From e671bbc0420f06d2ac85c97fe2e7511fcabbc322 Mon Sep 17 00:00:00 2001
From: marc <marc@lazarus-ide.org>
Date: Thu, 27 Dec 2007 23:21:29 +0000
Subject: [PATCH] * New Slovak translation by Komunista

git-svn-id: trunk@13491 -
---
 .gitattributes             |     1 +
 languages/lazaruside.sk.po | 10825 +++++++++++++++++++++++++++++++++++
 2 files changed, 10826 insertions(+)
 create mode 100644 languages/lazaruside.sk.po

diff --git a/.gitattributes b/.gitattributes
index cbefc56842..02ff97e104 100644
--- a/.gitattributes
+++ b/.gitattributes
@@ -2588,6 +2588,7 @@ languages/lazaruside.pliso.po svneol=native#text/plain
 languages/lazaruside.plwin.po svneol=native#text/plain
 languages/lazaruside.po svneol=native#text/plain
 languages/lazaruside.ru.po svneol=native#text/plain
+languages/lazaruside.sk.po svneol=native#text/plain
 languages/lazaruside.ua.po svneol=native#text/plain
 languages/lazaruside.zh_CN.po svneol=native#text/plain
 lazarus.app/Contents/Info.plist svneol=native#text/xml
diff --git a/languages/lazaruside.sk.po b/languages/lazaruside.sk.po
new file mode 100644
index 0000000000..014bc9512a
--- /dev/null
+++ b/languages/lazaruside.sk.po
@@ -0,0 +1,10825 @@
+# Slovenský preklad lazaruside.
+# Copyright (C) 2007 Free Software Foundation, Inc.
+# slavko <slavino@slavino.sk>, 2007.
+# 
+# 
+msgid ""
+msgstr ""
+"Project-Id-Version: lazarusid\n"
+"Report-Msgid-Bugs-To: \n"
+"POT-Creation-Date: 2007-12-26 15:21+0100\n"
+"PO-Revision-Date: 2007-12-26 18:11+0100\n"
+"Last-Translator: slavko <slavino@slavino.sk>\n"
+"Language-Team: Slovak <sk-i18n@linux.sk>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Plural-Forms: "
+
+#: lazarusidestrconsts:liserrinvalidoption
+msgid "Invalid option at position %d: \"%s\""
+msgstr "Neplatná voľba na pozícii %d:·\"%s\""
+
+#: lazarusidestrconsts:liserrnooptionallowed
+msgid "Option at position %d does not allow an argument: %s"
+msgstr ""
+
+#: lazarusidestrconsts:liserroptionneeded
+msgid "Option at position %d needs an argument : %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisentertransla
+msgid "Enter translation language"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusversionstring
+msgid "%s beta"
+msgstr ""
+
+#: lazarusidestrconsts:lisleaveemptyfo
+msgid "Leave empty for default .po file"
+msgstr "Nechajte prázdne pre predvolený .po súbor"
+
+#: lazarusidestrconsts:lismenucollectpofil
+msgid "Collect .po files"
+msgstr ""
+
+#: lazarusidestrconsts:lismenucreatepofile
+msgid "Create .po files"
+msgstr "vytvoriť súbory .po"
+
+#: lazarusidestrconsts:listhishelpmessage
+msgid "this help message"
+msgstr "táto správa nápovedy"
+
+#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
+msgid "primary config directory, where Lazarus stores its config files. Default is "
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusoptionsprojectfilename
+msgid "lazarus [options] <project-filename>"
+msgstr ""
+
+#: lazarusidestrconsts:lisideoptions
+msgid "IDE Options:"
+msgstr "Voľby IDE:"
+
+#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
+msgid "LCL Interface specific options:"
+msgstr ""
+
+#: lazarusidestrconsts:lisdonotshowsplashscreen
+msgid "Do not show splash screen"
+msgstr "Nezobrazovať úvodnú obrazovku"
+
+#: lazarusidestrconsts:lisskiploadinglastproject
+msgid "Skip loading last project"
+msgstr "Preskočiť otváranie posledného projektu"
+
+#: lazarusidestrconsts:lisoverridelanguage
+msgid "Override language. For example --language=de. For possible values see files in the languages directory."
+msgstr ""
+
+#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
+msgid "secondary config directory, where Lazarus searches for config template files. Default is "
+msgstr ""
+
+#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
+msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
+msgstr ""
+
+#: lazarusidestrconsts:lisselectiontool
+msgid "Selection tool"
+msgstr ""
+
+#: lazarusidestrconsts:liscursorcolumnincurrenteditor
+msgid "Cursor column in current editor"
+msgstr "Stĺpec kurzora v aktuálnom editore"
+
+#: lazarusidestrconsts:liscursorrowincurrenteditor
+msgid "Cursor row in current editor"
+msgstr "Riadok kurzora·v·aktuálnom·editore"
+
+#: lazarusidestrconsts:liscompilerfilename
+msgid "Compiler filename"
+msgstr ""
+
+#: lazarusidestrconsts:liswordatcursorincurrenteditor
+msgid "Word at cursor in current editor"
+msgstr "Slovo s kurzorom aktuálneho editora"
+
+#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
+msgid "Expanded filename of current editor file"
+msgstr ""
+
+#: lazarusidestrconsts:lisfreepascalsourcedirectory
+msgid "Freepascal source directory"
+msgstr "Adresár zdrojov FreePascal"
+
+#: lazarusidestrconsts:lislazarusdirectory
+msgid "Lazarus directory"
+msgstr "Adresár Lazarus"
+
+#: lazarusidestrconsts:lislazaruslanguageid
+msgid "Lazarus language ID (e.g. en, de, br, fi)"
+msgstr "Identifikátor jazyka Lazarus (napr. en,·de,·br,·sk)"
+
+#: lazarusidestrconsts:lislazaruslanguagename
+msgid "Lazarus language name (e.g. english, deutsch)"
+msgstr "Meno jazyka Lazarus (napr. english, slovak)"
+
+#: lazarusidestrconsts:lislclwidgettype
+msgid "LCL Widget Type"
+msgstr ""
+
+#: lazarusidestrconsts:liscovarious
+msgid "%s (various)"
+msgstr ""
+
+#: lazarusidestrconsts:listargetcpu
+msgid "Target CPU"
+msgstr "Cieľový CPU"
+
+#: lazarusidestrconsts:listargetos
+msgid "Target OS"
+msgstr "Cieľový OS"
+
+#: lazarusidestrconsts:liscommandlineparamsofprogram
+msgid "Command line parameters of program"
+msgstr "Parametre príkazového riadku programu"
+
+#: lazarusidestrconsts:lispromptforvalue
+msgid "Prompt for value"
+msgstr "Vyžiadať hodnotu"
+
+#: lazarusidestrconsts:lisprojectfilename
+msgid "Project filename"
+msgstr "Meno súboru projektu"
+
+#: lazarusidestrconsts:lisprojectdirectory
+msgid "Project directory"
+msgstr "Adresár projektu"
+
+#: lazarusidestrconsts:lissavecurrenteditorfile
+msgid "save current editor file"
+msgstr "uložiť súbor aktuálneho editora"
+
+#: lazarusidestrconsts:lissaveallmodified
+msgid "save all modified files"
+msgstr "uložiť všetky zmenené súbory"
+
+#: lazarusidestrconsts:listargetfilenameofproject
+msgid "Target filename of project"
+msgstr "Meno súboru cieľového projektu"
+
+#: lazarusidestrconsts:listargetfilenameplusparams
+msgid "Target filename + params"
+msgstr "Cieľové meno súboru + parametre"
+
+#: lazarusidestrconsts:listestdirectory
+msgid "Test directory"
+msgstr "Testovací adresár"
+
+#: lazarusidestrconsts:lislaunchingcmdline
+msgid "Launching target command line"
+msgstr ""
+
+#: lazarusidestrconsts:lispublishprojdir
+msgid "Publish project directory"
+msgstr "Publikovať adresár projektu"
+
+#: lazarusidestrconsts:lisprojectunitpath
+msgid "Project Unit Path"
+msgstr "Unit cesta projektu"
+
+#: lazarusidestrconsts:lisprojectincpath
+msgid "Project Include Path"
+msgstr "Include cesta projektu"
+
+#: lazarusidestrconsts:lisprojectsrcpath
+msgid "Project Src Path"
+msgstr "Src cesta projektu"
+
+#: lazarusidestrconsts:lismakeexe
+msgid "Make Executable"
+msgstr "Urobiť spustiteľné"
+
+#: lazarusidestrconsts:lisprojectmacroproperties
+msgid "Project macro properties"
+msgstr ""
+
+#: lazarusidestrconsts:lisopenproject2
+msgid "Open project"
+msgstr "Otvoriť projekt"
+
+#: lazarusidestrconsts:liskmsaveproject
+msgid "Save project"
+msgstr "Uložiť projekt"
+
+#: lazarusidestrconsts:liskmcloseproject
+msgid "Close project"
+msgstr "Zatvoriť projekt"
+
+#: lazarusidestrconsts:liskmsaveprojectas
+msgid "Save project as"
+msgstr "Uložiť projekt ako"
+
+#: lazarusidestrconsts:liskmpublishproject
+msgid "Publish project"
+msgstr "Publikovať projekt"
+
+#: lazarusidestrconsts:lisopenthefileasnormalsource
+msgid "Open the file as normal source"
+msgstr "Otvoriť súbor ako bežný zdrojový kód"
+
+#: lazarusidestrconsts:lisopenasxmlfile
+msgid "Open as XML file"
+msgstr "Otvoriť ako súbor XML"
+
+#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
+msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
+msgstr "Pri poslednom štarte nastala chyba pri otváraní %s!%s%sOtvoriť projekt znova?"
+
+#: lazarusidestrconsts:lisopenprojectagain
+msgid "Open project again"
+msgstr "Znova otvoriť projekt"
+
+#: lazarusidestrconsts:lisstartwithanewproject
+msgid "Start with a new project"
+msgstr "Začať nový projekt"
+
+#: lazarusidestrconsts:lisprojectmacrounitpath
+msgid "macro ProjectUnitPath"
+msgstr ""
+
+#: lazarusidestrconsts:lisconfigdirectory
+msgid "Lazarus config directory"
+msgstr "Konfiguračný adresár Lazarus"
+
+#: lazarusidestrconsts:lismenufile
+msgid "&File"
+msgstr "&Súbor"
+
+#: lazarusidestrconsts:lismenuedit
+msgid "&Edit"
+msgstr "&Upraviť"
+
+#: lazarusidestrconsts:lismenusearch
+msgid "&Search"
+msgstr "&Hľadať"
+
+#: lazarusidestrconsts:lismenuview
+msgid "&View"
+msgstr "&Zobraziť"
+
+#: lazarusidestrconsts:lismenuproject
+msgid "&Project"
+msgstr "&Projekt"
+
+#: lazarusidestrconsts:lismenurun
+msgid "&Run"
+msgstr "Sp&ustiť"
+
+#: lazarusidestrconsts:lismenucomponents
+msgid "&Components"
+msgstr "&Komponenty"
+
+#: lazarusidestrconsts:lismenutools
+msgid "&Tools"
+msgstr "&Nástroje"
+
+#: lazarusidestrconsts:lismenuenvironent
+msgid "E&nvironment"
+msgstr "P&rostredie"
+
+#: lazarusidestrconsts:lismenuwindow
+msgid "&Window"
+msgstr "&Okná"
+
+#: lazarusidestrconsts:lismenuhelp
+msgid "&Help"
+msgstr "&Nápoveda"
+
+#: lazarusidestrconsts:lismenunewunit
+msgid "New Unit"
+msgstr "Nová unita"
+
+#: lazarusidestrconsts:lismenunewform
+msgid "New Form"
+msgstr "Nový formulár"
+
+#: lazarusidestrconsts:lismenunewother
+msgid "New ..."
+msgstr "Nový ..."
+
+#: lazarusidestrconsts:lismenuopen
+msgid "Open ..."
+msgstr "Otvoriť ..."
+
+#: lazarusidestrconsts:lismenurevert
+msgid "Revert"
+msgstr "Vrátiť"
+
+#: lazarusidestrconsts:lispkgeditpublishpackage
+msgid "Publish Package"
+msgstr "Publikovať balíček"
+
+#: lazarusidestrconsts:lismenuopenrecent
+msgid "Open Recent ..."
+msgstr "Otvoriť posledné ..."
+
+#: lazarusidestrconsts:lismenusave
+msgid "Save"
+msgstr "Uložiť"
+
+#: lazarusidestrconsts:liskmsaveas
+msgid "SaveAs"
+msgstr "Uložiť ako"
+
+#: lazarusidestrconsts:liskmsaveall
+msgid "SaveAll"
+msgstr "Uložiť všetky"
+
+#: lazarusidestrconsts:lisdiscardchanges
+msgid "Discard changes"
+msgstr "Zahodiť zmeny"
+
+#: lazarusidestrconsts:lisdonotclosetheproject
+msgid "Do not close the project"
+msgstr "Nezatvárať projekt"
+
+#: lazarusidestrconsts:lisdonotclosetheide
+msgid "Do not close the IDE"
+msgstr "Nezatvárať IDE"
+
+#: lazarusidestrconsts:lismenusaveas
+msgid "Save As ..."
+msgstr "Uložiť ako ..."
+
+#: lazarusidestrconsts:lismenusaveall
+msgid "Save All"
+msgstr "Uložiť všetko"
+
+#: lazarusidestrconsts:lismenuclose
+msgid "Close"
+msgstr "Zatvoriť"
+
+#: lazarusidestrconsts:lispldonlyexistingfiles
+msgid "Only existing files"
+msgstr "Len existujúce súbory"
+
+#: lazarusidestrconsts:lispldshowgloballinks
+msgid "Show global links"
+msgstr ""
+
+#: lazarusidestrconsts:lispldshowuserlinks
+msgid "Show user links"
+msgstr ""
+
+#: lazarusidestrconsts:liskmcloseall
+msgid "Close All"
+msgstr "Zatvoriť všetko"
+
+#: lazarusidestrconsts:lisctdefdefinetemplates
+msgid "Define templates"
+msgstr ""
+
+#: lazarusidestrconsts:lismenucloseall
+msgid "Close all editor files"
+msgstr "Zatvoriť všetky súbory editora"
+
+#: lazarusidestrconsts:lismenucleandirectory
+msgid "Clean directory ..."
+msgstr "Vyčistiť adresár ..."
+
+#: lazarusidestrconsts:lismenuquit
+msgid "Quit"
+msgstr "Skončiť"
+
+#: lazarusidestrconsts:lismenurestart
+msgid "Restart"
+msgstr "Reštartovať"
+
+#: lazarusidestrconsts:lismenuundo
+msgid "Undo"
+msgstr "Späť"
+
+#: lazarusidestrconsts:lismenuredo
+msgid "Redo"
+msgstr "Znova"
+
+#: lazarusidestrconsts:lismenucut
+msgid "Cut"
+msgstr "Vystrihnúť"
+
+#: lazarusidestrconsts:lismenucopy
+msgid "Copy"
+msgstr "Kopírovať"
+
+#: lazarusidestrconsts:lismenupaste
+msgid "Paste"
+msgstr "Vložiť"
+
+#: lazarusidestrconsts:lismenuindentselection
+msgid "Indent selection"
+msgstr "Zväčšiť odsadenie"
+
+#: lazarusidestrconsts:lismenuunindentselection
+msgid "Unindent selection"
+msgstr "Zmenšiť odsadenie"
+
+#: lazarusidestrconsts:lismenuuppercaseselection
+msgid "Uppercase selection"
+msgstr "Výber na veľké písmená"
+
+#: lazarusidestrconsts:lismenulowercaseselection
+msgid "Lowercase selection"
+msgstr "Výber·na·malé·písmená"
+
+#: lazarusidestrconsts:lismenutabstospacesselection
+msgid "Tabs to spaces in selection"
+msgstr "Tabulátory výberu na medzery"
+
+#: lazarusidestrconsts:lismenuencloseselection
+msgid "Enclose selection ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenucommentselection
+msgid "Comment selection"
+msgstr "Zakomentovať výber"
+
+#: lazarusidestrconsts:lismenuuncommentselection
+msgid "Uncomment selection"
+msgstr "Odkomentovať výber"
+
+#: lazarusidestrconsts:liskminsertifdef
+msgid "Insert $IFDEF"
+msgstr "Vložiť $IFDEF"
+
+#: lazarusidestrconsts:lismenuconditionalselection
+msgid "Insert $IFDEF..."
+msgstr "Vložiť $IFDEF..."
+
+#: lazarusidestrconsts:lismenusortselection
+msgid "Sort selection ..."
+msgstr "Zoradiť výber ..."
+
+#: lazarusidestrconsts:lismenubeaklinesinselection
+msgid "Break Lines in selection"
+msgstr "Zalomiť riadky vo výbere"
+
+#: lazarusidestrconsts:liskmselectwordleft
+msgid "Select word left"
+msgstr "Vybrať slovo naľavo"
+
+#: lazarusidestrconsts:liskmselectwordright
+msgid "Select word right"
+msgstr "Vybrať slovo napravo"
+
+#: lazarusidestrconsts:liskmselectlinestart
+msgid "Select line start"
+msgstr "Vybrať začiatok riadku"
+
+#: lazarusidestrconsts:liskmselectlineend
+msgid "Select line end"
+msgstr "Vybrať koniec riadku"
+
+#: lazarusidestrconsts:liskmselectpagetop
+msgid "Select page top"
+msgstr "Vybrať vrch stránky"
+
+#: lazarusidestrconsts:liskmselectpagebottom
+msgid "Select page bottom"
+msgstr "Vybrať spodok stránky"
+
+#: lazarusidestrconsts:lismenuselect
+msgid "Select"
+msgstr "Vybrať"
+
+#: lazarusidestrconsts:lismenuselectall
+msgid "Select all"
+msgstr "Vybrať všetko"
+
+#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
+msgid "Abstract methods - not yet overridden"
+msgstr "Abstraktné metódy - zatiaľ neprepísané"
+
+#: lazarusidestrconsts:lismenuselecttobrace
+msgid "Select to brace"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuselectcodeblock
+msgid "Select code block"
+msgstr "Vybrať blok kódu"
+
+#: lazarusidestrconsts:lismenuselectword
+msgid "Select word"
+msgstr "Vybrať slovo"
+
+#: lazarusidestrconsts:lismenuselectline
+msgid "Select line"
+msgstr "Vybrať riadok"
+
+#: lazarusidestrconsts:lismenuselectparagraph
+msgid "Select paragraph"
+msgstr "Vybrať odsek"
+
+#: lazarusidestrconsts:lismenuinsertcharacter
+msgid "Insert from Character Map"
+msgstr "Vložiť z mapy znakov"
+
+#: lazarusidestrconsts:lismenuinserttext
+msgid "Insert text"
+msgstr "Vložiť text"
+
+#: lazarusidestrconsts:lismenuinsertcvskeyword
+msgid "CVS keyword"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuinsertgeneral
+msgid "General"
+msgstr ""
+
+#: lazarusidestrconsts:lisnone2
+msgid "none"
+msgstr "žiadne"
+
+#: lazarusidestrconsts:lisor
+msgid "or"
+msgstr "alebo"
+
+#: lazarusidestrconsts:lisnone
+msgid "%snone"
+msgstr "%sžiadne"
+
+#: lazarusidestrconsts:lisunitpaths
+msgid "Unit paths"
+msgstr "Cesty unit"
+
+#: lazarusidestrconsts:lisincludepaths
+msgid "Include paths"
+msgstr "Cesty Include"
+
+#: lazarusidestrconsts:lissourcepaths
+msgid "Source paths"
+msgstr "Cesty zdrojových kódov"
+
+#: lazarusidestrconsts:lismenucompletecode
+msgid "Complete Code"
+msgstr "Dokončovanie kódu"
+
+#: lazarusidestrconsts:lismenuextractproc
+msgid "Extract procedure ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenufindidentifierrefs
+msgid "Find Identifier References ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenurenameidentifier
+msgid "Rename Identifier ..."
+msgstr "Premenovať identifikátor ..."
+
+#: lazarusidestrconsts:lismenuinsertgplnotice
+msgid "GPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuinsertlgplnotice
+msgid "LGPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
+msgid "Modified LGPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuinsertusername
+msgid "Current username"
+msgstr "Meno aktuálneho používateľa"
+
+#: lazarusidestrconsts:lismenuinsertdatetime
+msgid "Current date and time"
+msgstr "Aktuálny dátum a čas"
+
+#: lazarusidestrconsts:lismenuinsertchangelogentry
+msgid "ChangeLog entry"
+msgstr "Položka ChangeLog"
+
+#: lazarusidestrconsts:lismenufind
+msgid "Find"
+msgstr "Nájsť"
+
+#: lazarusidestrconsts:lismenufindnext
+msgid "Find &Next"
+msgstr "Ná&jsť ďalší"
+
+#: lazarusidestrconsts:lismenufind2
+msgid "&Find ..."
+msgstr "&Nájsť ..."
+
+#: lazarusidestrconsts:lismenufindprevious
+msgid "Find &Previous"
+msgstr "Nájsť &predchádzajúci"
+
+#: lazarusidestrconsts:lismenufindinfiles
+msgid "Find &in files ..."
+msgstr "Nájsť v &súboroch ..."
+
+#: lazarusidestrconsts:lismenureplace
+msgid "Replace"
+msgstr "nahradiť"
+
+#: lazarusidestrconsts:lismenuincrementalfind
+msgid "Incremental Find"
+msgstr "Narastajúce hľadanie"
+
+#: lazarusidestrconsts:lismenureplace2
+msgid "&Replace ..."
+msgstr "Na&hradiť ..."
+
+#: lazarusidestrconsts:lismenugotoline
+msgid "Goto line ..."
+msgstr "Choď na riadok ..."
+
+#: lazarusidestrconsts:lismenujumpback
+msgid "Jump back"
+msgstr "Skočiť späť"
+
+#: lazarusidestrconsts:lismenujumpforward
+msgid "Jump forward"
+msgstr "Skočiť dopredu"
+
+#: lazarusidestrconsts:lismenuaddjumppointtohistory
+msgid "Add jump point to history"
+msgstr "Pridať bod skoku do histórie"
+
+#: lazarusidestrconsts:lismenuviewjumphistory
+msgid "View Jump-History ..."
+msgstr "Zobraziť Históriu skokov"
+
+#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
+msgid "Find other end of code block"
+msgstr "Nájsť druhý koniec bloku kódu"
+
+#: lazarusidestrconsts:lismenufindcodeblockstart
+msgid "Find code block start"
+msgstr "Nájsť začiatok bloku kódu"
+
+#: lazarusidestrconsts:lismenufinddeclarationatcursor
+msgid "Find Declaration at cursor"
+msgstr "Nájsť deklaráciu na kurzore"
+
+#: lazarusidestrconsts:lismenuopenfilenameatcursor
+msgid "Open filename at cursor"
+msgstr "Otvoriť súbor na kurzore"
+
+#: lazarusidestrconsts:lismenugotoincludedirective
+msgid "Goto include directive"
+msgstr "Choď na vkladaciu direktívu"
+
+#: lazarusidestrconsts:lismenujumptonexterror
+msgid "Jump to next error"
+msgstr "Skoč na ďalšiu chybu"
+
+#: lazarusidestrconsts:lismenujumptopreverror
+msgid "Jump to previous error"
+msgstr "Skoč na predchádzajúcu chybu"
+
+#: lazarusidestrconsts:lismenusetfreebookmark
+msgid "Set a free bookmark"
+msgstr "Nastav voľnú záložku"
+
+#: lazarusidestrconsts:lismenujumptonextbookmark
+msgid "Jump to next bookmark"
+msgstr "Skoč na ďalšiu záložku"
+
+#: lazarusidestrconsts:lismenujumptoprevbookmark
+msgid "Jump to previous bookmark"
+msgstr "Skoč na predchádzajúcu záložku"
+
+#: lazarusidestrconsts:lismenuviewobjectinspector
+msgid "Object Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuviewsourceeditor
+msgid "Source Editor"
+msgstr "Editor zdrojového kódu"
+
+#: lazarusidestrconsts:lismenuviewcodeexplorer
+msgid "Code Explorer"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuviewcodebrowser
+msgid "Code Browser"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuviewcomponents
+msgid "&Components"
+msgstr "&Komponenty"
+
+#: lazarusidestrconsts:lismenujumpto
+msgid "Jump to"
+msgstr "Skoč na"
+
+#: lazarusidestrconsts:lismenuviewunits
+msgid "Units..."
