "Help context %s not found." +msgstr "Žinyno turinys %s nerastas." + +#: lclstrconsts:rshelpnohelpfoundforsource +msgid "No help found for line %d, column %d of %s." +msgstr "Žinyne nėra duomenų eilutei %d, stulpeliui %d šio %s." + +#: lclstrconsts:rshelpnohelpnodesavailable +msgid "No help nodes available" +msgstr "Žinyno nėra" + +#: lclstrconsts:rshelperror +msgid "Help Error" +msgstr "Žinyno klaida" + +#: lclstrconsts:rshelpdatabasenotfound +msgid "Help Database not found" +msgstr "Žinyno duomenų bazė nerasta" + +#: lclstrconsts:rshelpcontextnotfound +msgid "Help Context not found" +msgstr "Žinyno turinys nerastas" + +#: lclstrconsts:rshelpviewernotfound +msgid "Help Viewer not found" +msgstr "Žinyno žiūriklė nerasta" + +#: lclstrconsts:rshelpnotfound +msgid "Help not found" +msgstr "Žinynas nerastas" + +#: lclstrconsts:rshelpviewererror +msgid "Help Viewer Error" +msgstr "Žinyno žiūriklės klaida" + +#: lclstrconsts:rshelpselectorerror +msgid "Help Selector Error" +msgstr "Žinyno išrinkėjo klaida" + +#: lclstrconsts:rsunknownerrorpleasereportthisbug +msgid "Unknown Error, please report this bug" +msgstr "Nežinoma klaida, prašau praneškite kūrėjams apie šią klaidą." + +#: lclstrconsts:hhshelpthehelpdatabasewasunabletofindfile +msgid "The help database %s%s%s was unable to find file %s%s%s." +msgstr "Žinyno duomenų bazė %s%s%s neranda failo %s%s%s." + +#: lclstrconsts:hhshelpthemacrosinbrowserparamswillbereplacedbytheurl +msgid "The macro %s in BrowserParams will be replaced by the URL." +msgstr "Makrokomanda %s naršyklės parametruose bus pakeista URL reikšme." + +#: lclstrconsts:hhshelpnohtmlbrowserfoundpleasedefineoneinhelpconfigurehe +msgid "No HTML Browser found.%sPlease define one in Help -> Configure Help -> Viewers" +msgstr "Nerasta HTML naršyklė.%sNurodykite kokią nors meniu \"Žinynas -> Derinti žinyną -> Žiūriklės\"." + +#: lclstrconsts:hhshelpnohtmlbrowserfound +msgid "Unable to find a HTML browser." +msgstr "Nepavyko rasti HTML naršyklės." + +#: lclstrconsts:hhshelpbrowsernotfound +msgid "Browser %s%s%s not found." +msgstr "Naršyklė %s%s%s nerasta." + +#: lclstrconsts:hhshelpbrowsernotexecutable +msgid "Browser %s%s%s not executable." +msgstr "Naršyklė %s%s%s nėra vykdomasis failas." + +#: lclstrconsts:hhshelperrorwhileexecuting +msgid "Error while executing %s%s%s:%s%s" +msgstr "Įvyko klaida startuojant %s%s%s:%s%s" +