+msgstr "Unity ..."
+
+#: lazarusidestrconsts:lismenuviewforms
+msgid "Forms..."
+msgstr "Formuláre ..."
+
+#: lazarusidestrconsts:lismenuviewunitdependencies
+msgid "View Unit Dependencies"
+msgstr "Zobraziť závislosti unity"
+
+#: lazarusidestrconsts:liskmviewunitinfo
+msgid "View Unit Info"
+msgstr "Zobraziť informácie o unite"
+
+#: lazarusidestrconsts:lismenuviewunitinfo
+msgid "View Unit Information"
+msgstr "Zobraziť·informácie·o·unite"
+
+#: lazarusidestrconsts:lismenuviewtoggleformunit
+msgid "Toggle form/unit view"
+msgstr "Prepnúť zobrazenie formulár/unita"
+
+#: lazarusidestrconsts:lismenuviewmessages
+msgid "Messages"
+msgstr "Správy"
+
+#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
+msgid "Copy selected messages to clipboard"
+msgstr "Kopírovať vybrané správy do schránky"
+
+#: lazarusidestrconsts:liscopyallmessagestoclipboard
+msgid "Copy all messages to clipboard"
+msgstr "Kopírovať všetky správy do schránky"
+
+#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
+msgid "Copy all and hidden messages to clipboard"
+msgstr "Kopírovať všetky skryté správy do schánky"
+
+#: lazarusidestrconsts:lissaveallmessagestofile
+msgid "Save all messages to file"
+msgstr "Uložiť všetky správy do súboru"
+
+#: lazarusidestrconsts:lismenuviewsearchresults
+msgid "Search Results"
+msgstr "Výsledky hľadania"
+
+#: lazarusidestrconsts:lissearchagain
+msgid "Search again"
+msgstr "Hľadať ďalej"
+
+#: lazarusidestrconsts:lissrclosepage
+msgid "Close page"
+msgstr "Zatvoriť stránku"
+
+#: lazarusidestrconsts:lismenuviewanchoreditor
+#, fuzzy
+msgid "View Anchor Editor"
+msgstr "Zobraziť Anchor Editor"
+
+#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
+msgid "Toggle view component palette"
+msgstr "Prepnúť zobrazenie Palety komponentov"
+
+#: lazarusidestrconsts:lismenuviewcomponentpalette
+msgid "View Component Palette"
+msgstr "Zobraziť paletu komponentov"
+
+#: lazarusidestrconsts:lismenuviewidespeedbuttons
+msgid "View IDE speed buttons"
+msgstr ""
+
+#: lazarusidestrconsts:lismenudebugwindows
+msgid "Debug windows"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuviewwatches
+msgid "Watches"
+msgstr ""
+
+#: lazarusidestrconsts:lismenuviewbreakpoints
+msgid "BreakPoints"
+msgstr "Body prerušenia"
+
+#: lazarusidestrconsts:lismenuviewlocalvariables
+msgid "Local Variables"
+msgstr "Lokálne premenné"
+
+#: lazarusidestrconsts:lismenuviewcallstack
+msgid "Call Stack"
+msgstr "Zásobník volaní"
+
+#: lazarusidestrconsts:lismenuviewdebugoutput
+msgid "Debug output"
+msgstr "Výstup ladenia"
+
+#: lazarusidestrconsts:lismenuideinternals
+msgid "IDE internals"
+msgstr ""
+
+#: lazarusidestrconsts:lismenupackagelinks
+msgid "Package links ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenunewproject
+msgid "New Project ..."
+msgstr "Nový projekt ..."
+
+#: lazarusidestrconsts:lismenunewprojectfromfile
+msgid "New Project from file ..."
+msgstr "Nový projekt zo súboru ..."
+
+#: lazarusidestrconsts:lismenuopenproject
+msgid "Open Project ..."
+msgstr "Otvoriť projekt ..."
+
+#: lazarusidestrconsts:lismenucloseproject
+msgid "Close Project"
+msgstr "Zatvoriť projekt"
+
+#: lazarusidestrconsts:lismenuopenrecentproject
+msgid "Open Recent Project ..."
+msgstr "Otvoriť nedávny projekt ..."
+
+#: lazarusidestrconsts:lismenusaveproject
+msgid "Save Project"
+msgstr "Uložiť projekt"
+
+#: lazarusidestrconsts:lismenusaveprojectas
+msgid "Save Project As ..."
+msgstr "Uložiť projekt ako ..."
+
+#: lazarusidestrconsts:lismenupublishproject
+msgid "Publish Project ..."
+msgstr "Publikovať projekt ..."
+
+#: lazarusidestrconsts:lismenuprojectinspector
+msgid "Project Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:liskmaddactiveunittoproject
+msgid "Add active unit to project"
+msgstr "Pridať aktívnu unitu do projektu"
+
+#: lazarusidestrconsts:liskmremoveactiveunitfromproject
+msgid "Remove active unit from project"
+msgstr "Odstrániť aktívnu unitu z projektu"
+
+#: lazarusidestrconsts:liskmviewprojectsource
+msgid "View project source"
+msgstr "Zobraziť zdrojový kód projektu"
+
+#: lazarusidestrconsts:liskmviewprojecttodolist
+msgid "View project ToDo list"
+msgstr "Zobraziť ToDo zoznam projektu"
+
+#: lazarusidestrconsts:lismenuaddtoproject
+msgid "Add editor file to Project"
+msgstr "Pridať súbor editora do projektu"
+
+#: lazarusidestrconsts:lismenuremovefromproject
+msgid "Remove from Project ..."
+msgstr "Odstrániť z projektu ..."
+
+#: lazarusidestrconsts:lismenuviewsource
+msgid "&View Source"
+msgstr "&Zobraziť zdrojový kód"
+
+#: lazarusidestrconsts:lismenuviewprojecttodos
+msgid "View ToDo List ..."
+msgstr "Zobraziť ToDo zoznam ..."
+
+#: lazarusidestrconsts:lismenuprojectoptions
+msgid "Project Options ..."
+msgstr "Voľby projektu ..."
+
+#: lazarusidestrconsts:lismenubuild
+msgid "Build"
+msgstr "Vybudovať"
+
+#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
+msgid "Working directory (Leave empty for file path)"
+msgstr "Pracovný adresár (prázdne pre cestu súboru)"
+
+#: lazarusidestrconsts:lisbfbuildcommand
+msgid "Build Command"
+msgstr ""
+
+#: lazarusidestrconsts:lismenubuildall
+msgid "Build all"
+msgstr "Vybudovať všetko"
+
+#: lazarusidestrconsts:lismenuquickcompile
+msgid "Quick compile"
+msgstr "Rýchly preklad"
+
+#: lazarusidestrconsts:lismenuabortbuild
+msgid "Abort Build"
+msgstr "Zrušiť budovanie"
+
+#: lazarusidestrconsts:lismenuprojectrun
+msgid "Run"
+msgstr "Spustiť"
+
+#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
+msgid "Always Build before Run"
+msgstr "Pred spustením vždy vybudovať"
+
+#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
+msgid "Working Directory (Leave empty for file path)"
+msgstr "Pracovný·adresár·(prázdne·pre·cestu·súboru)"
+
+#: lazarusidestrconsts:lisbfruncommand
+msgid "Run Command"
+msgstr "Príkaz spustiť"
+
+#: lazarusidestrconsts:lismenupause
+msgid "Pause"
+msgstr "Prerušiť"
+
+#: lazarusidestrconsts:lismenustepinto
+msgid "Step into"
+msgstr "Krok dnu"
+
+#: lazarusidestrconsts:lismenustepover
+msgid "Step over"
+msgstr "Krok cez"
+
+#: lazarusidestrconsts:lismenuruntocursor
+msgid "Run to cursor"
+msgstr "Spustiť po kurzor"
+
+#: lazarusidestrconsts:liskmstopprogram
+msgid "Stop program"
+msgstr "Zastaviť program"
+
+#: lazarusidestrconsts:lismenustop
+msgid "Stop"
+msgstr "Zastaviť"
+
+#: lazarusidestrconsts:liscontinue
+msgid "Continue"
+msgstr "Pokračovať"
+
+#: lazarusidestrconsts:lismenuresetdebugger
+msgid "Reset debugger"
+msgstr "Reštartovať ladenie"
+
+#: lazarusidestrconsts:liskmcompileroptions
+msgid "Compiler options"
+msgstr "Voľby prekladača"
+
+#: lazarusidestrconsts:lismenucompileroptions
+msgid "Compiler Options ..."
+msgstr "Voľby prekladača ..."
+
+#: lazarusidestrconsts:lismenurunparameters
+msgid "Run Parameters ..."
+msgstr "Parametre spustenia ..."
+
+#: lazarusidestrconsts:lismenubuildfile
+msgid "Build File"
+msgstr "Vybudovať súbor"
+
+#: lazarusidestrconsts:lismenurunfile
+msgid "Run File"
+msgstr "Spustiť súbor"
+
+#: lazarusidestrconsts:liskmconfigbuildfile
+msgid "Config %sBuild File%s"
+msgstr ""
+
+#: lazarusidestrconsts:liskminspect
+msgid "Inspect"
+msgstr ""
+
+#: lazarusidestrconsts:liskmevaluatemodify
+msgid "Evaluate/Modify"
+msgstr "Vyskúšať/Upraviť"
+
+#: lazarusidestrconsts:liskmaddwatch
+msgid "Add watch"
+msgstr "Pridať pozorovanie"
+
+#: lazarusidestrconsts:lismenuconfigbuildfile
+msgid "Configure Build+Run File ..."
+msgstr "Konfigurovať Vybudovať a Spustiť súbor ..."
+
+#: lazarusidestrconsts:lismenuinspect
+msgid "Inspect ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenuevaluate
+msgid "Evaluate/Modify ..."
+msgstr "Vyskúšať/Upraviť ..."
+
+#: lazarusidestrconsts:lismenuaddwatch
+msgid "Add watch ..."
+msgstr "Pridať·pozorovanie ..."
+
+#: lazarusidestrconsts:lismenuaddbreakpoint
+msgid "Add breakpoint"
+msgstr "Pridať bod prerušenia"
+
+#: lazarusidestrconsts:lismenuaddbpsource
+msgid "Source breakpoint"
+msgstr "Bod prerušenia zdrojového kódu"
+
+#: lazarusidestrconsts:lismenuopenpackage
+msgid "Open loaded package ..."
+msgstr "Otvoriť načítaný balíček ..."
+
+#: lazarusidestrconsts:lismenuopenrecentpkg
+msgid "Open recent package ..."
+msgstr "Otvoriť nedávny balíček ..."
+
+#: lazarusidestrconsts:lismenuopenpackagefile
+msgid "Open package file (.lpk) ..."
+msgstr "Otvoriť súbor balíčka (.lpk) ..."
+
+#: lazarusidestrconsts:lismenuopenpackageofcurunit
+msgid "Open package of current unit"
+msgstr "Otvoriť balíček aktuálnej unity"
+
+#: lazarusidestrconsts:lismenuaddcurunittopkg
+msgid "Add active unit to a package"
+msgstr "Pridať aktívnu unitu do balíčka"
+
+#: lazarusidestrconsts:liskmpackagegraph
+msgid "Package graph"
+msgstr "Graf balíčkov"
+
+#: lazarusidestrconsts:liskmconfigureinstalledpackages
+msgid "Configure installed packages"
+msgstr "Konfigurovať inštalované balíčky"
+
+#: lazarusidestrconsts:liskmconfigurecustomcomponents
+msgid "Configure custom components"
+msgstr "Konfigurovať voliteľné komponenty"
+
+#: lazarusidestrconsts:lismenupackagegraph
+msgid "Package Graph ..."
+msgstr "Graf balíčkov ..."
+
+#: lazarusidestrconsts:lismenueditinstallpkgs
+msgid "Configure installed packages ..."
+msgstr "Konfigurovať inštalované balíčky ..."
+
+#: lazarusidestrconsts:lismenuconfigcustomcomps
+msgid "Configure custom components ..."
+msgstr "Konfigurovať voliteľné komponenty ..."
+
+#: lazarusidestrconsts:lismenusettings
+msgid "Configure custom tools ..."
+msgstr "Konfigurovať voliteľné nástroje ..."
+
+#: lazarusidestrconsts:lismenuquicksyntaxcheck
+msgid "Quick syntax check"
+msgstr "Rýchla kontrola syntaxe"
+
+#: lazarusidestrconsts:lismenuguessunclosedblock
+msgid "Guess unclosed block"
+msgstr "Odhadnúť neuzavretý blok"
+
+#: lazarusidestrconsts:lismenuguessmisplacedifdef
+msgid "Guess misplaced IFDEF/ENDIF"
+msgstr ""
+
+#: lazarusidestrconsts:lismenumakeresourcestring
+msgid "Make Resource String ..."
+msgstr "Vytvoriť Resource String ..."
+
+#: lazarusidestrconsts:lismenudiff
+msgid "Diff"
+msgstr "Rozdiely"
+
+#: lazarusidestrconsts:lismenuconvertdfmtolfm
+msgid "Convert DFM file to LFM ..."
+msgstr "Konvertovať súbor DFM na LFM ..."
+
+#: lazarusidestrconsts:lismenuchecklfm
+msgid "Check LFM file in editor"
+msgstr "Skontrolovať súbor LFM v editore"
+
+#: lazarusidestrconsts:lismenuconvertdelphiunit
+msgid "Convert Delphi unit to Lazarus unit ..."
+msgstr "Konvertovať unitu Deplhi na unitu Lazarus ..."
+
+#: lazarusidestrconsts:lismenuconvertdelphiproject
+msgid "Convert Delphi project to Lazarus project ..."
+msgstr "Konvertovať projekt Delphi na projekt Lazarus ..."
+
+#: lazarusidestrconsts:lismenuconvertdelphipackage
+msgid "Convert Delphi package to Lazarus package ..."
+msgstr "Konvertovať·balíček Delphi·na·balíček Lazarus·..."
+
+#: lazarusidestrconsts:lismenubuildlazarus
+msgid "Build Lazarus"
+msgstr "Vybudovať Lazarus"
+
+#: lazarusidestrconsts:lismenuconfigurebuildlazarus
+msgid "Configure \"Build Lazarus\" ..."
+msgstr "Konfigurovať Vybudovanie·Lazarus"
+
+#: lazarusidestrconsts:lismenugeneraloptions
+msgid "Environment options ..."
+msgstr "Voľby prostredia ..."
+
+#: lazarusidestrconsts:lismenueditoroptions
+msgid "Editor options ..."
+msgstr "Voľby editora ..."
+
+#: lazarusidestrconsts:lismenueditcodetemplates
+msgid "Code Templates ..."
+msgstr "Šablóny kódu ..."
+
+#: lazarusidestrconsts:lismendebuggeroptions
+msgid "Debugger Options ..."
+msgstr "Voľby ladenia ..."
+
+#: lazarusidestrconsts:lismenucodetoolsoptions
+msgid "CodeTools Options ..."
+msgstr "Voľby CodeTools ..."
+
+#: lazarusidestrconsts:lismenucodetoolsdefineseditor
+msgid "CodeTools defines editor ..."
+msgstr ""
+
+#: lazarusidestrconsts:lismenuonlinehelp
+msgid "Online Help"
+msgstr "Online nápoveda"
+
+#: lazarusidestrconsts:lismenureportingbug
+msgid "Reporting a bug..."
+msgstr "Hlásenie chyby ..."
+
+#: lazarusidestrconsts:lisreportingbugurl
+msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
+msgstr ""
+
+#: lazarusidestrconsts:liskmconfigurehelp
+msgid "Configure Help"
+msgstr "Konfigurovať nápovedu"
+
+#: lazarusidestrconsts:liskmcontextsensitivehelp
+msgid "Context sensitive help"
+msgstr "Kontextovo závislá nápoveda"
+
+#: lazarusidestrconsts:liskmeditcontextsensitivehelp
+msgid "Edit context sensitive help"
+msgstr "Upraviť kontextovo závislú nápovedu"
+
+#: lazarusidestrconsts:lismenuconfigurehelp
+msgid "Configure Help ..."
+msgstr "Konfigurovať nápovedu ..."
+
+#: lazarusidestrconsts:lismenucontexthelp
+msgid "Context sensitive Help"
+msgstr "Kontextovo závislá nápoveda"
+
+#: lazarusidestrconsts:lismenueditcontexthelp
+msgid "Edit context sensitive Help"
+msgstr "Upraviť kontextovo závislú nápovedu"
+
+#: lazarusidestrconsts:lismenucreatelazdocfiles
+msgid "Create LazDoc files"
+msgstr "Vytvoriť súbory LazDoc"
+
+#: lazarusidestrconsts:lisdsgcopycomponents
+msgid "Copy selected components to clipboard"
+msgstr "Kopírovať vybraté komponenty"
+
+#: lazarusidestrconsts:lisdsgcutcomponents
+msgid "Cut selected components to clipboard"
+msgstr "Vystrihnúť vybraté·komponenty"
+
+#: lazarusidestrconsts:lisdsgpastecomponents
+msgid "Paste selected components from clipboard"
+msgstr "Vložiť vybraté komponenty"
+
+#: lazarusidestrconsts:lisdsgselectparentcomponent
+msgid "Select parent component"
+msgstr "Vybrať rodičovský komponent"
+
+#: lazarusidestrconsts:lisdsgordermovetofront
+msgid "Move component to front"
+msgstr "Presunúť komponent dopredu"
+
+#: lazarusidestrconsts:lisdsgordermovetoback
+msgid "Move component to back"
+msgstr "Presunúť·komponent·dozadu"
+
+#: lazarusidestrconsts:lisdsgorderforwardone
+msgid "Move component one forward"
+msgstr "Presunúť·komponent·o·jeden·vpred"
+
+#: lazarusidestrconsts:lisdsgorderbackone
+msgid "Move component one back"
+msgstr "Presunúť komponent o jeden vzad"
+
+#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
+msgid "Choose program source (*.pp,*.pas,*.lpr)"
+msgstr "Zvoliť zdrojový kód programu (*.pp, *.pas, *.lpr)"
+
+#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
+msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
+msgstr "Zdrojový kód programu musí mať príponu Pascalu ako .pas,·.pp·or·.lpr"
+
+#: lazarusidestrconsts:liscompileroptionsforproject
+msgid "Compiler Options for Project: %s"
+msgstr "Voľby prekladača pre Projekt: %s"
+
+#: lazarusidestrconsts:lischoosedelphiunit
+msgid "Choose Delphi unit (*.pas)"
+msgstr "Zvoliť unitu Delphi (*.pas)"
+
+#: lazarusidestrconsts:lischoosedelphiproject
+msgid "Choose Delphi project (*.dpr)"
+msgstr "Zvolliť projekt Delphi (*.dpr)"
+
+#: lazarusidestrconsts:lischoosedelphipackage
+msgid "Choose Delphi package (*.dpk)"
+msgstr "Zvoliť balíček Delphi (*.dpk)"
+
+#: lazarusidestrconsts:lisdelphiproject
+msgid "Delphi project"
+msgstr "Projekt Delphi"
+
+#: lazarusidestrconsts:lisunabletoreadfileerror
+msgid "Unable to read file %s%s%s%sError: %s"
+msgstr "Nemožno čítať súbor %s%s%s%sChyba:·%s"
+
+#: lazarusidestrconsts:lisformaterror
+msgid "Format error"
+msgstr "Chyba formátu"
+
+#: lazarusidestrconsts:lislfmfilecorrupt
+msgid "LFM file corrupt"
+msgstr "LFM súbor poškodený"
+
+#: lazarusidestrconsts:lisunabletofindavalidclassnamein
+msgid "Unable to find a valid classname in %s%s%s"
+msgstr "Nemožno nájsť platné meno triedy v %s%s%s"
+
+#: lazarusidestrconsts:lisunabletoconvertfileerror
+msgid "Unable to convert file %s%s%s%sError: %s"
+msgstr "nemožno konvertovať súbor %s%s%s%sChyba:·%s"
+
+#: lazarusidestrconsts:lisunabletowritefileerror
+msgid "Unable to write file %s%s%s%sError: %s"
+msgstr "Nemožno zapísať súbor %s%s%s%sChyba:·%s"
+
+#: lazarusidestrconsts:liserrorcreatinglrs
+msgid "Error creating lrs"
+msgstr "Chyba vytvárania lrs"
+
+#: lazarusidestrconsts:lislfmfilenotfound
+msgid "LFM file not found"
+msgstr "LFM súbor nenájdený"
+
+#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
+msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
+msgstr ""
+
+#: lazarusidestrconsts:lisunitnotfound
+msgid "Unit not found"
+msgstr "Nenájdená·unita"
+
+#: lazarusidestrconsts:lisunitsnotfound2
+msgid "Units not found"
+msgstr "Nenájdené unity"
+
+#: lazarusidestrconsts:lisunitlfmfile
+msgid "Unit: %s%sLFM file: %s"
+msgstr "Unita:·%s%sLFM·súbor:·%s"
+
+#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
+msgid "Unable to convert lfm to lrs and write lrs file."
+msgstr "Nemožno konvertovať lfm na lrs a zapísať súbor lrs"
+
+#: lazarusidestrconsts:lisnotadelphiproject
+msgid "Not a Delphi project"
+msgstr "Nie je projekt Delphi"
+
+#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
+msgid "The file %s%s%s is not a Delphi project (.dpr)"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
+msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
+msgstr ""
+
+#: lazarusidestrconsts:lisresourceloaderror
+msgid "Resource load error"
+msgstr ""
+
+#: lazarusidestrconsts:lisignoremissingfile
+msgid "Ignore missing file"
+msgstr "Ignorovať chýbajúci súbor"
+
+#: lazarusidestrconsts:lisnoname
+msgid "noname"
+msgstr "bez mena"
+
+#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
+msgid "The destination directory%s%s%s%s does not exist."
+msgstr "Cieľový adresár  %s%s%s%s·neexistuje."
+
+#: lazarusidestrconsts:lisrenamefile
+msgid "Rename file?"
+msgstr "Premenovať súbor?"
+
+#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
+msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
+msgstr ""
+
+#: lazarusidestrconsts:lisrenametolowercase
+msgid "Rename to lowercase"
+msgstr "Premenovať na malé písmená"
+
+#: lazarusidestrconsts:liskeepname
+msgid "Keep name"
+msgstr "Zachovať meno"
+
+#: lazarusidestrconsts:lisoverwritefile
+msgid "Overwrite file?"
+msgstr "Prepísať súbor?"
+
+#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
+msgid "A file %s%s%s already exists.%sReplace it?"
+msgstr "Súbor %s%s%s·už existuje.%sNahradiť ho?"
+
+#: lazarusidestrconsts:lisoverwritefileondisk
+msgid "Overwrite file on disk"
+msgstr "Prepísať súbor na disku"
+
+#: lazarusidestrconsts:lisambiguousfilesfound
+msgid "Ambiguous files found"
+msgstr ""
+
+#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
+msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
+msgstr ""
+
+#: lazarusidestrconsts:lisdeleteoldfile
+msgid "Delete old file %s%s%s?"
+msgstr "Zmazať starý súbor %s%s%s?"
+
+#: lazarusidestrconsts:lisdeletingoffilefailed
+msgid "Deleting of file %s%s%s failed."
+msgstr "Mazanie súboru %s%s%s·zlyhalo."
+
+#: lazarusidestrconsts:lisstreamingerror
+msgid "Streaming error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletostreamt
+msgid "Unable to stream %s:T%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisresourcesaveerror
+msgid "Resource save error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
+msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
+msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatefile2
+msgid "Unable to create file %s%s%s"
+msgstr "Nemožno vytvoriť súbor %s%s%s"
+
+#: lazarusidestrconsts:liscontinuewithoutloadingform
+msgid "Continue without loading form"
+msgstr "Pokračovať bez vytvorenia formulára"
+
+#: lazarusidestrconsts:liscancelloadingunit
+msgid "Cancel loading unit"
+msgstr "Zrušiť načítanie unity"
+
+#: lazarusidestrconsts:lisabortallloading
+msgid "Abort all loading"
+msgstr "Zrušiť všetky načítania"
+
+#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
+msgid "Unable to transform binary component stream of %s:T%s into text."
+msgstr ""
+
+#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
+msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
+msgstr ""
+
+#: lazarusidestrconsts:lisskipfileandcontinueloading
+msgid "Skip file and continue loading"
+msgstr "Preskočiť súbor a pokračovať v načítaní"
+
+#: lazarusidestrconsts:lisabortloadingproject
+msgid "Abort loading project"
+msgstr "Zrušiť načítanie projektu"
+
+#: lazarusidestrconsts:lisfilenotfound2
+msgid "File %s%s%s not found.%s"
+msgstr "Súbor %s%s%s·nenájdený.%s"
+
+#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
+msgid "File %s%s%s not found.%sDo you want to create it?%s"
+msgstr "Súbor·%s%s%s nenájdený.%sChcete ho vytvoriť?%s"
+
+#: lazarusidestrconsts:lisprojectinfofiledetected
+msgid "Project info file detected"
+msgstr "Informačný súbor projektu zistený"
+
+#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
+msgid "The file %s seems to be the program file of an existing lazarus Project."
+msgstr ""
+
+#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
+msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
+msgstr ""
+
+#: lazarusidestrconsts:lisprogramdetected
+msgid "Program detected"
+msgstr "Program zistený"
+
+#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
+msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
+msgstr ""
+
+#: lazarusidestrconsts:lisformloaderror
+msgid "Form load error"
+msgstr "Chyba načítania formulára"
+
+#: lazarusidestrconsts:lissaveprojectlpi
+msgid "Save Project %s (*.lpi)"
+msgstr "Uložiť projekt %s·(*.lpi)"
+
+#: lazarusidestrconsts:lisinvalidprojectfilename
+msgid "Invalid project filename"
+msgstr "Neplatné meno súboru projektu"
+
+#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
+msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
+msgstr ""
+
+#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
+msgid "The name %s%s%s is not a valid pascal identifier."
+msgstr "Meno·%s%s%s·nie je platný identifikátor Pascalu."
+
+#: lazarusidestrconsts:lischooseadifferentname
+msgid "Choose a different name"
+msgstr "Zvoľte iné meno"
+
+#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
+msgid "The project info file %s%s%s%sis equal to the project main source file!"
+msgstr ""
+
+#: lazarusidestrconsts:lisunitidentifierexists
+msgid "Unit identifier exists"
+msgstr "Identifikátor unity existuje"
+
+#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
+msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
+msgstr "Unita s menom %s%s%s·už v projekte existuje.%s"
+
+#: lazarusidestrconsts:liserrorcreatingfile
+msgid "Error creating file"
+msgstr "Chyba vytvárania súboru"
+
+#: lazarusidestrconsts:lisunabletocreatefile3
+msgid "Unable to create file%s%s%s%s"
+msgstr "Nemožno vytvoriť súbor %s%s%s%s"
+
+#: lazarusidestrconsts:liscopyerror2
+msgid "Copy error"
+msgstr "Chyba kopírovania"
+
+#: lazarusidestrconsts:lissourcedirectorydoesnotexist
+#, fuzzy
+msgid "Source directory %s%s%s does not exist."
+msgstr "Zdrojový adresár %s%s%s neexistuje."
+
+#: lazarusidestrconsts:lisunabletocreatedirectory
+msgid "Unable to create directory %s%s%s."
+msgstr "Nemožno vytvoriť adresár %s%s%s."
+
+#: lazarusidestrconsts:lisunabletocopyfileto
+msgid "Unable to copy file %s%s%s%sto %s%s%s"
+msgstr "Nemožno prekopírovať súbor %s%s%s%sdo·%s%s%s"
+
+#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
+msgid "Sorry, this type is not yet implemented"
+msgstr "Prepáčte, tento typ zatiaľ nie je implementovaný"
+
+#: lazarusidestrconsts:lisfilehaschangedsave
+msgid "File %s%s%s has changed. Save?"
+msgstr "Súbor %s%s%s·bol zmenený.·Uložiť?"
+
+#: lazarusidestrconsts:lisunithaschangedsave
+msgid "Unit %s%s%s has changed. Save?"
+msgstr "Unita %s%s%s bola zmenená  Uložiť?"
+
+#: lazarusidestrconsts:lissourceofpagehaschangedsave
+msgid "Source of page %s%s%s has changed. Save?"
+msgstr "Zdrojový kód stránky %s%s%s·bol zmenený.·Uložiť?"
+
+#: lazarusidestrconsts:lissourcemodified
+msgid "Source modified"
+msgstr "Zdrojový kód zmenený"
+
+#: lazarusidestrconsts:lisopenproject
+msgid "Open Project?"
+msgstr "Otvoriť projekt?"
+
+#: lazarusidestrconsts:lisopentheproject
+msgid "Open the project %s?"
+msgstr "otvoriť projekt %s?"
+
+#: lazarusidestrconsts:lisopenpackage
+msgid "Open Package?"
+msgstr "Otvoriť balíček?"
+
+#: lazarusidestrconsts:lisopenthepackage
+msgid "Open the package %s?"
+msgstr "Otvoriť balíček %s?"
+
+#: lazarusidestrconsts:lisrevertfailed
+msgid "Revert failed"
+msgstr "Vrátenie zlyhalo"
+
+#: lazarusidestrconsts:lisfileisvirtual
+msgid "File %s%s%s is virtual."
+msgstr "Súbor %s%s%s·je virtuálny."
+
+#: lazarusidestrconsts:lisunabletowrite
+msgid "Unable to write %s%s%s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisfilenottext
+msgid "File not text"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenamefile
+msgid "Unable to rename file"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocopyfile
+msgid "Unable to copy file"
+msgstr ""
+
+#: lazarusidestrconsts:lissourceanddestinationarethesame
+msgid "Source and Destination are the same:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenamefileto2
+msgid "Unable to rename file %s%s%s%sto %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocopyfileto2
+msgid "Unable to copy file %s%s%s%sto %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
+msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidcommand
+msgid "Invalid command"
+msgstr ""
+
+#: lazarusidestrconsts:listhecommandafterisnotexecutable
+msgid "The command after %s%s%s is not executable."
+msgstr ""
+
+#: lazarusidestrconsts:lisinvaliddestinationdirectory
+msgid "Invalid destination directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
+msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
+msgid "Unable to clean up destination directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscommandafterinvalid
+msgid "Command after invalid"
+msgstr ""
+
+#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
+msgid "The command after publishing is invalid:%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
+msgid "Unable to clean up %s%s%s.%sPlease check permissions."
+msgstr ""
+
+#: lazarusidestrconsts:liscommandafterpublishingmodule
+msgid "Command after publishing module"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
+msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
+msgstr ""
+
+#: lazarusidestrconsts:lisaddtoproject
+msgid "Add %s to project?"
+msgstr ""
+
+#: lazarusidestrconsts:listhefile
+msgid "The file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisaddtounitsearchpath
+msgid "Add to unit search path?"
+msgstr ""
+
+#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
+msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
+msgstr ""
+
+#: lazarusidestrconsts:lisisalreadypartoftheproject
+msgid "%s is already part of the Project."
+msgstr ""
+
+#: lazarusidestrconsts:lisremovefromproject
+msgid "Remove from project"
+msgstr ""
+
+#: lazarusidestrconsts:liscreateaprojectfirst
+msgid "Create a project first!"
+msgstr ""
+
+#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
+msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
+msgstr ""
+
+#: lazarusidestrconsts:lisbuildnewproject
+msgid "Build new project"
+msgstr ""
+
+#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
+msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojectsuccessfullybuilt
+msgid "Project %s%s%s successfully built. :)"
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutingcommandbefore
+msgid "Executing command before"
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutingcommandafter
+msgid "Executing command after"
+msgstr ""
+
+#: lazarusidestrconsts:lisnoprogramfilesfound
+msgid "No program file %s%s%s found."
+msgstr ""
+
+#: lazarusidestrconsts:liserrorinitializingprogramserrors
+msgid "Error initializing program%s%s%s%s%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisnotnow
+msgid "Not now"
+msgstr ""
+
+#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
+msgid "You can not build lazarus while debugging or compiling."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletosavefile
+msgid "Unable to save file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisreaderror
+msgid "Read Error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoreadfile2
+msgid "Unable to read file %s%s%s!"
+msgstr ""
+
+#: lazarusidestrconsts:liswriteerror
+msgid "Write Error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletowritetofile
+msgid "Unable to write to file %s%s%s!"
+msgstr ""
+
+#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2
+msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatebackupdirectory
+msgid "Unable to create backup directory %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisambiguousunitfound2
+msgid "Ambiguous unit found"
+msgstr ""
+
+#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
+msgid "The unit %s exists twice in the unit path of the %s:"
+msgstr ""
+
+#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
+msgid "Hint: Check if two packages contain a unit with the same name."
+msgstr ""
+
+#: lazarusidestrconsts:lisignoreall
+msgid "Ignore all"
+msgstr ""
+
+#: lazarusidestrconsts:lisdeletefilefailed
+msgid "Delete file failed"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
+msgid "Unable to remove old backup file %s%s%s!"
+msgstr ""
+
+#: lazarusidestrconsts:lisrenamefilefailed
+msgid "Rename file failed"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenamefileto
+msgid "Unable to rename file %s%s%s to %s%s%s!"
+msgstr ""
+
+#: lazarusidestrconsts:lisbackupfilefailed
+msgid "Backup file failed"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletobackupfileto
+msgid "Unable to backup file %s%s%s to %s%s%s!"
+msgstr ""
+
+#: lazarusidestrconsts:lisfilenotlowercase
+msgid "File not lowercase"
+msgstr ""
+
+#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
+msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
+msgstr ""
+
+#: lazarusidestrconsts:lisdeleteambiguousfile
+msgid "Delete ambiguous file?"
+msgstr ""
+
+#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
+msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
+msgstr ""
+
+#: lazarusidestrconsts:lislazaruseditorv
+msgid "Lazarus IDE v%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisnewproject
+msgid "%s - (new project)"
+msgstr ""
+
+#: lazarusidestrconsts:liscompiling
+msgid "%s (compiling ...)"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugging
+msgid "%s (debugging ...)"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindfile
+msgid "Unable to find file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
+msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
+msgid "NOTE: Could not create Define Template for Free Pascal Sources"
+msgstr ""
+
+#: lazarusidestrconsts:lisclassnotfound
+msgid "Class not found"
+msgstr ""
+
+#: lazarusidestrconsts:lisoifclassnotfound
+msgid "Class %s%s%s not found."
+msgstr ""
+
+#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
+msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
+msgstr ""
+
+#: lazarusidestrconsts:liscontrolneedsparent
+msgid "Control needs parent"
+msgstr ""
+
+#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
+msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
+msgstr ""
+
+#: lazarusidestrconsts:lisconversionerror
+msgid "Conversion error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
+msgid "Unable to convert component text into binary format:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
+msgid "NOTE: Could not create Define Template for Lazarus Sources"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
+msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
+msgstr ""
+
+#: lazarusidestrconsts:lisselectionexceedsstringconstant
+msgid "Selection exceeds string constant"
+msgstr ""
+
+#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
+msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
+msgstr ""
+
+#: lazarusidestrconsts:lisnoresourcestringsectionfound
+msgid "No ResourceString Section found"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
+msgid "Unable to find a ResourceString section in this or any of the used units."
+msgstr ""
+
+#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
+msgid "Component name %s%s%s is not a valid identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
+msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
+msgstr ""
+
+#: lazarusidestrconsts:liscomponentnameiskeyword
+msgid "Component name %s%s%s is keyword"
+msgstr ""
+
+#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
+msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenamevariableinsource
+msgid "Unable to rename variable in source."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
+msgid "Unable to update CreateForm statement in project source"
+msgstr ""
+
+#: lazarusidestrconsts:listhereisalreadyaformwiththename
+msgid "There is already a form with the name %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
+msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
+msgstr ""
+
+#: lazarusidestrconsts:lisseemessages
+msgid "See messages."
+msgstr ""
+
+#: lazarusidestrconsts:liserror
+msgid "Error: "
+msgstr ""
+
+#: lazarusidestrconsts:lissavechanges
+msgid "Save changes?"
+msgstr ""
+
+#: lazarusidestrconsts:lissavefilebeforeclosingform
+msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenameforminsource
+msgid "Unable to rename form in source."
+msgstr ""
+
+#: lazarusidestrconsts:lissorrynotimplementedyet
+msgid "Sorry, not implemented yet"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
+msgid "Unable to find method. Please fix the error shown in the message window."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
+msgid "Unable to create new method. Please fix the error shown in the message window."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
+msgid "Unable to show method. Please fix the error shown in the message window."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
+msgid "Unable to rename method. Please fix the error shown in the message window."
+msgstr ""
+
+#: lazarusidestrconsts:lisstopdebugging
+msgid "Stop Debugging?"
+msgstr ""
+
+#: lazarusidestrconsts:lisstopthedebugging
+msgid "Stop the debugging?"
+msgstr ""
+
+#: lazarusidestrconsts:liscannotfindlazarusstarter
+msgid "Cannot find lazarus starter:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisresourcefilecomment
+msgid "This is an automatically generated lazarus resource file"
+msgstr ""
+
+#: lazarusidestrconsts:lisopenfile
+msgid "Open file"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoexportfileexists
+msgid "Export file exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
+msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
+msgid "Open or Load Compiler Options"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoerroraccessingxml
+msgid "Error accessing xml"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoerrorloadingxml
+msgid "Error loading xml"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
+msgid "Error loading xml file %s%s%s:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
+msgid "Error accessing xml file %s%s%s:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecorecentfiles
+msgid "Recent files"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecosavetorecent
+msgid "Save to recent"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoopenrecent
+msgid "Open recent"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecosavetofile
+msgid "Save to file"
+msgstr ""
+
+#: lazarusidestrconsts:lisiecoloadfromfile
+msgid "Load from file"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusfile
+msgid "Lazarus File"
+msgstr ""
+
+#: lazarusidestrconsts:lispascalunit
+msgid "Pascal unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispascalsourcefile
+msgid "Pascal source file"
+msgstr ""
+
+#: lazarusidestrconsts:lisfreepascalsourcefile
+msgid "FreePascal source file"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugunabletoloadfile
+msgid "Unable to load file"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugunabletoloadfile2
+msgid "Unable to load file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisopenprojectfile
+msgid "Open Project File"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusprojectinfofile
+msgid "Lazarus Project Info file"
+msgstr ""
+
+#: lazarusidestrconsts:lisallfiles
+msgid "All Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojectclosed
+msgid "Project closed"
+msgstr ""
+
+#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin
+msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically."
+msgstr ""
+
+#: lazarusidestrconsts:lisquitlazarus
+msgid "Quit Lazarus"
+msgstr ""
+
+#: lazarusidestrconsts:liscreatenewproject
+msgid "Create new project"
+msgstr ""
+
+#: lazarusidestrconsts:lisopenpackagefile
+msgid "Open Package File"
+msgstr ""
+
+#: lazarusidestrconsts:lissavespace
+msgid "Save "
+msgstr ""
+
+#: lazarusidestrconsts:lisselectdfmfiles
+msgid "Select Delphi form files (*.dfm)"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosedirectory
+msgid "Choose directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisdestinationdirectory
+msgid "Destination directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscommandafter
+msgid "Command after"
+msgstr ""
+
+#: lazarusidestrconsts:lischooselazarussourcedirectory
+msgid "Choose Lazarus Directory"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosecompilerpath
+msgid "Choose compiler filename (%s)"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosefpcsourcedir
+msgid "Choose FPC source directory"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosemakepath
+msgid "Choose make path"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosedebuggerpath
+msgid "Choose debugger filename"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosetestbuilddir
+msgid "Choose the directory for tests"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusdesktopsettings
+msgid "Lazarus Desktop Settings"
+msgstr ""
+
+#: lazarusidestrconsts:lisxmlfiles
+msgid "XML files"
+msgstr ""
+
+#: lazarusidestrconsts:lissavechangestoproject
+msgid "Save changes to project %s?"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojectchanged
+msgid "Project changed"
+msgstr ""
+
+#: lazarusidestrconsts:lisfpcsourcedirectoryerror
+msgid "FPC Source Directory error"
+msgstr ""
+
+#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
+msgid "Please check the freepascal source directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscompilererror
+msgid "Compiler error"
+msgstr ""
+
+#: lazarusidestrconsts:lispleasecheckthecompilername
+msgid "Please check the compiler name"
+msgstr ""
+
+#: lazarusidestrconsts:lisaboutlazarus
+msgid "About Lazarus"
+msgstr ""
+
+#: lazarusidestrconsts:lisversion
+msgid "Version"
+msgstr ""
+
+#: lazarusidestrconsts:lisvertoclipboard
+msgid "Copy version information to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:lisdate
+msgid "Date"
+msgstr ""
+
+#: lazarusidestrconsts:lissvnrevision
+msgid "SVN Revision: "
+msgstr ""
+
+#: lazarusidestrconsts:lisclose
+msgid "&Close"
+msgstr ""
+
+#: lazarusidestrconsts:lisaboutlazarusmsg
+msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
+msgstr ""
+
+#: lazarusidestrconsts:lisaboutnocontributors
+msgid "Cannot find contributors list."
+msgstr ""
+
+#: lazarusidestrconsts:lisunitnamealreadyexistscap
+msgid "Unitname already in project"
+msgstr ""
+
+#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
+msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
+msgstr ""
+
+#: lazarusidestrconsts:lisforcerenaming
+msgid "Force renaming"
+msgstr ""
+
+#: lazarusidestrconsts:liscancelrenaming
+msgid "Cancel renaming"
+msgstr ""
+
+#: lazarusidestrconsts:lisabortall
+msgid "Abort all"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidpascalidentifiercap
+msgid "Invalid Pascal Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidpascalidentifiertext
+msgid "The name \"%s\" is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:liscopyerror
+msgid "Copy Error"
+msgstr ""
+
+#: lazarusidestrconsts:lishintopen
+msgid "Open"
+msgstr ""
+
+#: lazarusidestrconsts:lishintsave
+msgid "Save"
+msgstr ""
+
+#: lazarusidestrconsts:lishintsaveall
+msgid "Save all"
+msgstr ""
+
+#: lazarusidestrconsts:lishinttoggleformunit
+msgid "Toggle Form/Unit"
+msgstr ""
+
+#: lazarusidestrconsts:lishintviewunits
+msgid "View Units"
+msgstr ""
+
+#: lazarusidestrconsts:lishintviewforms
+msgid "View Forms"
+msgstr ""
+
+#: lazarusidestrconsts:lishintrun
+msgid "Run"
+msgstr ""
+
+#: lazarusidestrconsts:lishintpause
+msgid "Pause"
+msgstr ""
+
+#: lazarusidestrconsts:lishintstepinto
+msgid "Step Into"
+msgstr ""
+
+#: lazarusidestrconsts:lishintstepover
+msgid "Step Over"
+msgstr ""
+
+#: lazarusidestrconsts:lisgplnotice
+msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+msgstr ""
+
+#: lazarusidestrconsts:lislgplnotice
+msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+msgstr ""
+
+#: lazarusidestrconsts:lismodifiedlgplnotice
+msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
+msgstr ""
+
+#: lazarusidestrconsts:dlgbaknosubdirectory
+msgid "(no subdirectory)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsearchcaption
+msgid "Searching..."
+msgstr ""
+
+#: lazarusidestrconsts:dlgsearchabort
+msgid "Search terminated by user."
+msgstr ""
+
+#: lazarusidestrconsts:lissmatches
+msgid "Matches"
+msgstr ""
+
+#: lazarusidestrconsts:lisssearching
+msgid "Searching"
+msgstr ""
+
+#: lazarusidestrconsts:lisssearchtext
+msgid "Search text"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdesktop
+msgid "Desktop"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwindows
+msgid "Windows"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfrmeditor
+msgid "Form Editor"
+msgstr ""
+
+#: lazarusidestrconsts:dlgobjinsp
+msgid "Object Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvfiles
+msgid "Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisignorebinaries
+msgid "Ignore binaries"
+msgstr ""
+
+#: lazarusidestrconsts:lissimplesyntax
+msgid "Simple Syntax"
+msgstr ""
+
+#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
+msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
+msgstr ""
+
+#: lazarusidestrconsts:lisuseexcludefilter
+msgid "Use Exclude Filter"
+msgstr ""
+
+#: lazarusidestrconsts:lisexcludefilter
+msgid "Exclude Filter"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojectinformation
+msgid "Project Information"
+msgstr ""
+
+#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
+msgid "Save editor info of non project files"
+msgstr ""
+
+#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
+msgid "Save info of closed editor files"
+msgstr ""
+
+#: lazarusidestrconsts:lisuseincludefilter
+msgid "Use Include Filter"
+msgstr ""
+
+#: lazarusidestrconsts:lisincludefilter
+msgid "Include Filter"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvbckup
+msgid "Backup"
+msgstr ""
+
+#: lazarusidestrconsts:dlgnaming
+msgid "Naming"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdoc
+msgid "LazDoc"
+msgstr ""
+
+#: lazarusidestrconsts:lisokbtn
+msgid "Ok"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcancel
+msgid "Cancel"
+msgstr ""
+
+#: lazarusidestrconsts:lissamselectnone
+msgid "Select none"
+msgstr ""
+
+#: lazarusidestrconsts:liskmclassic
+msgid "Classic"
+msgstr ""
+
+#: lazarusidestrconsts:liskmmacosx
+msgid "Mac OS X"
+msgstr ""
+
+#: lazarusidestrconsts:lispefilename
+msgid "Filename:"
+msgstr ""
+
+#: lazarusidestrconsts:lispeunitname
+msgid "Unitname:"
+msgstr ""
+
+#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
+msgid "The unitname is used when the IDE extends uses clauses."
+msgstr ""
+
+#: lazarusidestrconsts:lispetheunitnameisusedwhentheideextendsusesclauses
+msgid "The unitname is used when the IDE extends uses clauses."
+msgstr ""
+
+#: lazarusidestrconsts:lispeinvalidunitfilename
+msgid "Invalid unit filename"
+msgstr ""
+
+#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
+msgid "A pascal unit must have the extension .pp or .pas"
+msgstr ""
+
+#: lazarusidestrconsts:lispeapascalunitmusthavetheextensionpporpas
+msgid "A pascal unit must have the extension .pp or .pas"
+msgstr ""
+
+#: lazarusidestrconsts:lispeinvalidunitname
+msgid "Invalid unitname"
+msgstr ""
+
+#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
+msgid "The unitname is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
+msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
+msgstr ""
+
+#: lazarusidestrconsts:lispetheunitnameisnotavalidpascalidentifier
+msgid "The unitname is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lispeconflictfound
+msgid "Conflict found"
+msgstr ""
+
+#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
+msgid "There is already an unit with this name.%sFile: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispethereisalreadyanunitwiththisnamefile
+msgid "There is already an unit with this name.%sFile: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
+msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
+msgstr ""
+
+#: lazarusidestrconsts:lisok
+msgid "&Ok"
+msgstr ""
+
+#: lazarusidestrconsts:liscmparameter
+msgid "Parameter"
+msgstr ""
+
+#: lazarusidestrconsts:lisctpleaseselectamacro
+msgid "please select a macro"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pcreatenewfile
+msgid "Create new file"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvlanguage
+msgid "Language"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautosave
+msgid "Auto save"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedfiles
+msgid "Editor files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvproject
+msgid "Project"
+msgstr ""
+
+#: lazarusidestrconsts:liscodebrowser
+msgid "Code browser"
+msgstr ""
+
+#: lazarusidestrconsts:dlgintvinsec
+msgid "Interval in secs"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdesktopfiles
+msgid "Desktop files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsavedfile
+msgid "Save desktop settings to file"
+msgstr ""
+
+#: lazarusidestrconsts:dlgloaddfile
+msgid "Load desktop settings from file"
+msgstr ""
+
+#: lazarusidestrconsts:dlgminimizeallonminimizemain
+msgid "Minimize all on minimize main"
+msgstr ""
+
+#: lazarusidestrconsts:dlghideideonrun
+msgid "Hide IDE windows on run"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpalhints
+msgid "Hints for component palette"
+msgstr ""
+
+#: lazarusidestrconsts:lischeckchangesondiskwithloading
+msgid "Check changes on disk with loading"
+msgstr ""
+
+#: lazarusidestrconsts:dlgspbhints
+msgid "Hints for main speed buttons (open, save, ...)"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
+msgid "Double click on messages jumps (otherwise: single click)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwinpos
+msgid "Window Positions"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmainmenu
+msgid "Main Menu"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsrcedit
+msgid "Source Editor"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmsgs
+msgid "Messages"
+msgstr ""
+
+#: lazarusidestrconsts:dlgprojfiles
+msgid "Project files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvtype
+msgid "Type"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvnone
+msgid "None"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsmbfront
+msgid "Symbol in front (.~pp)"
+msgstr ""
+
+#: lazarusidestrconsts:lisnobackupfiles
+msgid "No backup files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsmbbehind
+msgid "Symbol behind (.pp~)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsmbcounter
+msgid "Counter (.pp;1)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcustomext
+msgid "User defined extension (.pp.xxx)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbckupsubdir
+msgid "Same name (in subdirectory)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedcustomext
+msgid "User defined extension"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmaxcntr
+msgid "Maximum counter"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedbsubdir
+msgid "Sub directory"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvotherfiles
+msgid "Other files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmaxrecentfiles
+msgid "Max recent files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmaxrecentprojs
+msgid "Max recent project files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgqopenlastprj
+msgid "Open last project at start"
+msgstr ""
+
+#: lazarusidestrconsts:dlglazarusdir
+msgid "Lazarus directory (default for all projects)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfpcpath
+msgid "Compiler path (e.g. %s)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfpcsrcpath
+msgid "FPC source directory"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmakepath
+msgid "Make path"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdebugtype
+msgid "Debugger type and path"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtestprjdir
+msgid "Directory for building test projects"
+msgstr ""
+
+#: lazarusidestrconsts:dlgqshowgrid
+msgid "Show grid"
+msgstr ""
+
+#: lazarusidestrconsts:dlgqshowborderspacing
+msgid "Show border spacing"
+msgstr ""
+
+#: lazarusidestrconsts:dlggridcolor
+msgid "Grid color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgqsnaptogrid
+msgid "Snap to grid"
+msgstr ""
+
+#: lazarusidestrconsts:dlggridx
+msgid "Grid size X"
+msgstr ""
+
+#: lazarusidestrconsts:dlggridxhint
+msgid "Horizontal grid step size"
+msgstr ""
+
+#: lazarusidestrconsts:dlggridy
+msgid "Grid size Y"
+msgstr ""
+
+#: lazarusidestrconsts:dlggridyhint
+msgid "Vertical grid step size"
+msgstr ""
+
+#: lazarusidestrconsts:dlgguidelines
+msgid "Show Guide Lines"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsnapguidelines
+msgid "Snap to Guide Lines"
+msgstr ""
+
+#: lazarusidestrconsts:dlglefttopclr
+msgid "color for left, top"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrightbottomclr
+msgid "color for right, bottom"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowcaps
+msgid "Show component captions"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowedrhints
+msgid "Show editor hints"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautoform
+msgid "Auto create form when opening unit"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrightclickselects
+msgid "Right Click selects"
+msgstr ""
+
+#: lazarusidestrconsts:dlggrabbercolor
+msgid "Grabber color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmarkercolor
+msgid "Marker color"
+msgstr ""
+
+#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
+msgid "Reduce designer painting"
+msgstr ""
+
+#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
+msgid "Paint designer items only on idle (reduce overhead for slow computers)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvgrid
+msgid "Grid"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvlguidelines
+msgid "Guide lines"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvmisc
+msgid "Miscellaneous"
+msgstr ""
+
+#: lazarusidestrconsts:dlgruberbandselectioncolor
+msgid "Selection"
+msgstr ""
+
+#: lazarusidestrconsts:dlgruberbandcreationcolor
+msgid "Creation"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
+msgid "Select grand childs"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrubberbandgroup
+msgid "Rubber band"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpasext
+msgid "Default pascal extension"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcharcasefileact
+msgid "Save As - auto rename pascal files lower case"
+msgstr ""
+
+#: lazarusidestrconsts:dlgambigfileact
+msgid "Ambiguous file action:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvask
+msgid "Ask"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautodel
+msgid "Auto delete file"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautoren
+msgid "Auto rename file lowercase"
+msgstr ""
+
+#: lazarusidestrconsts:dlgnoautomaticrenaming
+msgid "no automatic renaming"
+msgstr ""
+
+#: lazarusidestrconsts:dlgambigwarn
+msgid "Warn on compile"
+msgstr ""
+
+#: lazarusidestrconsts:dlgignoreverb
+msgid "Ignore"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbackcolor
+msgid "Background"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsubpropkcolor
+msgid "Subpropertes"
+msgstr ""
+
+#: lazarusidestrconsts:dlgreferencecolor
+msgid "Reference"
+msgstr ""
+
+#: lazarusidestrconsts:dlgvaluecolor
+msgid "Value"
+msgstr ""
+
+#: lazarusidestrconsts:liswladd
+msgid "&Add"
+msgstr ""
+
+#: lazarusidestrconsts:liswlproperties
+msgid "&Properties"
+msgstr ""
+
+#: lazarusidestrconsts:liswlenabled
+msgid "&Enabled"
+msgstr ""
+
+#: lazarusidestrconsts:liswldelete
+msgid "&Delete"
+msgstr ""
+
+#: lazarusidestrconsts:liswldisableall
+msgid "D&isable All"
+msgstr ""
+
+#: lazarusidestrconsts:liswlenableall
+msgid "E&nable All"
+msgstr ""
+
+#: lazarusidestrconsts:liswldeleteall
+msgid "De&lete All"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdefvaluecolor
+msgid "Default value"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpropnamecolor
+msgid "Property name"
+msgstr ""
+
+#: lazarusidestrconsts:dlgoimiscellaneous
+msgid "Miscellaneous"
+msgstr ""
+
+#: lazarusidestrconsts:dlgoiitemheight
+msgid "Item height"
+msgstr ""
+
+#: lazarusidestrconsts:lisshowhintsinobjectinspector
+msgid "Show hints in Object Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvcolors
+msgid "Colors"
+msgstr ""
+
+#: lazarusidestrconsts:dlgenvbackuphelpnote
+msgid "Notes: Project files are all files in the project directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
+msgid "Invalid compiler filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
+msgid "The compiler file \"%s\" is not an executable."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
+msgid "Invalid make filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
+msgid "The make file \"%s\" is not an executable."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
+msgid "Invalid debugger filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
+msgid "The debugger file \"%s\" is not an executable."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
+msgid "Directory not found"
+msgstr ""
+
+#: lazarusidestrconsts:lisinstallationfailed
+msgid "Installation failed"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
+msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
+msgid "Lazarus directory \"%s\" not found."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
+msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
+msgid "FPC source directory \"%s\" not found."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
+msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
+msgstr ""
+
+#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
+msgid "Test directory \"%s\" not found."
+msgstr ""
+
+#: lazarusidestrconsts:dlgeddisplay
+msgid "Display"
+msgstr ""
+
+#: lazarusidestrconsts:liseotabwidths
+msgid "Tab widths"
+msgstr ""
+
+#: lazarusidestrconsts:dlgkeymapping
+msgid "Key Mappings"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedcolor
+msgid "Color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgkeymappingerrors
+msgid "Key mapping errors"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedback
+msgid "Back"
+msgstr ""
+
+#: lazarusidestrconsts:dlgreport
+msgid "Report"
+msgstr ""
+
+#: lazarusidestrconsts:dlgednoerr
+msgid "No errors in key mapping found."
+msgstr ""
+
+#: lazarusidestrconsts:dlgdeltemplate
+msgid "Delete template "
+msgstr ""
+
+#: lazarusidestrconsts:dlgchscodetempl
+msgid "Choose code template file (*.dci)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgallfiles
+msgid "All files"
+msgstr ""
+
+#: lazarusidestrconsts:lissavefileas
+msgid "Save file as"
+msgstr ""
+
+#: lazarusidestrconsts:lisopenexistingfile
+msgid "Open existing file"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusunit
+msgid "Lazarus unit"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusinclude
+msgid "Lazarus include file"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusproject
+msgid "Lazarus project"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusform
+msgid "Lazarus form"
+msgstr ""
+
+#: lazarusidestrconsts:lislazaruspackage
+msgid "Lazarus package"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusprojectsource
+msgid "Lazarus project source"
+msgstr ""
+
+#: lazarusidestrconsts:dlgaltsetclmode
+msgid "Alt-Key sets column mode"
+msgstr ""
+
+#: lazarusidestrconsts:dlgalwaysvisiblecaret
+msgid "Always visible caret"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautoident
+msgid "Auto indent"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbrachighlight
+msgid "Bracket highlighting"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdragdroped
+msgid "Drag Drop editing"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdropfiles
+msgid "Drop files"
+msgstr ""
+
+#: lazarusidestrconsts:dlggroupundo
+msgid "Group Undo"
+msgstr ""
+
+#: lazarusidestrconsts:dlghalfpagescroll
+msgid "Half page scroll"
+msgstr ""
+
+#: lazarusidestrconsts:dlgkeepcaretx
+msgid "Keep caret X position"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpersistentcaret
+msgid "Persistent caret"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcaretskipsselection
+msgid "Caret skips selection"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrightmousemovescursor
+msgid "Right mouse moves caret"
+msgstr ""
+
+#: lazarusidestrconsts:dlgscrollbyoneless
+msgid "Scroll by one less"
+msgstr ""
+
+#: lazarusidestrconsts:dlgscrollpastendfile
+msgid "Scroll past end of file"
+msgstr ""
+
+#: lazarusidestrconsts:dlgscrollpastendline
+msgid "Scroll past end of line"
+msgstr ""
+
+#: lazarusidestrconsts:dlgclosebuttonsnotebook
+msgid "Show close buttons in notebook"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowscrollhint
+msgid "Show scroll hint"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmouselinks
+msgid "Mouse links"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowgutterhints
+msgid "Show gutter hints"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsmarttabs
+msgid "Smart tabs"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtabstospaces
+msgid "Tabs to spaces"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtabindent
+msgid "Tab indents blocks"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtrimtrailingspaces
+msgid "Trim trailing spaces"
+msgstr ""
+
+#: lazarusidestrconsts:dlgundoaftersave
+msgid "Undo after save"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdoubleclickline
+msgid "Double click line"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfindtextatcursor
+msgid "Find text at cursor"
+msgstr ""
+
+#: lazarusidestrconsts:dlgusesyntaxhighlight
+msgid "Use syntax highlight"
+msgstr ""
+
+#: lazarusidestrconsts:dlgusecodefolding
+msgid "Code folding"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
+msgid "Copy word on copy none"
+msgstr ""
+
+#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
+msgid "Home key jumps to nearest start"
+msgstr ""
+
+#: lazarusidestrconsts:dlgblockindent
+msgid "Block indent"
+msgstr ""
+
+#: lazarusidestrconsts:dlgundolimit
+msgid "Undo limit"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtabwidths
+msgid "Tab widths"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmargingutter
+msgid "Margin and gutter"
+msgstr ""
+
+#: lazarusidestrconsts:dlgvisiblerightmargin
+msgid "Visible right margin"
+msgstr ""
+
+#: lazarusidestrconsts:dlgvisiblegutter
+msgid "Visible gutter"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowlinenumbers
+msgid "Show line numbers"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowcompilinglinenumbers
+msgid "Show line numbers"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrightmargin
+msgid "Right margin"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrightmargincolor
+msgid "Right margin color"
+msgstr ""
+
+#: lazarusidestrconsts:dlggutterwidth
+msgid "Gutter width"
+msgstr ""
+
+#: lazarusidestrconsts:dlgguttercolor
+msgid "Gutter color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgeditorfont
+msgid "Editor font"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdefaulteditorfont
+msgid "Default editor font"
+msgstr ""
+
+#: lazarusidestrconsts:dlgeditorfontheight
+msgid "Editor font height"
+msgstr ""
+
+#: lazarusidestrconsts:dlgextralinespacing
+msgid "Extra line spacing"
+msgstr ""
+
+#: lazarusidestrconsts:dlgkeymappingscheme
+msgid "Key Mapping Scheme"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcheckconsistency
+msgid "Check consistency"
+msgstr ""
+
+#: lazarusidestrconsts:lisedoptschoosescheme
+msgid "Choose Scheme"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedhintcommand
+msgid "Hint: click on the command you want to edit"
+msgstr ""
+
+#: lazarusidestrconsts:dlglang
+msgid "Language"
+msgstr ""
+
+#: lazarusidestrconsts:dlgclrscheme
+msgid "Color Scheme"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfileexts
+msgid "File extensions"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedelement
+msgid "Element"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsetelementdefault
+msgid "Set element to default"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsetallelementdefault
+msgid "Set all elements to default"
+msgstr ""
+
+#: lazarusidestrconsts:dlgforecolor
+msgid "Foreground color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedusedefcolor
+msgid "Use default color"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtextattributes
+msgid "Text attributes"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedbold
+msgid "Bold"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedital
+msgid "Italic"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedunder
+msgid "Underline"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedidcomlet
+msgid "Identifier completion"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedcodeparams
+msgid "Code parameters"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtooltipeval
+msgid "Tooltip expression evaluation"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtooltiptools
+msgid "Tooltip symbol Tools"
+msgstr ""
+
+#: lazarusidestrconsts:dlgeddelay
+msgid "Delay"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtimesecondunit
+msgid "sec"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedcodetempl
+msgid "Code templates"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtplfname
+msgid "Template file name"
+msgstr ""
+
+#: lazarusidestrconsts:dlgedadd
+msgid "Add..."
+msgstr ""
+
+#: lazarusidestrconsts:dlgededit
+msgid "Edit..."
+msgstr ""
+
+#: lazarusidestrconsts:dlgeddelete
+msgid "Delete"
+msgstr ""
+
+#: lazarusidestrconsts:dlgindentcodeto
+msgid "Indent code to"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodetoolstab
+msgid "Code Tools"
+msgstr ""
+
+#: lazarusidestrconsts:lisautomaticfeatures
+msgid "Automatic features"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcfdividerdrawlevel
+msgid "Divider Draw Level"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodetoolsopts
+msgid "CodeTools Options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodecreation
+msgid "Code Creation"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwordspolicies
+msgid "Words"
+msgstr ""
+
+#: lazarusidestrconsts:dlglinesplitting
+msgid "Line Splitting"
+msgstr ""
+
+#: lazarusidestrconsts:dlgspacenotcosmos
+msgid "Space"
+msgstr ""
+
+#: lazarusidestrconsts:dlgidentifiercompletion
+msgid "Identifier completion"
+msgstr ""
+
+#: lazarusidestrconsts:dlgadditionalsrcpath
+msgid "Additional Source search path for all projects (.pp;.pas)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgjumpingetc
+msgid "Jumping (e.g. Method Jumping)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgadjusttopline
+msgid "Adjust top line due to comment in front"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcentercursorline
+msgid "Center Cursor Line"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcursorbeyondeol
+msgid "Cursor beyond EOL"
+msgstr ""
+
+#: lazarusidestrconsts:dlgclassinsertpolicy
+msgid "Class part insert policy"
+msgstr ""
+
+#: lazarusidestrconsts:dlgalphabetically
+msgid "Alphabetically"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtlast
+msgid "Last"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmixmethodsandproperties
+msgid "Mix methods and properties"
+msgstr ""
+
+#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
+msgid "Procedure insert policy"
+msgstr ""
+
+#: lazarusidestrconsts:dlglast
+msgid "Last (i.e. at end of source)"
+msgstr ""
+
+#: lazarusidestrconsts:dlginfrontofmethods
+msgid "In front of methods"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbehindmethods
+msgid "Behind methods"
+msgstr ""
+
+#: lazarusidestrconsts:dlgforwardprocskeeporder
+msgid "Keep order of procedures"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmethodinspolicy
+msgid "Method insert policy"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtclassorder
+msgid "Class order"
+msgstr ""
+
+#: lazarusidestrconsts:dlgkeywordpolicy
+msgid "Keyword policy"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtlower
+msgid "lowercase"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtuppercase
+msgid "UPPERCASE"
+msgstr ""
+
+#: lazarusidestrconsts:dlg1up2low
+msgid "Lowercase, first letter up"
+msgstr ""
+
+#: lazarusidestrconsts:dlgidentifierpolicy
+msgid "Identifier policy"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpropertycompletion
+msgid "Property completion"
+msgstr ""
+
+#: lazarusidestrconsts:lisheadercommentforclass
+msgid "Header comment for class"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcompleteproperties
+msgid "Complete properties"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtreadprefix
+msgid "Read prefix"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtwriteprefix
+msgid "Write prefix"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtstoredpostfix
+msgid "Stored postfix"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtvariableprefix
+msgid "Variable prefix"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsetpropertyvariable
+msgid "Set property Variable"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmaxlinelength
+msgid "Max line length:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgnotsplitlinefront
+msgid "Do not split line In front of:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgnotsplitlineafter
+msgid "Do not split line after:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcdtpreview
+msgid "Preview (Max line length = 1)"
+msgstr ""
+
+#: lazarusidestrconsts:dlginsspacefront
+msgid "Insert space in front of"
+msgstr ""
+
+#: lazarusidestrconsts:dlginsspaceafter
+msgid "Insert space after"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwrdpreview
+msgid "Preview"
+msgstr ""
+
+#: lazarusidestrconsts:dlgaddsemicolon
+msgid "Add semicolon"
+msgstr ""
+
+#: lazarusidestrconsts:dlgaddassignmentoperator
+msgid "Add assignment operator :="
+msgstr ""
+
+#: lazarusidestrconsts:locwndsrceditor
+msgid "Source Editor"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcompileroptions
+msgid "Compiler Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
+msgid "Online Help not yet implemented"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
+msgid "Right click on the items tree to get the popupmenu with all available package functions."
+msgstr ""
+
+#: lazarusidestrconsts:dlgsearchpaths
+msgid "Paths"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoparsing
+msgid "Parsing"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodegeneration
+msgid "Code"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcolinking
+msgid "Linking"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcomessages
+msgid "Messages"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoother
+msgid "Other"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoinherited
+msgid "Inherited"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcocompilation
+msgid "Compilation"
+msgstr ""
+
+#: lazarusidestrconsts:lisbrowseforcompiler
+msgid "Browse for Compiler (%s)"
+msgstr ""
+
+#: lazarusidestrconsts:lisunitoutputdirectory
+msgid "Unit Output directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisselectanode
+msgid "Select a node"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowcompileroptions
+msgid "Show compiler options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoopts
+msgid "Options: "
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoasmstyle
+msgid "Assembler style:"
+msgstr ""
+
+#: lazarusidestrconsts:lisnocompileroptionsinherited
+msgid "No compiler options inherited."
+msgstr ""
+
+#: lazarusidestrconsts:lisunitpath
+msgid "unit path"
+msgstr ""
+
+#: lazarusidestrconsts:lisincludepath
+msgid "include path"
+msgstr ""
+
+#: lazarusidestrconsts:lisobjectpath
+msgid "object path"
+msgstr ""
+
+#: lazarusidestrconsts:lislibrarypath
+msgid "library path"
+msgstr ""
+
+#: lazarusidestrconsts:lislinkeroptions
+msgid "linker options"
+msgstr ""
+
+#: lazarusidestrconsts:liscustomoptions
+msgid "custom options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoasis
+msgid "As-Is"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsyntaxoptions
+msgid "Syntax options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgassemblerdefault
+msgid "Default"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdelphi2ext
+msgid "Delphi 2 Extensions"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcocops
+msgid "C Style Operators (*=, +=, /= and -=)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgassertcode
+msgid "Include Assertion Code"
+msgstr ""
+
+#: lazarusidestrconsts:dlglabelgoto
+msgid "Allow LABEL and GOTO"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcppinline
+msgid "C++ Styled INLINE"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcmacro
+msgid "C Style Macros (global)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbp7cptb
+msgid "TP/BP 7.0 Compatible"
+msgstr ""
+
+#: lazarusidestrconsts:dlginitdoneonly
+msgid "Constructor name must be 'init' (destructor must be 'done')"
+msgstr ""
+
+#: lazarusidestrconsts:dlgstatickeyword
+msgid "Static Keyword in Objects"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdeplhicomp
+msgid "Delphi Compatible"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoansistr
+msgid "Use Ansi Strings"
+msgstr ""
+
+#: lazarusidestrconsts:dlggpccomp
+msgid "GPC (GNU Pascal Compiler) Compatible"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcounitstyle
+msgid "Unit Style:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcosmartlinkable
+msgid "Smart Linkable"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcochecks
+msgid "Checks:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcorange
+msgid "Range"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcooverflow
+msgid "Overflow"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcostack
+msgid "Stack"
+msgstr ""
+
+#: lazarusidestrconsts:dlgheapsize
+msgid "Heap Size"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcogenerate
+msgid "Generate:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgconormal
+msgid "Normal Code"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcofast
+msgid "Faster Code"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcosmaller
+msgid "Smaller Code"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtargetproc
+msgid "Target i386"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtargetplatform
+msgid "Target Platform:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgoptimiz
+msgid "Optimizations:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcokeepvarsreg
+msgid "Keep certain variables in registers"
+msgstr ""
+
+#: lazarusidestrconsts:dlguncertopt
+msgid "Uncertain Optimizations"
+msgstr ""
+
+#: lazarusidestrconsts:dlglevelnoneopt
+msgid "Level 0 (no extra Optimizations)"
+msgstr ""
+
+#: lazarusidestrconsts:dlglevel1opt
+msgid "Level 1 (quick and debugger friendly)"
+msgstr ""
+
+#: lazarusidestrconsts:dlglevel2opt
+msgid "Level 2 (Level 1 + quick optimizations)"
+msgstr ""
+
+#: lazarusidestrconsts:dlglevel3opt
+msgid "Level 3 (Level 2 + slow optimizations)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtargetos
+msgid "Target OS"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtargetcpu
+msgid "Target CPU"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodebugging
+msgid "Debugging:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcogdb
+msgid "Generate Debugging Info For GDB (Slows Compiling)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodbx
+msgid "Generate Debugging Info For DBX (Slows Compiling)"
+msgstr ""
+
+#: lazarusidestrconsts:dlglnumsbct
+msgid "Display Line Numbers in Run-time Error Backtraces"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoheaptrc
+msgid "Use Heaptrc Unit"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcovalgrind
+msgid "Generate code for valgrind"
+msgstr ""
+
+#: lazarusidestrconsts:dlggprof
+msgid "Generate code for gprof"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcostrip
+msgid "Strip Symbols From Executable"
+msgstr ""
+
+#: lazarusidestrconsts:dlglinklibraries
+msgid "Link Style:"
+msgstr ""
+
+#: lazarusidestrconsts:dlglinksmart
+msgid "Link Smart"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpassoptslinker
+msgid "Pass Options To The Linker (Delimiter is space)"
+msgstr ""
+
+#: lazarusidestrconsts:liscotargetosspecificoptions
+msgid "Target OS specific options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwin32guiapp
+msgid "Win32 gui application"
+msgstr ""
+
+#: lazarusidestrconsts:dlgverbosity
+msgid "Verbosity during compilation:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoshowerr
+msgid "Show Errors"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowwarnings
+msgid "Show Warnings"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshownotes
+msgid "Show Notes"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowhint
+msgid "Show Hints"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowgeneralinfo
+msgid "Show general info"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowprocserror
+msgid "Show all procs on error"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshoweverything
+msgid "Show everything"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowsummary
+msgid "Show summary"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowdebuginfo
+msgid "Show debug info"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowusedfiles
+msgid "Show used files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowtriedfiles
+msgid "Show tried files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowdefinedmacros
+msgid "Show defined macros"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowcompiledprocedures
+msgid "Show compiled procedures"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowconditionals
+msgid "Show conditionals"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshowexecutableinfo
+msgid "Show executable info (Win32 only)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgshownothing
+msgid "Show nothing (only errors)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwritefpclogo
+msgid "Write an FPC logo"
+msgstr ""
+
+#: lazarusidestrconsts:dlghintsunused
+msgid "Show Hints for unused units in main source"
+msgstr ""
+
+#: lazarusidestrconsts:dlghintsparametersendernotused
+msgid "Show Hints for parameter \"Sender\" not used"
+msgstr ""
+
+#: lazarusidestrconsts:dlgconfigfiles
+msgid "Config Files:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgusefpccfg
+msgid "Use standard Compiler Config File (fpc.cfg)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgusecustomconfig
+msgid "Use addional Compiler Config File"
+msgstr ""
+
+#: lazarusidestrconsts:liscustomoptions2
+msgid "Custom options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgstopafternrerr
+msgid "Stop after number of errors:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgotherunitfiles
+msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoincfiles
+msgid "Include Files (-Fi):"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcosources
+msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcolibraries
+msgid "Libraries (-Fl):"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcodebugpath
+msgid "Debugger path addition (none):"
+msgstr ""
+
+#: lazarusidestrconsts:liscompiler
+msgid "Compiler"
+msgstr ""
+
+#: lazarusidestrconsts:listofpcpath
+msgid "Path:"
+msgstr ""
+
+#: lazarusidestrconsts:liscoskipcallingcompiler
+msgid "Skip calling Compiler"
+msgstr ""
+
+#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
+msgid "Ambiguous additional compiler config file"
+msgstr ""
+
+#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
+msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
+msgstr ""
+
+#: lazarusidestrconsts:liscoclickokifaresuretodothat
+msgid "%s%sClick OK if you are sure to do that."
+msgstr ""
+
+#: lazarusidestrconsts:liscocallon
+msgid "Call on:"
+msgstr ""
+
+#: lazarusidestrconsts:liscocalloncompile
+msgid "Compile"
+msgstr ""
+
+#: lazarusidestrconsts:liscocallonbuild
+msgid "Build"
+msgstr ""
+
+#: lazarusidestrconsts:liscocallonrun
+msgid "Run"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcocreatemakefile
+msgid "Create Makefile"
+msgstr ""
+
+#: lazarusidestrconsts:liscoexecuteafter
+msgid "Execute after"
+msgstr ""
+
+#: lazarusidestrconsts:liscoexecutebefore
+msgid "Execute before"
+msgstr ""
+
+#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
+msgid "Additional compiler options inherited from packages"
+msgstr ""
+
+#: lazarusidestrconsts:liscocommand
+msgid "Command:"
+msgstr ""
+
+#: lazarusidestrconsts:liscoscanforfpcmessages
+msgid "Scan for FPC messages"
+msgstr ""
+
+#: lazarusidestrconsts:liscoscanformakemessages
+msgid "Scan for Make messages"
+msgstr ""
+
+#: lazarusidestrconsts:liscoshowallmessages
+msgid "Show all messages"
+msgstr ""
+
+#: lazarusidestrconsts:dlgunitoutp
+msgid "Unit output directory (-FU):"
+msgstr ""
+
+#: lazarusidestrconsts:liscodefault
+msgid "default (%s)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgbutapply
+msgid "Apply"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoshowoptions
+msgid "Show Options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcoloadsave
+msgid "Load/Save"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmainviewforms
+msgid "View project forms"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmainviewunits
+msgid "View project units"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmultiselect
+msgid "Multi Select"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccocaption
+msgid "Checking compiler options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotest
+msgid "Test"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccoresults
+msgid "Results"
+msgstr ""
+
+#: lazarusidestrconsts:lisccocopyoutputtocliboard
+msgid "Copy output to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:lisccocontains
+msgid "contains "
+msgstr ""
+
+#: lazarusidestrconsts:lisccospaces
+msgid "spaces"
+msgstr ""
+
+#: lazarusidestrconsts:lisccospecialcharacters
+msgid "special characters"
+msgstr ""
+
+#: lazarusidestrconsts:lisccononascii
+msgid "non ASCII"
+msgstr ""
+
+#: lazarusidestrconsts:lisccowrongpathdelimiter
+msgid "wrong path delimiter"
+msgstr ""
+
+#: lazarusidestrconsts:lisccounusualchars
+msgid "unusual characters"
+msgstr ""
+
+#: lazarusidestrconsts:lisccohasnewline
+msgid "new line symbols"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoinvalidsearchpath
+msgid "Invalid search path"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoskip
+msgid "Skip"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestcheckingcompiler
+msgid "Test: Checking compiler ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisccoinvalidcompiler
+msgid "Invalid compiler"
+msgstr ""
+
+#: lazarusidestrconsts:lisccocompilernotanexe
+msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoambiguouscompiler
+msgid "Ambiguous compiler"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoseveralcompilers
+msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
+msgid "Test: Checking fpc configs ..."
+msgstr ""
+
+#: lazarusidestrconsts:liscconocfgfound
+msgid "no fpc.cfg found"
+msgstr ""
+
+#: lazarusidestrconsts:lisccomultiplecfgfound
+msgid "multiple compiler configs found: "
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestcompilingemptyfile
+msgid "Test: Compiling an empty file ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisccoinvalidtestdir
+msgid "Invalid Test Directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisccochecktestdir
+msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
+msgstr ""
+
+#: lazarusidestrconsts:lisccounabletocreatetestfile
+msgid "Unable to create Test File"
+msgstr ""
+
+#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
+msgid "Unable to create Test pascal file \"%s\"."
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
+msgid "Test: Compiling an empty file"
+msgstr ""
+
+#: lazarusidestrconsts:lisccorelunitpathfoundincfg
+msgid "relative unit path found in fpc cfg: %s"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
+msgid "Test: Checking compiler configuration ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisccoenglishmessagefilemissing
+msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
+msgstr ""
+
+#: lazarusidestrconsts:lisccomsgppunotfound
+msgid "compiled FPC unit not found: %s.ppu"
+msgstr ""
+
+#: lazarusidestrconsts:lisccomissingunit
+msgid "Missing unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoppunotfounddetailed
+msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestmissingppu
+msgid "Test: Checking missing fpc ppu ..."
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestcompilerdate
+msgid "Test: Checking compiler date ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisccoerrorcaption
+msgid "Error"
+msgstr ""
+
+#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
+msgid "This method can not be overridden because it is defined in the current class"
+msgstr ""
+
+#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
+msgid "%s is an abstract class, it has %s abstract methods."
+msgstr ""
+
+#: lazarusidestrconsts:lissamabstractmethodsof
+msgid "Abstract methods of %s"
+msgstr ""
+
+#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
+msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
+msgstr ""
+
+#: lazarusidestrconsts:lissamnoabstractmethodsfound
+msgid "No abstract methods found"
+msgstr ""
+
+#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
+msgid "Cursor is not in a class declaration"
+msgstr ""
+
+#: lazarusidestrconsts:lissamideisbusy
+msgid "IDE is busy"
+msgstr ""
+
+#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
+msgid "There are no abstract methods left to override."
+msgstr ""
+
+#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
+msgid "Unable to show abstract methods of the current class, because"
+msgstr ""
+
+#: lazarusidestrconsts:lisccounabletogetfiledate
+msgid "Unable to get file date of %s."
+msgstr ""
+
+#: lazarusidestrconsts:lisccowarningcaption
+msgid "Warning"
+msgstr ""
+
+#: lazarusidestrconsts:lisccodatesdiffer
+msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoppuolderthancompiler
+msgid "There is a .ppu file older than the compiler itself:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisccoppuexiststwice
+msgid "ppu exists twice: %s, %s"
+msgstr ""
+
+#: lazarusidestrconsts:dlgccotestsrcinppupaths
+msgid "Test: Checking sources in fpc ppu search paths ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisccofpcunitpathhassource
+msgid "FPC unit path contains a source: "
+msgstr ""
+
+#: lazarusidestrconsts:lisccotestssuccess
+msgid "All tests succeeded."
+msgstr ""
+
+#: lazarusidestrconsts:lisccowarningmsg
+msgid "WARNING: "
+msgstr ""
+
+#: lazarusidestrconsts:lisccohintmsg
+msgid "HINT: "
+msgstr ""
+
+#: lazarusidestrconsts:lisccoerrormsg
+msgid "ERROR: "
+msgstr ""
+
+#: lazarusidestrconsts:dlgcommandlineparameters
+msgid "Command line parameters"
+msgstr ""
+
+#: lazarusidestrconsts:dlgprojectoptions
+msgid "Project Options"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpoapplication
+msgid "Application"
+msgstr ""
+
+#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
+msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:dlgpofroms
+msgid "Forms"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpomisc
+msgid "Miscellaneous"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpoi18n
+msgid "i18n"
+msgstr ""
+
+#: lazarusidestrconsts:rsenablei18n
+msgid "Enable i18n"
+msgstr ""
+
+#: lazarusidestrconsts:rsi18noptions
+msgid "i18n Options"
+msgstr ""
+
+#: lazarusidestrconsts:rspooutputdirectory
+msgid "PO Output Directory:"
+msgstr ""
+
+#: lazarusidestrconsts:rsincludeversioninfoinexecutable
+msgid "Include Version Info in executable"
+msgstr ""
+
+#: lazarusidestrconsts:rsversionnumbering
+msgid "Version numbering"
+msgstr ""
+
+#: lazarusidestrconsts:rsversion
+msgid "Version:"
+msgstr ""
+
+#: lazarusidestrconsts:rsmajorrevision
+msgid "Major revision:"
+msgstr ""
+
+#: lazarusidestrconsts:rsminorrevision
+msgid "Minor revision:"
+msgstr ""
+
+#: lazarusidestrconsts:rsbuild
+msgid "Build:"
+msgstr ""
+
+#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
+msgid "Automatically increase build number"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageoptions
+msgid "Language options"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageselection
+msgid "Language selection:"
+msgstr ""
+
+#: lazarusidestrconsts:rscharacterset
+msgid "Character set:"
+msgstr ""
+
+#: lazarusidestrconsts:rsotherinfo
+msgid "Other info"
+msgstr ""
+
+#: lazarusidestrconsts:rscopyright
+msgid "Copyright:"
+msgstr ""
+
+#: lazarusidestrconsts:rsadditionalinfo
+msgid "Additional info"
+msgstr ""
+
+#: lazarusidestrconsts:dlgposavesession
+msgid "Session"
+msgstr ""
+
+#: lazarusidestrconsts:dlgapplicationsettings
+msgid "Application Settings"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpotitle
+msgid "Title:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpooutputsettings
+msgid "Output Settings"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpotargetfilename
+msgid "Target file name:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpouseappbundle
+msgid "Use Application Bundle for running and debugging (darwin only)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpousemanifest
+msgid "Use manifest file to enable themes (windows only)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautocreateforms
+msgid "Auto-create forms:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgavailableforms
+msgid "Available forms:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgautocreatenewforms
+msgid "When creating new forms, add them to auto-created forms"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsaveeditorinfo
+msgid "Save editor info for closed files"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsaveeditorinfoproject
+msgid "Save editor info only for project files"
+msgstr ""
+
+#: lazarusidestrconsts:lismainunitispascalsource
+msgid "Main Unit is Pascal Source"
+msgstr ""
+
+#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
+msgid "Main Unit has Uses Section containing all Units of project"
+msgstr ""
+
+#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
+msgid "Main Unit has Application.CreateForm statements"
+msgstr ""
+
+#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
+msgid "Main Unit has Application.Title statements"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojectisrunnable
+msgid "Project is runnable"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
+msgid "Always build (even if nothing changed)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunparameters
+msgid "Run parameters"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunolocal
+msgid "Local"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunoenvironment
+msgid "Environment"
+msgstr ""
+
+#: lazarusidestrconsts:dlghostapplication
+msgid "Host application"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcommandlineparams
+msgid "Command line parameters (without application name)"
+msgstr ""
+
+#: lazarusidestrconsts:dlguselaunchingapp
+msgid "Use launching application"
+msgstr ""
+
+#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
+msgid "Launching application"
+msgstr ""
+
+#: lazarusidestrconsts:dlgroworkingdirectory
+msgid "Working directory"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunodisplay
+msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunousedisplay
+msgid "Use display"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunosystemvariables
+msgid "System variables"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunovariable
+msgid "Variable"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunovalue
+msgid "Value"
+msgstr ""
+
+#: lazarusidestrconsts:dlgrunouseroverrides
+msgid "User overrides"
+msgstr ""
+
+#: lazarusidestrconsts:dlgincludesystemvariables
+msgid "Include system variables"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdirectorydoesnotexist
+msgid "Directory does not exist"
+msgstr ""
+
+#: lazarusidestrconsts:lisrunparamsfilenotexecutable
+msgid "File not executable"
+msgstr ""
+
+#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
+msgid "The host application %s%s%s is not executable."
+msgstr ""
+
+#: lazarusidestrconsts:dlgthedirectory
+msgid "The directory \""
+msgstr ""
+
+#: lazarusidestrconsts:dlgdoesnotexist
+msgid "\" does not exist."
+msgstr ""
+
+#: lazarusidestrconsts:dlgtexttofing
+msgid "&Text to Find"
+msgstr ""
+
+#: lazarusidestrconsts:dlgreplacewith
+msgid "&Replace With"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfropts
+msgid "Options"
+msgstr ""
+
+#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
+msgid "When this file is active in source editor ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
+msgid "On build project execute the Build File command instead"
+msgstr ""
+
+#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
+msgid "On run project execute the Run File command instead"
+msgstr ""
+
+#: lazarusidestrconsts:liscefilter
+msgid "(Filter)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgcasesensitive
+msgid "&Case Sensitive"
+msgstr ""
+
+#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
+msgid "Distinguish big and small letters e.g. A and a"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwholewordsonly
+msgid "&Whole Words Only"
+msgstr ""
+
+#: lazarusidestrconsts:lisonlysearchforwholewords
+msgid "Only search for whole words"
+msgstr ""
+
+#: lazarusidestrconsts:dlgregularexpressions
+msgid "&Regular Expressions"
+msgstr ""
+
+#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
+msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
+msgstr ""
+
+#: lazarusidestrconsts:dlgmultiline
+msgid "&Multiline"
+msgstr ""
+
+#: lazarusidestrconsts:lisallowsearchingformultiplelines
+msgid "Allow searching for multiple lines"
+msgstr ""
+
+#: lazarusidestrconsts:dlgpromptonreplace
+msgid "&Prompt On Replace"
+msgstr ""
+
+#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
+msgid "Ask before replacing each found text"
+msgstr ""
+
+#: lazarusidestrconsts:dlgsrorigin
+msgid "Origin"
+msgstr ""
+
+#: lazarusidestrconsts:lispldexists
+msgid "Exists"
+msgstr ""
+
+#: lazarusidestrconsts:dlgfromcursor
+msgid "&From Cursor"
+msgstr ""
+
+#: lazarusidestrconsts:dlgentirescope
+msgid "&Entire Scope"
+msgstr ""
+
+#: lazarusidestrconsts:dlgscope
+msgid "Scope"
+msgstr ""
+
+#: lazarusidestrconsts:liswithrequiredpackages
+msgid "With required packages"
+msgstr ""
+
+#: lazarusidestrconsts:lislevels
+msgid "Levels"
+msgstr ""
+
+#: lazarusidestrconsts:lisshowpackages
+msgid "Show packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisshowunits
+msgid "Show units"
+msgstr ""
+
+#: lazarusidestrconsts:lisshowidentifiers
+msgid "Show identifiers"
+msgstr ""
+
+#: lazarusidestrconsts:lisfilter
+msgid "Filter"
+msgstr ""
+
+#: lazarusidestrconsts:lisprivate
+msgid "Private"
+msgstr ""
+
+#: lazarusidestrconsts:lisprotected
+msgid "Protected"
+msgstr ""
+
+#: lazarusidestrconsts:lisexpandallpackages
+msgid "Expand all packages"
+msgstr ""
+
+#: lazarusidestrconsts:liscollapseallpackages
+msgid "Collapse all packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisexpandallunits
+msgid "Expand all units"
+msgstr ""
+
+#: lazarusidestrconsts:liscollapseallunits
+msgid "Collapse all units"
+msgstr ""
+
+#: lazarusidestrconsts:lisexpandallclasses
+msgid "Expand all classes"
+msgstr ""
+
+#: lazarusidestrconsts:liscollapseallclasses
+msgid "Collapse all classes"
+msgstr ""
+
+#: lazarusidestrconsts:lisexport
+msgid "Export ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisbegins
+msgid "begins"
+msgstr ""
+
+#: lazarusidestrconsts:lisidentifierbeginswith
+msgid "Identifier begins with ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisunitnamebeginswith
+msgid "Unit name begins with ..."
+msgstr ""
+
+#: lazarusidestrconsts:lispackagenamebeginswith
+msgid "Package name begins with ..."
+msgstr ""
+
+#: lazarusidestrconsts:liscontains
+msgid "contains"
+msgstr ""
+
+#: lazarusidestrconsts:lisidentifiercontains
+msgid "Identifier contains ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisunitnamecontains
+msgid "Unit name contains ..."
+msgstr ""
+
+#: lazarusidestrconsts:lispackagenamecontains
+msgid "Package name contains ..."
+msgstr ""
+
+#: lazarusidestrconsts:lisfriincurrentunit
+msgid "in current unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisfriinmainproject
+msgid "in main project"
+msgstr ""
+
+#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
+msgid "in project/package owning current unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
+msgid "in all open packages and projects"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrirenameallreferences
+msgid "Rename all References"
+msgstr ""
+
+#: lazarusidestrconsts:dlgglobal
+msgid "&Global"
+msgstr ""
+
+#: lazarusidestrconsts:lisplduser
+msgid "User"
+msgstr ""
+
+#: lazarusidestrconsts:dlgselectedtext
+msgid "&Selected Text"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdirection
+msgid "Direction"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrforwardsearch
+msgid "&Forward search"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrbackwardsearch
+msgid "&Backward search"
+msgstr ""
+
+#: lazarusidestrconsts:dlgupword
+msgid "Up"
+msgstr ""
+
+#: lazarusidestrconsts:dlgdownword
+msgid "Down"
+msgstr ""
+
+#: lazarusidestrconsts:dlgreplaceall
+msgid "Replace &All"
+msgstr ""
+
+#: lazarusidestrconsts:dlggetposition
+msgid "Get position"
+msgstr ""
+
+#: lazarusidestrconsts:dlgleftpos
+msgid "Left:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgwidthpos
+msgid "Width:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgtoppos
+msgid "Top:"
+msgstr ""
+
+#: lazarusidestrconsts:dlgheightpos
+msgid "Height:"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwpusewindowmanagersetting
+msgid "Use windowmanager setting"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwpdefault
+msgid "Default"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwprestorewindowgeometry
+msgid "Restore window geometry"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwpdocked
+msgid "Docked"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwpcustomposition
+msgid "Custom position"
+msgstr ""
+
+#: lazarusidestrconsts:rsiwprestorewindowsize
+msgid "Restore window size"
+msgstr ""
+
+#: lazarusidestrconsts:liscodeexplorer
+msgid "Code Explorer"
+msgstr ""
+
+#: lazarusidestrconsts:uemfinddeclaration
+msgid "&Find Declaration"
+msgstr ""
+
+#: lazarusidestrconsts:uemopenfileatcursor
+msgid "&Open file at cursor"
+msgstr ""
+
+#: lazarusidestrconsts:uemprocedurejump
+msgid "Procedure Jump"
+msgstr ""
+
+#: lazarusidestrconsts:uemclosepage
+msgid "&Close Page"
+msgstr ""
+
+#: lazarusidestrconsts:uemcut
+msgid "Cut"
+msgstr ""
+
+#: lazarusidestrconsts:uemcopy
+msgid "Copy"
+msgstr ""
+
+#: lazarusidestrconsts:uempaste
+msgid "Paste"
+msgstr ""
+
+#: lazarusidestrconsts:uemcopyfilename
+msgid "Copy filename"
+msgstr ""
+
+#: lazarusidestrconsts:uemgotobookmark
+msgid "&Goto Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:uemsetfreebookmark
+msgid "Set a free Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:uemnextbookmark
+msgid "Goto next Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:uemprevbookmark
+msgid "Goto previous Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:uembookmarkn
+msgid "Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:lisopenlfm
+msgid "Open %s"
+msgstr ""
+
+#: lazarusidestrconsts:uemsetbookmark
+msgid "&Set Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:uemreadonly
+msgid "Read Only"
+msgstr ""
+
+#: lazarusidestrconsts:uemshowlinenumbers
+msgid "Show Line Numbers"
+msgstr ""
+
+#: lazarusidestrconsts:uemshowunitinfo
+msgid "Unit Info"
+msgstr ""
+
+#: lazarusidestrconsts:uemdebugword
+msgid "Debug"
+msgstr ""
+
+#: lazarusidestrconsts:uemaddbreakpoint
+msgid "&Add Breakpoint"
+msgstr ""
+
+#: lazarusidestrconsts:uemaddwatchatcursor
+msgid "Add &Watch At Cursor"
+msgstr ""
+
+#: lazarusidestrconsts:uemruntocursor
+msgid "&Run to Cursor"
+msgstr ""
+
+#: lazarusidestrconsts:uemviewcallstack
+msgid "View Call Stack"
+msgstr ""
+
+#: lazarusidestrconsts:uemmoveeditorleft
+msgid "Move Editor Left"
+msgstr ""
+
+#: lazarusidestrconsts:uemmoveeditorright
+msgid "Move Editor Right"
+msgstr ""
+
+#: lazarusidestrconsts:uemrefactor
+msgid "Refactoring"
+msgstr ""
+
+#: lazarusidestrconsts:uemcompletecode
+msgid "Complete Code"
+msgstr ""
+
+#: lazarusidestrconsts:uemencloseselection
+msgid "Enclose Selection"
+msgstr ""
+
+#: lazarusidestrconsts:uemextractproc
+msgid "Extract Procedure"
+msgstr ""
+
+#: lazarusidestrconsts:ueminvertassignment
+msgid "Invert Assignment"
+msgstr ""
+
+#: lazarusidestrconsts:uemfindidentifierreferences
+msgid "Find Identifier References"
+msgstr ""
+
+#: lazarusidestrconsts:uemrenameidentifier
+msgid "Rename Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:uemeditorproperties
+msgid "Editor properties"
+msgstr ""
+
+#: lazarusidestrconsts:uenotimplcap
+msgid "Not implemented yet"
+msgstr ""
+
+#: lazarusidestrconsts:uenotimpltext
+msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
+msgstr ""
+
+#: lazarusidestrconsts:uenotimplcapagain
+msgid "I told You: Not implemented yet"
+msgstr ""
+
+#: lazarusidestrconsts:uefilerocap
+msgid "File is readonly"
+msgstr ""
+
+#: lazarusidestrconsts:uefilerotext1
+msgid "The file \""
+msgstr ""
+
+#: lazarusidestrconsts:uefilerotext2
+msgid "\" is not writable."
+msgstr ""
+
+#: lazarusidestrconsts:uemodified
+msgid "Modified"
+msgstr ""
+
+#: lazarusidestrconsts:uepreadonly
+msgid "Readonly"
+msgstr ""
+
+#: lazarusidestrconsts:uepins
+msgid "INS"
+msgstr ""
+
+#: lazarusidestrconsts:uepovr
+msgid "OVR"
+msgstr ""
+
+#: lazarusidestrconsts:lisuefontwith
+msgid "Font without UTF-8"
+msgstr ""
+
+#: lazarusidestrconsts:lisuethecurre
+msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
+msgstr ""
+
+#: lazarusidestrconsts:lisuedonotsho
+msgid "Do not show this message again."
+msgstr ""
+
+#: lazarusidestrconsts:ueminserttodo
+msgid "Insert Todo"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidmultiselection
+msgid "Invalid multiselection"
+msgstr ""
+
+#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
+msgid "Unable convert binary stream to text"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletostreamselectedcomponents
+msgid "Unable to stream selected components"
+msgstr ""
+
+#: lazarusidestrconsts:liscannotcopytoplevelcomponent
+msgid "Can not copy top level component."
+msgstr ""
+
+#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
+msgid "Copying a whole form is not implemented."
+msgstr ""
+
+#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
+msgid "There was an error during writing the selected component %s:%s:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
+msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
+msgid "Unable copy components to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
+msgid "There was an error while copying the component stream to clipboard:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liserrorin
+msgid "Error in %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
+msgid "There is already another component with the name %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
+msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
+msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:fdinvalidmultiselectiontext
+msgid "Multiselected components must be of a single form."
+msgstr ""
+
+#: lazarusidestrconsts:lisinvaliddelete
+msgid "Invalid delete"
+msgstr ""
+
+#: lazarusidestrconsts:listherootcomponentcannotbedeleted
+msgid "The root component can not be deleted."
+msgstr ""
+
+#: lazarusidestrconsts:fdmalignword
+msgid "Align"
+msgstr ""
+
+#: lazarusidestrconsts:fdmmirrorhorizontal
+msgid "Mirror horizontal"
+msgstr ""
+
+#: lazarusidestrconsts:fdmmirrorvertical
+msgid "Mirror vertical"
+msgstr ""
+
+#: lazarusidestrconsts:fdmscaleword
+msgid "Scale"
+msgstr ""
+
+#: lazarusidestrconsts:fdmsizeword
+msgid "Size"
+msgstr ""
+
+#: lazarusidestrconsts:fdmtaborder
+msgid "Tab order..."
+msgstr ""
+
+#: lazarusidestrconsts:fdmorder
+msgid "Order"
+msgstr ""
+
+#: lazarusidestrconsts:fdmordermovetofront
+msgid "Move to front"
+msgstr ""
+
+#: lazarusidestrconsts:fdmordermovetoback
+msgid "Move to back"
+msgstr ""
+
+#: lazarusidestrconsts:fdmorderforwardone
+msgid "Forward one"
+msgstr ""
+
+#: lazarusidestrconsts:fdmorderbackone
+msgid "Back one"
+msgstr ""
+
+#: lazarusidestrconsts:fdmdeleteselection
+msgid "Delete selection"
+msgstr ""
+
+#: lazarusidestrconsts:lischangeclass
+msgid "Change Class"
+msgstr ""
+
+#: lazarusidestrconsts:fdmsnaptogridoption
+msgid "Option: Snap to grid"
+msgstr ""
+
+#: lazarusidestrconsts:lisviewsourcelfm
+msgid "View Source (.lfm)"
+msgstr ""
+
+#: lazarusidestrconsts:fdmsaveformasxml
+msgid "Save form as xml"
+msgstr ""
+
+#: lazarusidestrconsts:fdmsnaptoguidelinesoption
+msgid "Option: Snap to guide lines"
+msgstr ""
+
+#: lazarusidestrconsts:fdmshowoptions
+msgid "Show Options for form editing"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeditkeys
+msgid "Edit Keys"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcommand
+msgid "Command:"
+msgstr ""
+
+#: lazarusidestrconsts:srkmconflic
+msgid "Conflict "
+msgstr ""
+
+#: lazarusidestrconsts:srkmconflicw
+msgid " conflicts with "
+msgstr ""
+
+#: lazarusidestrconsts:srkmcommand1
+msgid "    command1 \""
+msgstr ""
+
+#: lazarusidestrconsts:srkmcommand2
+msgid "    command2 \""
+msgstr ""
+
+#: lazarusidestrconsts:srkmeditforcmd
+msgid "Edit keys for command"
+msgstr ""
+
+#: lazarusidestrconsts:srkmkey
+msgid "Key (or 2 keys combination)"
+msgstr ""
+
+#: lazarusidestrconsts:srkmgrabkey
+msgid "Grab key"
+msgstr ""
+
+#: lazarusidestrconsts:srkmgrabsecondkey
+msgid "Grab second key"
+msgstr ""
+
+#: lazarusidestrconsts:srkmpresskey
+msgid "Please press a key ..."
+msgstr ""
+
+#: lazarusidestrconsts:srkmalternkey
+msgid "Alternative key (or 2 keys combination)"
+msgstr ""
+
+#: lazarusidestrconsts:srkmalreadyconnected
+msgid " The key \"%s\" is already connected to \"%s\"."
+msgstr ""
+
+#: lazarusidestrconsts:srkmecwordleft
+msgid "Move cursor word left"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecwordright
+msgid "Move cursor word right"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeclinestart
+msgid "Move cursor to line start"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeclineend
+msgid "Move cursor to line end"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpageup
+msgid "Move cursor up one page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpagedown
+msgid "Move cursor down one page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpageleft
+msgid "Move cursor left one page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpageright
+msgid "Move cursor right one page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpagetop
+msgid "Move cursor to top of page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpagebottom
+msgid "Move cursor to bottom of page"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeceditortop
+msgid "Move cursor to absolute beginning"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeceditorbottom
+msgid "Move cursor to absolute end"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecgotoxy
+msgid "Goto XY"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselleft
+msgid "SelLeft"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselright
+msgid "SelRight"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselup
+msgid "Select Up"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecseldown
+msgid "Select Down"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselwordleft
+msgid "Select Word Left"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselwordright
+msgid "Select Word Right"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecsellinestart
+msgid "Select Line Start"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecsellineend
+msgid "Select Line End"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpageup
+msgid "Select Page Up"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpagedown
+msgid "Select Page Down"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpageleft
+msgid "Select Page Left"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpageright
+msgid "Select Page Right"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpagetop
+msgid "Select Page Top"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselpagebottom
+msgid "Select Page Bottom"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecseleditortop
+msgid "Select to absolute beginning"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecseleditorbottom
+msgid "Select to absolute end"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselgotoxy
+msgid "Select Goto XY"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselectall
+msgid "Select All"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeletelastchar
+msgid "Delete Last Char"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeletechar
+msgid "Delete char at cursor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeleteword
+msgid "Delete to end of word"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeletelastword
+msgid "Delete to start of word"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeletebol
+msgid "Delete to beginning of line"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeleteeol
+msgid "Delete to end of line"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecdeleteline
+msgid "Delete current line"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecclearall
+msgid "Delete whole text"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeclinebreak
+msgid "Break line and move cursor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertline
+msgid "Break line, leave cursor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecchar
+msgid "Char"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecimestr
+msgid "Ime Str"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccut
+msgid "Cut selection to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccopy
+msgid "Copy selection to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpaste
+msgid "Paste clipboard to current position"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecscrollup
+msgid "Scroll up one line"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecscrolldown
+msgid "Scroll down one line"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecscrollleft
+msgid "Scroll left one char"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecscrollright
+msgid "Scroll right one char"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertmode
+msgid "Insert Mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecoverwritemode
+msgid "Overwrite Mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglemode
+msgid "Toggle Mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecblockindent
+msgid "Indent block"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecblockunindent
+msgid "Unindent block"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecshifttab
+msgid "Shift Tab"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecmatchbracket
+msgid "Go to matching bracket"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecnormalselect
+msgid "Normal selection mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccolumnselect
+msgid "Column selection mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeclineselect
+msgid "Line selection mode"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecautocompletion
+msgid "Code template completion"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecuserfirst
+msgid "User First"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecsetfreebookmark
+msgid "Set a free Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecprevbookmark
+msgid "Previous Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecnextbookmark
+msgid "Next Bookmark"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker0
+msgid "Go to marker 0"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker1
+msgid "Go to marker 1"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker2
+msgid "Go to marker 2"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker3
+msgid "Go to marker 3"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker4
+msgid "Go to marker 4"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker5
+msgid "Go to marker 5"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker6
+msgid "Go to marker 6"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker7
+msgid "Go to marker 7"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker8
+msgid "Go to marker 8"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotomarker9
+msgid "Go to marker 9"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker0
+msgid "Set marker 0"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker1
+msgid "Set marker 1"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker2
+msgid "Set marker 2"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker3
+msgid "Set marker 3"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker4
+msgid "Set marker 4"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker5
+msgid "Set marker 5"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker6
+msgid "Set marker 6"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker7
+msgid "Set marker 7"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker8
+msgid "Set marker 8"
+msgstr ""
+
+#: lazarusidestrconsts:liskmsetmarker9
+msgid "Set marker 9"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecgotomarker
+msgid "Go to Marker %d"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecsetmarker
+msgid "Set Marker %d"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecjumptoeditor
+msgid "Focus to source editor"
+msgstr ""
+
+#: lazarusidestrconsts:liskmtogglebetweenunitandform
+msgid "Toggle between Unit and Form"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecnexteditor
+msgid "Go to next editor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpreveditor
+msgid "Go to prior editor"
+msgstr ""
+
+#: lazarusidestrconsts:liskmaddbreakpoint
+msgid "Add break point"
+msgstr ""
+
+#: lazarusidestrconsts:liskmremovebreakpoint
+msgid "Remove break point"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecmoveeditorleft
+msgid "Move editor left"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecmoveeditorright
+msgid "Move editor right"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor1
+msgid "Go to source editor 1"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor2
+msgid "Go to source editor 2"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor3
+msgid "Go to source editor 3"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor4
+msgid "Go to source editor 4"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor5
+msgid "Go to source editor 5"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor6
+msgid "Go to source editor 6"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor7
+msgid "Go to source editor 7"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor8
+msgid "Go to source editor 8"
+msgstr ""
+
+#: lazarusidestrconsts:liskmgotosourceeditor9
+msgid "Go to source editor 9"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecgotoeditor
+msgid "Go to editor %d"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecselectiontabs2spaces
+msgid "Convert tabs to spaces in selection"
+msgstr ""
+
+#: lazarusidestrconsts:liskmencloseselection
+msgid "Enclose selection"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcharacter
+msgid "Insert from Charactermap"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertgplnotice
+msgid "Insert GPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertlgplnotice
+msgid "Insert LGPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
+msgid "Insert modified LGPL notice"
+msgstr ""
+
+#: lazarusidestrconsts:liskminsertusername
+msgid "Insert username"
+msgstr ""
+
+#: lazarusidestrconsts:liskminsertdateandtime
+msgid "Insert date and time"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertusername
+msgid "Insert current username"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertdatetime
+msgid "Insert current date and time"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertchangelogentry
+msgid "Insert ChangeLog entry"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsauthor
+msgid "Insert CVS keyword Author"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsdate
+msgid "Insert CVS keyword Date"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsheader
+msgid "Insert CVS keyword Header"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsid
+msgid "Insert CVS keyword ID"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvslog
+msgid "Insert CVS keyword Log"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsname
+msgid "Insert CVS keyword Name"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvsrevision
+msgid "Insert CVS keyword Revision"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertcvssource
+msgid "Insert CVS keyword Source"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinsertguid
+msgid "Insert a GUID"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfind
+msgid "Find text"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindnext
+msgid "Find next"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindprevious
+msgid "Find previous"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindinfiles
+msgid "Find in files"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecreplace
+msgid "Replace text"
+msgstr ""
+
+#: lazarusidestrconsts:liskmfindincremental
+msgid "Find incremental"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindproceduredefinition
+msgid "Find procedure definiton"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindproceduremethod
+msgid "Find procedure method"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecgotolinenumber
+msgid "Go to line number"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindnextwordoccurrence
+msgid "Find next word occurrence"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindprevwordoccurrence
+msgid "Find previous word occurrence"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecaddjumppoint
+msgid "Add jump point"
+msgstr ""
+
+#: lazarusidestrconsts:liskmviewjumphistory
+msgid "View jump history"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecopenfileatcursor
+msgid "Open file at cursor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecgotoincludedirective
+msgid "Go to to include directive of current include file"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecprocedurelist
+msgid "Procedure List ..."
+msgstr ""
+
+#: lazarusidestrconsts:srkmectoggleformunit
+msgid "Switch between form and unit"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectoggleobjectinsp
+msgid "View Object Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglesourceeditor
+msgid "View Source Editor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglecodeexpl
+msgid "View Code Explorer"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglelazdoc
+msgid "View Documentation Editor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglemessages
+msgid "View messages"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglesearchresults
+msgid "View Search Results"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglewatches
+msgid "View watches"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglebreakpoints
+msgid "View breakpoints"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectoggledebuggerout
+msgid "View debugger output"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglelocals
+msgid "View local variables"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglecallstack
+msgid "View call stack"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewunits
+msgid "View units"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewforms
+msgid "View forms"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewcomponents
+msgid "View components"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewunitdependencies
+msgid "View unit dependencies"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewunitinfo
+msgid "View unit information"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecviewanchoreditor
+msgid "View anchor editor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglecodebrowser
+msgid "View code browser"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectogglecomppalette
+msgid "View component palette"
+msgstr ""
+
+#: lazarusidestrconsts:srkmectoggleidespeedbtns
+msgid "View IDE speed buttons"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecwordcompletion
+msgid "Word completion"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccompletecode
+msgid "Complete code"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecshowcodecontext
+msgid "Show code context"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecextractproc
+msgid "Extract procedure"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindidentifierrefs
+msgid "Find identifier references"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecrenameidentifier
+msgid "Rename identifier"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinvertassignment
+msgid "Invert assignment"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecsyntaxcheck
+msgid "Syntax check"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecguessmisplacedifdef
+msgid "Guess misplaced $IFDEF"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfinddeclaration
+msgid "Find declaration"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindblockotherend
+msgid "Find block other end"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecfindblockstart
+msgid "Find block start"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecshowabstractmethods
+msgid "Show abstract methods"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecbuild
+msgid "build program/project"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecbuildall
+msgid "build all files of program/project"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecquickcompile
+msgid "quick compile, no linking"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecabortbuild
+msgid "abort build"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecrun
+msgid "run program"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecpause
+msgid "pause program"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecstopprogram
+msgid "stop program"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecresetdebugger
+msgid "reset debugger"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecaddbreakpoint
+msgid "add break point"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecremovebreakpoint
+msgid "remove break point"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecrunparameters
+msgid "run parameters"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccompileroptions
+msgid "compiler options"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecbuildfile
+msgid "build file"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecrunfile
+msgid "run file"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecconfigbuildfile
+msgid "config build file"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecinspect
+msgid "inspect"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecevaluate
+msgid "evaluate/modify"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecaddwatch
+msgid "add watch"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecexttoolsettings
+msgid "External tools settings"
+msgstr "Nastavenie externých nástrojov"
+
+#: lazarusidestrconsts:srkmecbuildlazarus
+msgid "Build lazarus"
+msgstr "Vybudovať Lazarus"
+
+#: lazarusidestrconsts:srkmecexttool
+msgid "External tool %d"
+msgstr "Externý nástroj %d"
+
+#: lazarusidestrconsts:srkmeccustomtool
+msgid "Custom tool %d"
+msgstr "Vlastný nástroj %d"
+
+#: lazarusidestrconsts:srkmecenvironmentoptions
+msgid "General environment options"
+msgstr ""
+
+#: lazarusidestrconsts:liskmeditoroptions
+msgid "Editor options"
+msgstr "Voľby editora"
+
+#: lazarusidestrconsts:liskmeditcodetemplates
+msgid "Edit Code Templates"
+msgstr ""
+
+#: lazarusidestrconsts:liskmcodetoolsoptions
+msgid "CodeTools options"
+msgstr "Voľby CodeTools"
+
+#: lazarusidestrconsts:liskmcodetoolsdefineseditor
+msgid "CodeTools defines editor"
+msgstr ""
+
+#: lazarusidestrconsts:srkmeccodetoolsoptions
+msgid "Codetools options"
+msgstr "Voľby CodeTools"
+
+#: lazarusidestrconsts:srkmeccodetoolsdefinesed
+msgid "Codetools defines editor"
+msgstr ""
+
+#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
+msgid "Rescan FPC source directory"
+msgstr "Znova prezrieť zdrojový adresár FPC"
+
+#: lazarusidestrconsts:srkmecmakeresourcestring
+msgid "Make resource string"
+msgstr ""
+
+#: lazarusidestrconsts:liskmdiffeditorfiles
+msgid "Diff editor files"
+msgstr ""
+
+#: lazarusidestrconsts:liskmconvertdfmfiletolfm
+msgid "Convert DFM file to LFM"
+msgstr "Konvertovať súbor DFM na LFM"
+
+#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
+msgid "Convert Delphi unit to Lazarus unit"
+msgstr "Konvertovať unitu Delphi na unitu Lazarus"
+
+#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
+msgid "Convert Delphi project to Lazarus project"
+msgstr "Konvertovať projekt Delphi na projekt Lazarus"
+
+#: lazarusidestrconsts:srkmecdiff
+msgid "Diff"
+msgstr ""
+
+#: lazarusidestrconsts:srkmecunknown
+msgid "unknown editor command"
+msgstr "neznámy príkaz editora"
+
+#: lazarusidestrconsts:srvk_unknown
+msgid "Unknown"
+msgstr "Neznámy"
+
+#: lazarusidestrconsts:srvk_lbutton
+msgid "Mouse Button Left"
+msgstr "Ľavé tlačítko myši"
+
+#: lazarusidestrconsts:srvk_rbutton
+msgid "Mouse Button Right"
+msgstr "Pravé tlačítko myši"
+
+#: lazarusidestrconsts:srvk_mbutton
+msgid "Mouse Button Middle"
+msgstr "Stredné tlačítko myši"
+
+#: lazarusidestrconsts:srvk_back
+msgid "Backspace"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_tab
+msgid "Tab"
+msgstr "Tabulátor"
+
+#: lazarusidestrconsts:srvk_clear
+msgid "Clear"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_return
+msgid "Return"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_shift
+msgid "Shift"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_control
+msgid "Control"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_menu
+msgid "Menu"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_pause
+msgid "Pause key"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_capital
+msgid "Capital"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_kana
+msgid "Kana"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_junja
+msgid "Junja"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_final
+msgid "Final"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_hanja
+msgid "Hanja"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_escape
+msgid "Escape"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_convert
+msgid "Convert"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_nonconvert
+msgid "Nonconvert"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_accept
+msgid "Accept"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_modechange
+msgid "Mode Change"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_space
+msgid "Space key"
+msgstr "Medzerník"
+
+#: lazarusidestrconsts:srvk_prior
+msgid "Prior"
+msgstr "Prechádzajúci"
+
+#: lazarusidestrconsts:srvk_next
+msgid "Next"
+msgstr "Nasledujúci"
+
+#: lazarusidestrconsts:srvk_end
+msgid "End"
+msgstr "Koniec"
+
+#: lazarusidestrconsts:srvk_home
+msgid "Home"
+msgstr "Domov"
+
+#: lazarusidestrconsts:srvk_left
+msgid "Left"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_up
+msgid "Up"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_right
+msgid "Right"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_print
+msgid "Print"
+msgstr "Tlačiť"
+
+#: lazarusidestrconsts:srvk_execute
+msgid "Execute"
+msgstr "Spustiť"
+
+#: lazarusidestrconsts:srvk_snapshot
+msgid "Snapshot"
+msgstr "Snímok"
+
+#: lazarusidestrconsts:srvk_insert
+msgid "Insert"
+msgstr "Vložiť"
+
+#: lazarusidestrconsts:srvk_help
+msgid "Help"
+msgstr "Nápoveda"
+
+#: lazarusidestrconsts:srvk_lwin
+msgid "left windows key"
+msgstr "ľavá klávesa Win"
+
+#: lazarusidestrconsts:srvk_rwin
+msgid "right windows key"
+msgstr "pravá klávesa Win"
+
+#: lazarusidestrconsts:srvk_apps
+msgid "application key"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_numpad
+msgid "Numpad %d"
+msgstr "Numerická klávesa %d"
+
+#: lazarusidestrconsts:srvk_numlock
+msgid "Numlock"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_scroll
+msgid "Scroll"
+msgstr ""
+
+#: lazarusidestrconsts:srvk_irregular
+msgid "Irregular "
+msgstr "Neplatné"
+
+#: lazarusidestrconsts:srkm_alt
+msgid "Alt"
+msgstr ""
+
+#: lazarusidestrconsts:srkm_ctrl
+msgid "Ctrl"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatcursormoving
+msgid "Cursor moving commands"
+msgstr "Príkazy presunu kurzora"
+
+#: lazarusidestrconsts:srkmcatselection
+msgid "Text selection commands"
+msgstr "Príkazy výberu textu"
+
+#: lazarusidestrconsts:srkmcatediting
+msgid "Text editing commands"
+msgstr "Príkazy úpravy textu"
+
+#: lazarusidestrconsts:liskmdeletelastchar
+msgid "Delete last char"
+msgstr "Zmazať posledný znak"
+
+#: lazarusidestrconsts:srkmcatcmdcmd
+msgid "Command commands"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatsearchreplace
+msgid "Text search and replace commands"
+msgstr "Príkazy hľadania a nahrádzovania textu"
+
+#: lazarusidestrconsts:srkmcatmarker
+msgid "Text marker commands"
+msgstr "Príkazy značkovania textu"
+
+#: lazarusidestrconsts:liskmsetfreebookmark
+msgid "Set free Bookmark"
+msgstr "Nastaviť voľnú záložku"
+
+#: lazarusidestrconsts:srkmcatcodetools
+msgid "CodeTools commands"
+msgstr "Príkazy CodeTools"
+
+#: lazarusidestrconsts:srkmcatsrcnotebook
+msgid "Source Notebook commands"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatfilemenu
+msgid "File menu commands"
+msgstr "Príkazy menu Súbor"
+
+#: lazarusidestrconsts:liskmgotosourceeditor10
+msgid "Go to source editor 10"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatviewmenu
+msgid "View menu commands"
+msgstr "Príkazy menu Zobraziť"
+
+#: lazarusidestrconsts:liskmtoggleviewobjectinspector
+#, fuzzy
+msgid "Toggle view Object Inspector"
+msgstr "Prepnúť zobrazenie Object Inspector"
+
+#: lazarusidestrconsts:liskmtoggleviewsourceeditor
+msgid "Toggle view Source Editor"
+msgstr "Prepnúť zobrazenie Editora zdrojových súborov"
+
+#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
+#, fuzzy
+msgid "Toggle view Code Explorer"
+msgstr "Prepnúť zobrazenie Code Explorer"
+
+#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
+msgid "Toggle view Documentation Editor"
+msgstr "Prepnúť zobrazenie Editor dokumentácie"
+
+#: lazarusidestrconsts:liskmtoggleviewmessages
+msgid "Toggle view Messages"
+msgstr "Prepnúť zobrazenie Správy"
+
+#: lazarusidestrconsts:liskmtoggleviewsearchresults
+msgid "Toggle view Search Results"
+msgstr "Prepnúť zobrazenie Výsledky hľadania"
+
+#: lazarusidestrconsts:liskmtoggleviewwatches
+#, fuzzy
+msgid "Toggle view Watches"
+msgstr "Prepnúť zobrazenie Watches"
+
+#: lazarusidestrconsts:liskmtoggleviewbreakpoints
+msgid "Toggle view Breakpoints"
+msgstr "Prepnúť zobrazenie Body prerušenia"
+
+#: lazarusidestrconsts:liskmtoggleviewlocalvariables
+msgid "Toggle view Local Variables"
+msgstr "prepnúť zobrazenie Lokálne premenné"
+
+#: lazarusidestrconsts:liskmtoggleviewcallstack
+msgid "Toggle view Call Stack"
+msgstr "Prepnúť zobrazenie Zásobník volaní"
+
+#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
+msgid "Toggle view Debugger Output"
+msgstr "Prepnúť zobrazenie Výstup ladenia"
+
+#: lazarusidestrconsts:srkmcatprojectmenu
+msgid "Project menu commands"
+msgstr "Príkazy menu Projekt"
+
+#: lazarusidestrconsts:liskmnewproject
+msgid "New project"
+msgstr "Nový projekt"
+
+#: lazarusidestrconsts:liskmnewprojectfromfile
+msgid "New project from file"
+msgstr "Nový projekt zo súboru"
+
+#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
+msgid "Toggle view IDE speed buttons"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatrunmenu
+msgid "Run menu commands"
+msgstr "Príkazy menu Spustiť"
+
+#: lazarusidestrconsts:liskmbuildprojectprogram
+msgid "Build project/program"
+msgstr "Vybudovať projekt/program"
+
+#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
+msgid "Build all files of project/program"
+msgstr ""
+
+#: lazarusidestrconsts:liskmquickcompilenolinking
+msgid "Quick compile, no linking"
+msgstr ""
+
+#: lazarusidestrconsts:liskmabortbuilding
+msgid "Abort building"
+msgstr ""
+
+#: lazarusidestrconsts:liskmrunprogram
+msgid "Run program"
+msgstr ""
+
+#: lazarusidestrconsts:liskmpauseprogram
+msgid "Pause program"
+msgstr ""
+
+#: lazarusidestrconsts:liskmviewprojectoptions
+msgid "View project options"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatcomponentsmenu
+msgid "Components menu commands"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcattoolmenu
+msgid "Tools menu commands"
+msgstr ""
+
+#: lazarusidestrconsts:liskmexternaltoolssettings
+msgid "External Tools settings"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcatenvmenu
+msgid "Environment menu commands"
+msgstr ""
+
+#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
+msgid "Convert Delphi package to Lazarus package"
+msgstr ""
+
+#: lazarusidestrconsts:srkmcarhelpmenu
+msgid "Help menu commands"
+msgstr ""
+
+#: lazarusidestrconsts:liskeycatdesigner
+msgid "Designer commands"
+msgstr ""
+
+#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
+msgid "Copy selected Components to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
+msgid "Cut selected Components to clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
+msgid "Paste Components from clipboard"
+msgstr ""
+
+#: lazarusidestrconsts:liskeycatobjinspector
+msgid "Object Inspector commands"
+msgstr ""
+
+#: lazarusidestrconsts:liskeycatcustom
+msgid "Custom commands"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageautomatic
+msgid "Automatic (or english)"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageenglish
+msgid "English"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagegerman
+msgid "German"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagespanish
+msgid "Spanish"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagefrench
+msgid "French"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagerussian
+msgid "Russian"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagepolish
+msgid "Polish"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagepolishiso
+msgid "Polish(ISO 8859-2)"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagepolishwin
+msgid "Polish(CP1250)"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageitalian
+msgid "Italian"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagecatalan
+msgid "Catalan"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagefinnish
+msgid "Finnish"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagehebrew
+msgid "Hebrew"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagearabic
+msgid "Arabic"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageportugues
+msgid "Portuguese"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageukrainian
+msgid "Ukrainian"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagedutch
+msgid "Dutch"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagejapanese
+msgid "Japanese"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagechinese
+msgid "Chinese"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageindonesian
+msgid "Indonesian"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguageafrikaans
+msgid "Afrikaans"
+msgstr ""
+
+#: lazarusidestrconsts:rslanguagelithuanian
+msgid "Lithuanian"
+msgstr ""
+
+#: lazarusidestrconsts:dlgunitdepcaption
+msgid "Unit dependencies"
+msgstr ""
+
+#: lazarusidestrconsts:dlgunitdepbrowse
+msgid "Open"
+msgstr ""
+
+#: lazarusidestrconsts:dlgunitdeprefresh
+msgid "Refresh"
+msgstr ""
+
+#: lazarusidestrconsts:listodogoto
+msgid "Goto"
+msgstr ""
+
+#: lazarusidestrconsts:lisdocumentationeditor
+msgid "Documentation Editor"
+msgstr ""
+
+#: lazarusidestrconsts:lisconfirmlazarusrebuild
+msgid "Do you want to rebuild Lazarus?"
+msgstr ""
+
+#: lazarusidestrconsts:liscleanlazarussource
+msgid "Clean Lazarus Source"
+msgstr ""
+
+#: lazarusidestrconsts:lismakenotfound
+msgid "Make not found"
+msgstr ""
+
+#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
+msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscompileidewithoutlinking
+msgid "Compile IDE (without linking)"
+msgstr ""
+
+#: lazarusidestrconsts:lislcl
+msgid "LCL"
+msgstr ""
+
+#: lazarusidestrconsts:liscomponent
+msgid "Component"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetools
+msgid "CodeTools"
+msgstr ""
+
+#: lazarusidestrconsts:lissynedit
+msgid "SynEdit"
+msgstr ""
+
+#: lazarusidestrconsts:lisideintf
+msgid "IDE Interface"
+msgstr ""
+
+#: lazarusidestrconsts:lisjitform
+msgid "JIT Form"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgreg
+msgid "Package Registration"
+msgstr ""
+
+#: lazarusidestrconsts:liside
+msgid "IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lisstarter
+msgid "Starter"
+msgstr ""
+
+#: lazarusidestrconsts:lisexamples
+msgid "Examples"
+msgstr ""
+
+#: lazarusidestrconsts:lisconfigurebuildlazarus
+msgid "Configure %sBuild Lazarus%s"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildcleanall
+msgid "Clean all"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
+msgid "Build Components (SynEdit, CodeTools)"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildsynedit
+msgid "Build SynEdit"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildcodetools
+msgid "Build CodeTools"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildide
+msgid "Build IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildexamples
+msgid "Build Examples"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildoptions
+msgid "Options:"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildtargetos
+msgid "Target OS:"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildtargetcpu
+msgid "Target CPU:"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildtargetdirectory
+msgid "Target Directory:"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildlclinterface
+msgid "LCL interface"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildjitform
+msgid "Build JITForm"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildwithstaticpackages
+msgid "With Packages"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildrestartafterbuild
+msgid "Restart After Successfull Build"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildconfirmbuild
+msgid "Confirm Before ReBuild Lazarus"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildok
+msgid "Ok"
+msgstr ""
+
+#: lazarusidestrconsts:lisctdtemplates
+msgid "Templates"
+msgstr ""
+
+#: lazarusidestrconsts:lissavesettings
+msgid "Save Settings"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildcancel
+msgid "Cancel"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildnone
+msgid "None"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuild
+msgid "Build"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildcleanbuild
+msgid "Clean+Build"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildbuildoptions
+msgid "Build Options"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildquickbuildoptions
+msgid "Quick Build Options"
+msgstr ""
+
+#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
+msgid "Advanced Build Options"
+msgstr ""
+
+#: lazarusidestrconsts:liscompilererrorinvalidcompiler
+msgid "Error: invalid compiler: %s"
+msgstr ""
+
+#: lazarusidestrconsts:listcompilerinternalerror
+msgid "Internal compiler error! (%d)"
+msgstr ""
+
+#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
+msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
+msgstr ""
+
+#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
+msgid "NOTE: loading old codetools options file: "
+msgstr ""
+
+#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
+msgid "NOTE: codetools config file not found - using defaults"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsok
+msgid "Ok"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsnone
+msgid "None"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptskeyword
+msgid "Keyword"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsidentifier
+msgid "Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
+msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrifindreferences
+msgid "Find References"
+msgstr ""
+
+#: lazarusidestrconsts:lisfriinvalididentifier
+msgid "Invalid Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrirenameto
+msgid "Rename to"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrirename
+msgid "Rename"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrisearchincommentstoo
+msgid "Search in comments too"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrisearchwhere
+msgid "Search where"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptscolon
+msgid "Colon"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptssemicolon
+msgid "Semicolon"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptscomma
+msgid "Comma"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptspoint
+msgid "Point"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsat
+msgid "At"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsnumber
+msgid "Number"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsstringconst
+msgid "String constant"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsnewline
+msgid "Newline"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptsspace
+msgid "Space"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsoptssymbol
+msgid "Symbol"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
+msgid "CodeTools Defines Preview"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefswriteerror
+msgid "Write error"
+msgstr ""
+
+#: lazarusidestrconsts:lisstopdebugging2
+msgid "Stop debugging?"
+msgstr ""
+
+#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
+msgid "Stop current debugging and rebuild project?"
+msgstr ""
+
+#: lazarusidestrconsts:liserrorwritingpackagelisttofile
+msgid "Error writing package list to file%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
+msgid "Error while writing %s%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
+msgid "Error while writing project info file %s%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsreaderror
+msgid "Read error"
+msgstr ""
+
+#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
+msgid "Error reading package list from file%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
+msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
+msgstr ""
+
+#: lazarusidestrconsts:lislclunitpathmissing
+msgid "LCL unit path missing"
+msgstr ""
+
+#: lazarusidestrconsts:lisnotadelphiunit
+msgid "Not a Delphi unit"
+msgstr ""
+
+#: lazarusidestrconsts:listhefileisnotadelphiunit
+msgid "The file %s%s%s is not a Delphi unit."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefserrorreading
+msgid "Error reading %s%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
+msgid "Error reading project info file %s%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
+msgid "Node is readonly"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
+msgid "Auto generated nodes can not be edited."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
+msgid "Invalid previous node"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
+msgid "Previous node can not contain child nodes."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
+msgid "Create FPC Macros and paths for a fpc project directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory
+msgid "Project directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
+msgid "The Free Pascal project directory."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscompilerpath
+msgid "compiler path"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
+msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
+msgid "FPC SVN source directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
+msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
+msgid "Create Defines for Free Pascal Compiler"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
+msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
+msgid "Create Defines for Free Pascal SVN Sources"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
+msgid "The Free Pascal SVN source directory."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
+msgid "Create Defines for Lazarus Directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
+msgid "Lazarus Directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
+msgid "The Lazarus main directory."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
+msgid "Create Defines for %s Directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdirectory
+msgid "%s directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
+msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
+msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
+msgid "Create Defines for %s Project"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
+msgid "%s project directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
+msgid "The %s project directory,%swhich contains the .dpr, dpk file."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
+msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
+msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsexit
+msgid "Exit"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefssaveandexit
+msgid "Save and Exit"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
+msgid "Exit without Save"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsedit
+msgid "Edit"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
+msgid "Move node up"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
+msgid "Move node down"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
+msgid "Move node one level up"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
+msgid "Move node one level down"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
+msgid "Insert node below"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
+msgid "Insert node as child"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdeletenode
+msgid "Delete node"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsconvertnode
+msgid "Convert node"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdefine
+msgid "Define"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
+msgid "Define Recurse"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsundefine
+msgid "Undefine"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
+msgid "Undefine Recurse"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsundefineall
+msgid "Undefine All"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsblock
+msgid "Block"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
+msgid "Directory"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsif
+msgid "If"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsifdef
+msgid "IfDef"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsifndef
+msgid "IfNDef"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefselseif
+msgid "ElseIf"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefselse
+msgid "Else"
+msgstr ""
+
+#: lazarusidestrconsts:lisctdefstools
+msgid "Tools"
+msgstr ""
+
+#: lazarusidestrconsts:lisctdefsopenpreview
+msgid "Open Preview"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
+msgid "Insert Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
+msgid "Insert Free Pascal Project Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
+msgid "Insert Free Pascal Compiler Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
+msgid "Insert Free Pascal SVN Source Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
+msgid "Insert Lazarus Directory Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
+msgid "Insert Delphi 5 Compiler Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
+msgid "Insert Delphi 5 Directory Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
+msgid "Insert Delphi 5 Project Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
+msgid "Insert Delphi 6 Compiler Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
+msgid "Insert Delphi 6 Directory Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
+msgid "Insert Delphi 6 Project Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
+msgid "Insert Delphi 7 Compiler Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
+msgid "Insert Delphi 7 Directory Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
+msgid "Insert Delphi 7 Project Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
+msgid "Insert Kylix 3 Compiler Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
+msgid "Insert Kylix 3 Directory Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
+msgid "Insert Kylix 3 Project Template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsselectednode
+msgid "Selected Node:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
+msgid "Node and its children are only valid for this project"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsname
+msgid "Name:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsdescription
+msgid "Description:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsvariable
+msgid "Variable:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsvalueastext
+msgid "Value as Text"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
+msgid "Value as File Paths"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsaction
+msgid "Action: %s"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsautogenerated
+msgid "%s, auto generated"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
+msgid "%s, project specific"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsnoneselected
+msgid "none selected"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
+msgid "Invalid parent"
+msgstr ""
+
+#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
+msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
+msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
+msgid "Invalid parent node"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
+msgid "Parent node can not contain child nodes."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefsnewnode
+msgid "NewNode"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
+msgid "CodeTools Defines Editor"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetempladdcodetemplate
+msgid "Add code template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetempladd
+msgid "Add"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetempleditcodetemplate
+msgid "Edit code template"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetemplautocompleteon
+msgid "Auto complete on ..."
+msgstr ""
+
+#: lazarusidestrconsts:liscodetemplchange
+msgid "Change"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetempltoken
+msgid "Token:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetemplcomment
+msgid "Comment:"
+msgstr ""
+
+#: lazarusidestrconsts:liscodetemplatokenalreadyexists
+msgid " A token %s%s%s already exists! "
+msgstr ""
+
+#: lazarusidestrconsts:liscodetemplerror
+msgid "Error"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
+msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
+msgstr ""
+
+#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic
+msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
+msgid "Unable to find the unit of component class %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
+msgid "Unable to load the component class %s%s%s, because it depends on itself."
+msgstr ""
+
+#: lazarusidestrconsts:liscancelloadingthiscomponent
+msgid "Cancel loading this component"
+msgstr ""
+
+#: lazarusidestrconsts:lisabortwholeloading
+msgid "Abort whole loading"
+msgstr ""
+
+#: lazarusidestrconsts:lisignoreusetformasancestor
+msgid "Ignore, use TForm as ancestor"
+msgstr ""
+
+#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
+msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresourcestring
+msgid "Make ResourceString"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
+msgid "Invalid Resourcestring section"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
+msgid "Please choose a resourstring section from the list."
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
+msgid "Resourcestring already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrchooseanothername
+msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrstringconstantinsource
+msgid "String constant in source"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrconversionoptions
+msgid "Conversion Options"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstridentifierprefix
+msgid "Identifier prefix:"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstridentifierlength
+msgid "Identifier length:"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrdialogidentifier
+msgid "Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrcustomidentifier
+msgid "Custom identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrresourcestringsection
+msgid "Resourcestring section:"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
+msgid "Strings with same value:"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrappendtosection
+msgid "Append to section"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrinsertalphabetically
+msgid "Insert alphabetically"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
+msgid "Insert context sensitive"
+msgstr ""
+
+#: lazarusidestrconsts:lismakeresstrsourcepreview
+msgid "Source preview"
+msgstr ""
+
+#: lazarusidestrconsts:lisnostringconstantfound
+msgid "No string constant found"
+msgstr ""
+
+#: lazarusidestrconsts:lissuccess
+msgid "Success"
+msgstr ""
+
+#: lazarusidestrconsts:lisallblockslooksok
+msgid "All blocks looks ok."
+msgstr ""
+
+#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
+msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgtext1
+msgid "Text1"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgonlyselection
+msgid "Only selection"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgtext2
+msgid "Text2"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
+msgid "Case Insensitive"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
+msgid "Ignore if empty lines were added or removed"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
+msgid "Ignore spaces at start of line"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
+msgid "Ignore spaces at end of line"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
+msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
+msgid "Ignore amount of space chars"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgignorespaces
+msgid "Ignore spaces (newline chars not included)"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiffdlgopendiffineditor
+msgid "Open Diff in editor"
+msgstr ""
+
+#: lazarusidestrconsts:lissave
+msgid "Save ..."
+msgstr ""
+
+#: lazarusidestrconsts:listodolistcaption
+msgid "ToDo List"
+msgstr ""
+
+#: lazarusidestrconsts:listodolistrefresh
+msgid "Refresh todo items"
+msgstr ""
+
+#: lazarusidestrconsts:listodolistgotoline
+msgid "Goto selected source line"
+msgstr ""
+
+#: lazarusidestrconsts:listodolistprintlist
+msgid "Print todo items"
+msgstr ""
+
+#: lazarusidestrconsts:listodolistoptions
+msgid "ToDo options..."
+msgstr ""
+
+#: lazarusidestrconsts:lisctinsertmacro
+msgid "Insert Macro"
+msgstr ""
+
+#: lazarusidestrconsts:listodoldone
+msgid "Done"
+msgstr ""
+
+#: lazarusidestrconsts:listodoldescription
+msgid "Description"
+msgstr ""
+
+#: lazarusidestrconsts:listodolpriority
+msgid "Priority"
+msgstr ""
+
+#: lazarusidestrconsts:listodolfile
+msgid "Module"
+msgstr ""
+
+#: lazarusidestrconsts:listodolline
+msgid "Line"
+msgstr ""
+
+#: lazarusidestrconsts:listodolowner
+msgid "Owner"
+msgstr ""
+
+#: lazarusidestrconsts:listtodolcategory
+msgid "Category"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypeunit
+msgid "Unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypevirtualunit
+msgid "Virtual Unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypelfm
+msgid "LFM - Lazarus form text"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypelrs
+msgid "LRS - Lazarus resource"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypeinclude
+msgid "Include file"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypetext
+msgid "Text"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgfiletypebinary
+msgid "Binary"
+msgstr ""
+
+#: lazarusidestrconsts:lisviewprojectunits
+msgid "View Project Units"
+msgstr ""
+
+#: lazarusidestrconsts:lisinformationaboutunit
+msgid "Information about %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidyes
+msgid "yes"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidno
+msgid "no"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidbytes
+msgid "%s bytes"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidname
+msgid "Name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidtype
+msgid "Type:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidinproject
+msgid "in Project:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidincludedby
+msgid "Included by:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidclear
+msgid "Clear"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidpathsreadonly
+msgid "Paths (Read Only)"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidunit
+msgid "Unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidsrc
+msgid "Src"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidok
+msgid "Ok"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidsize
+msgid "Size:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuidlines
+msgid "Lines:"
+msgstr ""
+
+#: lazarusidestrconsts:lisuishowcodetoolsvalues
+msgid "Show CodeTools Values"
+msgstr ""
+
+#: lazarusidestrconsts:lisueerrorinregularexpression
+msgid "Error in regular expression"
+msgstr ""
+
+#: lazarusidestrconsts:lissearchfor
+msgid "Search For "
+msgstr ""
+
+#: lazarusidestrconsts:lisuenotfound
+msgid "Not found"
+msgstr ""
+
+#: lazarusidestrconsts:lisuesearchstringnotfound
+msgid "Search string '%s' not found!"
+msgstr ""
+
+#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
+msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lisuesearching
+msgid "Searching: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisuereadonly
+msgid "%s/ReadOnly"
+msgstr ""
+
+#: lazarusidestrconsts:lisuegotoline
+msgid "Goto line :"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionextractfileextension
+msgid "Function: extract file extension"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionextractfilepath
+msgid "Function: extract file path"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionextractfilenameextension
+msgid "Function: extract file name+extension"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionextractfilenameonly
+msgid "Function: extract file name only"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionappendpathdelimiter
+msgid "Function: append path delimiter"
+msgstr ""
+
+#: lazarusidestrconsts:listmfunctionchomppathdelimiter
+msgid "Function: chomp path delimiter"
+msgstr ""
+
+#: lazarusidestrconsts:listmunknownmacro
+msgid "(unknown macro: %s)"
+msgstr ""
+
+#: lazarusidestrconsts:lissvuoinvalidvariablename
+msgid "Invalid variable name"
+msgstr ""
+
+#: lazarusidestrconsts:lissvuoisnotavalididentifier
+msgid "%s%s%s is not a valid identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lisfriidentifier
+msgid "Identifier: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lissvuooverridesystemvariable
+msgid "Override system variable"
+msgstr ""
+
+#: lazarusidestrconsts:lissvuook
+msgid "Ok"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselsortselection
+msgid "Sort selection"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselpreview
+msgid "Preview"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselascending
+msgid "Ascending"
+msgstr ""
+
+#: lazarusidestrconsts:lissortseldescending
+msgid "Descending"
+msgstr ""
+
+#: lazarusidestrconsts:lissortseldomain
+msgid "Domain"
+msgstr ""
+
+#: lazarusidestrconsts:lissortsellines
+msgid "Lines"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselwords
+msgid "Words"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselparagraphs
+msgid "Paragraphs"
+msgstr ""
+
+#: lazarusidestrconsts:lissortseloptions
+msgid "Options"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselcasesensitive
+msgid "&Case Sensitive"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselignorespace
+msgid "Ignore Space"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselsort
+msgid "Accept"
+msgstr ""
+
+#: lazarusidestrconsts:lissortselcancel
+msgid "Cancel"
+msgstr ""
+
+#: lazarusidestrconsts:lispublprojinvalidincludefilter
+msgid "Invalid Include filter"
+msgstr ""
+
+#: lazarusidestrconsts:lispublprojinvalidexcludefilter
+msgid "Invalid Exclude filter"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
+msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojoptserror
+msgid "Error"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditselectdirectory
+msgid "Select directory"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditsearchpaths
+msgid "Search paths:"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditmovepathdown
+msgid "Move path down"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditmovepathup
+msgid "Move path up"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditbrowse
+msgid "Browse"
+msgstr ""
+
+#: lazarusidestrconsts:lispatheditpathtemplates
+msgid "Path templates"
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgnoitemselected
+msgid "No item selected"
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
+msgid "Please select an item first."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
+msgid "Create a new editor file.%sChoose a type."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
+msgid "Create a new project.%sChoose a type."
+msgstr ""
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
+msgid "Choose one of these items to create a new File"
+msgstr ""
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
+msgid "Choose one of these items to create a new Project"
+msgstr ""
+
+#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
+msgid "Choose one of these items to create a new Package"
+msgstr ""
+
+#: lazarusidestrconsts:lispackage
+msgid "Package"
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
+msgid "Create a new pascal unit."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
+msgid "Create a new unit with a LCL form."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
+msgid "Create a new unit with a datamodule."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
+msgid "Create a new empty text file."
+msgstr ""
+
+#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
+msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
+msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewprogram
+msgid "Create a new program.%sThe program file is maintained by Lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
+msgid "Create a new program."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
+msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
+msgid "Create a new standard package.%sA package is a collection of units and components."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatefile
+msgid "Unable to create file"
+msgstr ""
+
+#: lazarusidestrconsts:liscannotcreatefile
+msgid "Can not create file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisextendunitpath
+msgid "Extend unit path?"
+msgstr ""
+
+#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
+msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatefilename
+msgid "Unable to create file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletowritefile
+msgid "Unable to write file"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletowritefile2
+msgid "Unable to write file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisfileisnotwritable
+msgid "File is not writable"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletowritetofile2
+msgid "Unable to write to file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletowritefilename
+msgid "Unable to write file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoreadfile
+msgid "Unable to read file"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletoreadfilename
+msgid "Unable to read file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:liserrordeletingfile
+msgid "Error deleting file"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletodeleteambiguousfile
+msgid "Unable to delete ambiguous file %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liserrorrenamingfile
+msgid "Error renaming file"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletorenameambiguousfileto
+msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
+msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisambiguousfilefound
+msgid "Ambiguous file found"
+msgstr ""
+
+#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
+msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
+msgid "Invalid Min-Max version"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
+msgid "The Maximum Version is lower than the Minimim Version."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddinvalidpackagename
+msgid "Invalid packagename"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
+msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojadddependencyalreadyexists
+msgid "Dependency already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
+msgid "The project has already a dependency for the package %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddpackagenotfound
+msgid "Package not found"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
+msgid "This file is not in any loaded package."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
+msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddinvalidversion
+msgid "Invalid version"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
+msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
+msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
+msgid "Invalid pascal unit name"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
+msgid "The unit name %s%s%s is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
+msgid "Unit name already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
+msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
+msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddtoproject
+msgid "Add to project"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddnewrequirement
+msgid "New Requirement"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddfiles
+msgid "Add files"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddeditorfile
+msgid "Add editor files"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddaddfiletoproject
+msgid "Add file to project:"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddpackagename
+msgid "Package Name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddminimumversionoptional
+msgid "Minimum Version (optional):"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojaddmaximumversionoptional
+msgid "Maximum Version (optional):"
+msgstr ""
+
+#: lazarusidestrconsts:liscomppalopenpackage
+msgid "Open package"
+msgstr ""
+
+#: lazarusidestrconsts:liskmopenpackagefile
+msgid "Open package file"
+msgstr ""
+
+#: lazarusidestrconsts:liscpopenpackage
+msgid "Open Package %s"
+msgstr ""
+
+#: lazarusidestrconsts:liscpopenunit
+msgid "Open Unit %s"
+msgstr ""
+
+#: lazarusidestrconsts:liscomppalopenunit
+msgid "Open unit"
+msgstr ""
+
+#: lazarusidestrconsts:liscomppalfindcomponent
+msgid "Find component"
+msgstr ""
+
+#: lazarusidestrconsts:lismacropromptenterdata
+msgid "Enter data"
+msgstr ""
+
+#: lazarusidestrconsts:lismacropromptenterrunparameters
+msgid "Enter run parameters"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebuggererror
+msgid "Debugger error"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
+msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutionstopped
+msgid "Execution stopped"
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutionstoppedon
+msgid "Execution stopped%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutionpaused
+msgid "Execution paused"
+msgstr ""
+
+#: lazarusidestrconsts:lisexecutionpausedadress
+msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisfilenotfound
+msgid "File not found"
+msgstr ""
+
+#: lazarusidestrconsts:liscleanupunitpath
+msgid "Clean up unit path?"
+msgstr ""
+
+#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
+msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
+msgstr ""
+
+#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
+msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisruntofailed
+msgid "Run-to failed"
+msgstr ""
+
+#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
+msgid "No debugger specified"
+msgstr ""
+
+#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
+msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
+msgstr ""
+
+#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
+msgid "Set the breakpoint anyway"
+msgstr ""
+
+#: lazarusidestrconsts:lislaunchingapplicationinvalid
+msgid "Launching application invalid"
+msgstr ""
+
+#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
+msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
+msgstr ""
+
+#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
+msgid "The launching Application Bundle %s%s%s%sdoes not exist or is not executable.%s%sSee Project -> Project options -> Application."
+msgstr ""
+
+#: lazarusidestrconsts:lisdebuggerinvalid
+msgid "Debugger invalid"
+msgstr ""
+
+#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
+msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispleaseopenaunitbeforerun
+msgid "Please open a unit before run."
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdifferrorreadingfile
+msgid "Error reading file: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
+msgid "Some files have changed on disk:"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdiffchangedfiles
+msgid "Changed files:"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
+msgid "Click on one of the above items to see the diff"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdiffrevertall
+msgid "Reload from disk"
+msgstr ""
+
+#: lazarusidestrconsts:lisdiskdiffignorediskchanges
+msgid "Ignore disk changes"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefcurrentproject
+msgid "Current Project"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
+msgid "Current Project Directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefprojectsrcpath
+msgid "Project SrcPath"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefprojectincpath
+msgid "Project IncPath"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefprojectunitpath
+msgid "Project UnitPath"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefallpackages
+msgid "All packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsallprojects
+msgid "All projects"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
+msgid "set FPC mode to DELPHI"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
+msgid "set FPC mode to TP"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
+msgid "set FPC mode to GPC"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetiocheckson
+msgid "set IOCHECKS on"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetrangecheckson
+msgid "set RANGECHECKS on"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
+msgid "set OVERFLOWCHECKS on"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefuselineinfounit
+msgid "use LineInfo unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefuseheaptrcunit
+msgid "use HeapTrc unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
+msgid "Global Source Path addition"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolfailedtoruntool
+msgid "Failed to run tool"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolunabletorunthetool
+msgid "Unable to run the tool %s%s%s:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolexternaltools
+msgid "External tools"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolremove
+msgid "Remove"
+msgstr ""
+
+#: lazarusidestrconsts:liskeepthemandcontinue
+msgid "Keep them and continue"
+msgstr ""
+
+#: lazarusidestrconsts:lisremovethem
+msgid "Remove them"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolmoveup
+msgid "Up"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolmovedown
+msgid "Down"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
+msgid "Maximum Tools reached"
+msgstr ""
+
+#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
+msgid "There is a maximum of %s tools."
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttooledittool
+msgid "Edit Tool"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolprogramfilename
+msgid "Programfilename:"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolparameters
+msgid "Parameters:"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolworkingdirectory
+msgid "Working Directory:"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
+msgid "Scan output for Free Pascal Compiler messages"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
+msgid "Scan output for make messages"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolkey
+msgid "Key"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolctrl
+msgid "Ctrl"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolalt
+msgid "Alt"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolshift
+msgid "Shift"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolmacros
+msgid "Macros"
+msgstr ""
+
+#: lazarusidestrconsts:lisworkingdirectoryforbuilding
+msgid "Working directory for building"
+msgstr ""
+
+#: lazarusidestrconsts:lisworkingdirectoryforrun
+msgid "Working directory for run"
+msgstr ""
+
+#: lazarusidestrconsts:lisconfigurebuild
+msgid "Configure Build %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolinsert
+msgid "Insert"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
+msgid "Title and Filename required"
+msgstr ""
+
+#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
+msgid "A valid tool needs at least a title and a filename."
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfiletexttofind
+msgid "Text to find:"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilecasesensitive
+msgid "&Case sensitive"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilewholewordsonly
+msgid "&Whole words only"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfileregularexpressions
+msgid "&Regular expressions"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilemultiline
+msgid "&Multiline pattern"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilewhere
+msgid "Where"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
+msgid "search all files in &project"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilesearchallopenfiles
+msgid "search all &open files"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilesearchindirectories
+msgid "search in &directories"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfiledirectoryoptions
+msgid "Directory options"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfilefilemaskbak
+msgid "File mask (*;*.*;*.bak?)"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfileincludesubdirectories
+msgid "Include sub directories"
+msgstr ""
+
+#: lazarusidestrconsts:lisfindfileonlytextfiles
+msgid "Only text files"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackage
+msgid "Package: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangproject
+msgid "Project: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanglazarus
+msgid "Lazarus"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangdependencywithoutowner
+msgid "Dependency without Owner: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangsavepackagelpk
+msgid "Save Package %s (*.lpk)"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
+msgid "Invalid package file extension"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
+msgid "Packages must have the extension .lpk"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagename
+msgid "Invalid package name"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
+msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangrenamefilelowercase
+msgid "Rename File lowercase?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
+msgid "Should the file be renamed lowercase to%s%s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
+msgid "Package name already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
+msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
+msgid "Filename is used by project"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
+msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
+msgid "Filename is used by other package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
+msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangreplacefile
+msgid "Replace File"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangreplaceexistingfile
+msgid "Replace existing file %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
+msgid "Delete Old Package File?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
+msgid "Delete old package file %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangdeletefailed
+msgid "Delete failed"
+msgstr ""
+
+#: lazarusidestrconsts:lisambiguousunitfound
+msgid "Ambiguous Unit found"
+msgstr ""
+
+#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
+msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletodeletefile
+msgid "Unable to delete file %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisdeleteallthesefiles
+msgid "Delete all these files?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunsavedpackage
+msgid "Unsaved package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
+msgid "There is an unsaved package in the required packages. See package graph."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangbrokendependency
+msgid "Broken dependency"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
+msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
+msgid "A required packages was not found. See package graph."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
+msgid "Circle in package dependencies"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
+msgid "There is a circle in the required packages. See package graph."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
+msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
+msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangambiguousunitsfound
+msgid "Ambiguous units found"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
+msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
+msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
+msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangerrorwritingfile
+msgid "Error writing file"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
+msgid "Unable to write state file for project %s%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
+msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangerrorreadingfile
+msgid "Error reading file"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
+msgid "Unable to read state file %s of project %s%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
+msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
+msgid "Unable to create directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatedirectory2
+msgid "Unable to create directory %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
+msgid "Unable to create output directory %s%s%s%sfor package %s."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletodeletefilename
+msgid "Unable to delete file"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
+msgid "Unable to delete old state file %s%s%s%sfor package %s."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
+msgid "Unable to create package source directory %s%s%s%sfor package %s."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletoloadpackage
+msgid "Unable to load package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
+msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagename2
+msgid "Invalid Package Name"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
+msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackageconflicts
+msgid "Package conflicts"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
+msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangsavepackage
+msgid "Save Package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
+msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangnewpackage
+msgid "NewPackage"
+msgstr ""
+
+#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
+msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispackageneedsinstallation
+msgid "Package needs installation"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangskipthispackage
+msgid "Skip this package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidfileextension
+msgid "Invalid file extension"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
+msgid "The file %s%s%s is not a lazarus package."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
+msgid "Invalid package filename"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
+msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfilenotfound
+msgid "File %s%s%s not found."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangerrorreadingpackage
+msgid "Error Reading Package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
+msgid "Unable to read package file %s%s%s.%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
+msgid "Filename differs from Packagename"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
+msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangsavepackage2
+msgid "Save package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagefilemissing
+msgid "Package file missing"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
+msgid "The file %s%s%s%sof package %s is missing."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
+msgid "Package file not saved"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
+msgid "The file %s%s%s%sof package %s needs to be saved first."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
+msgid "Ignore and save package now"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagechangedsave
+msgid "Package %s%s%s changed. Save?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangerrorwritingpackage
+msgid "Error Writing Package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
+msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisseeprojectprojectinspector
+msgid "%sSee Project -> Project Inspector"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
+msgid "The following package failed to load:"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
+msgid "The following packages failed to load:"
+msgstr ""
+
+#: lazarusidestrconsts:lismissingpackages
+msgid "Missing Packages"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
+msgid "invalid Compiler filename"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
+msgid "The compiler file for package %s is not a valid executable:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
+msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
+msgid "package main source file"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
+msgid "This file was automatically created by Lazarus. Do not edit!"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
+msgid "This source is only used to compile and install the package."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangrenamefileinpackage
+msgid "Rename file in package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
+msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
+msgid "%sAdding new Dependency for project %s: package %s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
+msgid "%sAdding new Dependency for package %s: package %s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
+msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisconfirmchanges
+msgid "Confirm changes"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfilenotsaved
+msgid "File not saved"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
+msgid "Please save the file before adding it to a package."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfileisinproject
+msgid "File is in Project"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
+msgid "Warning: The file %s%s%s%sbelongs to the current project."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
+msgid "File is already in package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
+msgid "The file %s%s%s%sis already in the package %s."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
+msgid "Package is no designtime package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
+msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
+msgid "Automatically installed packages"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
+msgid "Installing the package %s will automatically install the packages:"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
+msgid "Installing the package %s will automatically install the package:"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangrebuildlazarus
+msgid "Rebuild Lazarus?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
+msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpackageisrequired
+msgid "Package is required"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
+msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanguninstallpackage
+msgid "Uninstall package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanguninstallpackage2
+msgid "Uninstall package %s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
+msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
+msgid "This is a virtual package. It has no source yet. Please save the package first."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
+msgid "Please save the package first."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
+msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
+msgid "static packages config file"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
+msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysinvalidunitname
+msgid "Invalid Unitname: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysunitnotfound
+msgid "Unit not found: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
+msgid "Unit %s%s%s was removed from package"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
+msgid "Can not register components without unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
+msgid "Invalid component class"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
+msgid "Component Class %s%s%s already defined"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
+msgid "RegisterUnit was called, but no package is registering."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysunitname
+msgid "%s%sUnit Name: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysfilename
+msgid "%s%sFile Name: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysregistrationerror
+msgid "Registration Error"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
+msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
+msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
+msgid "The LCL - Lazarus Component Library contains all base components for form editing."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
+msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
+msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
+msgid "This is the default package. Used only for components without a package. These components are outdated."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
+msgid "Register procedure is nil"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
+msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsyspackagefilenotfound
+msgid "Package file not found"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
+msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgdefsoutputdirectory
+msgid "Output directory"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
+msgid "CompiledSrcPath addition"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgdefsunitpath
+msgid "Unit Path"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
+msgid "Project Source Directory Mark"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgdefssrcdirmark
+msgid "Package Source Directory Mark"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pinvalidpackage
+msgid "Invalid Package"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pinvalidpackageid
+msgid "Invalid package ID: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2ppackagenotfound
+msgid "Package %s%s%s not found."
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2ppackageisreadonly
+msgid "Package is read only"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pthepackageisreadonly
+msgid "The package %s is read only."
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage
+msgid "The file %s%s%s%sis already in the package %s."
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2punitname
+msgid "Unit Name: "
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2phasregisterprocedure
+msgid "Has Register procedure"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pisvirtualunit
+msgid "Virtual unit (source is not in package)"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pfiletype
+msgid "File Type"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pdestinationpackage
+msgid "Destination Package"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2pshowall
+msgid "Show All"
+msgstr ""
+
+#: lazarusidestrconsts:lisaf2paddfiletoapackage
+msgid "Add file to a package"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidfilename
+msgid "Invalid filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
+msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilenotunit
+msgid "File not unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
+msgid "Pascal units must have the extension .pp or .pas"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pisnotavalidunitname
+msgid "%s%s%s is not a valid unit name."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2punitnamealreadyexists
+msgid "Unitname already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
+msgid "The unitname %s%s%s already exists in this package."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
+msgid "The unitname %s%s%s already exists in the package:%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pambiguousunitname
+msgid "Ambiguous Unit Name"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
+msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
+msgid "File %s%s%s already exists in the project."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pexistingfile
+msgid "%sExisting file: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilealreadyexists
+msgid "File already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfileisused
+msgid "File is used"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
+msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion
+msgid "The Maximum Version is lower than the Minimim Version."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
+msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
+msgid "The package has already a dependency for the package %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
+msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidunitname
+msgid "Invalid Unit Name"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
+msgid "The unit name %s%s%s%sand filename %s%s%s differ."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilealreadyinpackage
+msgid "File already in package"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
+msgid "The file %s%s%s is already in the package."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidfile
+msgid "Invalid file"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas
+msgid "A pascal unit must have the extension .pp or .pas"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidancestortype
+msgid "Invalid Ancestor Type"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
+msgid "The ancestor type %s%s%s is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ppagenametoolong
+msgid "Page Name too long"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
+msgid "The page name %s%s%s is too long (max 100 chars)."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2punitnameinvalid
+msgid "Unit Name Invalid"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
+msgid "The unit name %s%s%s does not correspond to the filename."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidclassname
+msgid "Invalid Class Name"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
+msgid "The class name %s%s%s is not a valid pascal identifier."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pinvalidcircle
+msgid "Invalid Circle"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
+msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pambiguousancestortype
+msgid "Ambiguous Ancestor Type"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
+msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pambiguousclassname
+msgid "Ambiguous Class Name"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
+msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pclassnamealreadyexists
+msgid "Class Name already exists"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
+msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
+msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
+msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddunit
+msgid "Add Unit"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pnewfile
+msgid "New File"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pnewcomponent
+msgid "New Component"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddfile
+msgid "Add File"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddfiles
+msgid "Add Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2punitfilename
+msgid "Unit file name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pchooseanexistingfile
+msgid "<choose an existing file>"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
+msgid "Add LFM, LRS files, if they exist"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
+msgid "Scan Unit for Unit Name and Register procedure"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pancestortype
+msgid "Ancestor Type"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pshowall
+msgid "Show all"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pnewclassname
+msgid "New class name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2ppalettepage
+msgid "Palette Page:"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2punitfilename2
+msgid "Unit File Name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2punitname
+msgid "Unit Name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pshortenorexpandfilename
+msgid "Shorten or expand filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2psavefiledialog
+msgid "Save file dialog"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilename
+msgid "File name:"
+msgstr ""
+
+#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
+msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pdependency
+msgid "Dependency"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pbrokendependencies
+msgid "Broken Dependencies"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipfilename
+msgid "Filename:  %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
+msgid "%sThis package was automatically created"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
+msgid "%sThis package is installed, but the lpk file was not found"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipdescriptiondescription
+msgid "%sDescription:  %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipdescription
+msgid "Description:  "
+msgstr ""
+
+#: lazarusidestrconsts:lisoippleaseselectapackage
+msgid "Please select a package"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipnopackageselected
+msgid "No package selected"
+msgstr ""
+
+#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
+msgid "Please select a package to open"
+msgstr ""
+
+#: lazarusidestrconsts:lisoippackagename
+msgid "Package Name"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipstate
+msgid "State"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipmodified
+msgid "modified"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipmissing
+msgid "missing"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipinstalledstatic
+msgid "installed static"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipinstalleddynamic
+msgid "installed dynamic"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipautoinstallstatic
+msgid "auto install static"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipautoinstalldynamic
+msgid "auto install dynamic"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipreadonly
+msgid "readonly"
+msgstr ""
+
+#: lazarusidestrconsts:lisoipopenloadedpackage
+msgid "Open loaded package"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovefile
+msgid "Remove file"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditreaddfile
+msgid "Re-Add file"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovedependency
+msgid "Remove dependency"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditmovedependencyup
+msgid "Move dependency up"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditmovedependencydown
+msgid "Move dependency down"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditreadddependency
+msgid "Re-Add dependency"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
+msgid "Store dependency filename"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
+msgid "Clear dependency filename"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcompile
+msgid "Compile"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditrecompileclean
+msgid "Recompile clean"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditrecompileallrequired
+msgid "Recompile all required"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcreatemakefile
+msgid "Create Makefile"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditaddtoproject
+msgid "Add to project"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditinstall
+msgid "Install"
+msgstr ""
+
+#: lazarusidestrconsts:lispckedituninstall
+msgid "Uninstall"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditviewpackgesource
+msgid "View Package Source"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditgeneraloptions
+msgid "General Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditsavechanges
+msgid "Save Changes?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
+msgid "Package %s%s%s has changed.%sSave package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditpage
+msgid "%s, Page: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovefile2
+msgid "Remove file?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovefilefrompackage
+msgid "Remove file %s%s%s%sfrom package %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovedependency2
+msgid "Remove Dependency?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
+msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditinvalidminimumversion
+msgid "Invalid minimum version"
+msgstr ""
+
+#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
+msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditinvalidmaximumversion
+msgid "Invalid maximum version"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
+msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcompileeverything
+msgid "Compile everything?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
+msgid "Re-Compile this and all required packages?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
+msgid "Compiler Options for Package %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditsavepackage
+msgid "Save package"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcompilepackage
+msgid "Compile package"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditaddanitem
+msgid "Add an item"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremoveselecteditem
+msgid "Remove selected item"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditinstallpackageintheide
+msgid "Install package in the IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lispckediteditgeneraloptions
+msgid "Edit General Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcompopts
+msgid "Compiler Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispckedithelp
+msgid "Help"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
+msgid "There are more functions in the popupmenu"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditmore
+msgid "More ..."
+msgstr ""
+
+#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
+msgid "Edit Options to compile package"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditrequiredpackages
+msgid "Required Packages"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditfileproperties
+msgid "File Properties"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditregisterunit
+msgid "Register unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
+msgid "Call %sRegister%s procedure of selected unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditregisteredplugins
+msgid "Registered plugins"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
+msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
+msgstr ""
+
+#: lazarusidestrconsts:lispkgmanguseunit
+msgid "Use unit"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditminimumversion
+msgid "Minimum Version:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditmaximumversion
+msgid "Maximum Version:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditapplychanges
+msgid "Apply changes"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditpackage
+msgid "Package %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
+msgid "Removed Files (these entries are not saved to the lpk file)"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
+msgid "Removed required packages (these entries are not saved to the lpk file)"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditdependencyproperties
+msgid "Dependency Properties"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditpackagenotsaved
+msgid "package %s not saved"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditreadonly
+msgid "Read Only: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispckeditmodified
+msgid "Modified: %s"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
+msgid "New unit not in unitpath"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
+msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgeditrevertpackage
+msgid "Revert package?"
+msgstr ""
+
+#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
+msgid "Do you really want to forget all changes to package %s and reload it from file?"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsusage
+msgid "Usage"
+msgstr ""
+
+#: lazarusidestrconsts:lispochoosepofiledirectory
+msgid "Choose .po file directory"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsideintegration
+msgid "IDE Integration"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsprovides
+msgid "Provides"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsdescriptionabstract
+msgid "Description/Abstract"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsauthor
+msgid "Author:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptslicense
+msgid "License:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsmajor
+msgid "Major"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsminor
+msgid "Minor"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsrelease
+msgid "Release"
+msgstr ""
+
+#: lazarusidestrconsts:lisbuildnumber
+msgid "Build Number"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
+msgid "Automatically increment version on build"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptspackagetype
+msgid "PackageType"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsdesigntimeonly
+msgid "Designtime only"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsruntimeonly
+msgid "Runtime only"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
+msgid "Designtime and Runtime"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsupdaterebuild
+msgid "Update/Rebuild"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
+msgid "Automatically rebuild as needed"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
+msgid "Auto rebuild when rebuilding all"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
+msgid "Manual compilation (never automatically)"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
+msgid "LazDoc - Lazarus documentation"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
+msgid "Add paths to dependent packages/projects"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsinclude
+msgid "Include"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsobject
+msgid "Object"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptslibrary
+msgid "Library"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
+msgid "Add options to dependent packages and projects"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptslinker
+msgid "Linker"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptscustom
+msgid "Custom"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsinvalidpackagetype
+msgid "Invalid package type"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
+msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptspackageoptions
+msgid "Package Options"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplloadedpackages
+msgid "Loaded Packages:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplisrequiredby
+msgid "Selected package is required by:"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplpackagenotfound
+msgid "Package %s not found"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplstate
+msgid "%sState: "
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplautocreated
+msgid "AutoCreated"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplinstalled
+msgid "Installed"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexplinstallonnextstart
+msgid "Install on next start"
+msgstr ""
+
+#: lazarusidestrconsts:lispckexpluninstallonnextstart
+msgid "Uninstall on next start"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
+msgid "Confirm deleting dependency"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspconfirmremovingfile
+msgid "Confirm removing file"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspdeletedependencyfor
+msgid "Delete dependency for %s?"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspremovefilefromproject
+msgid "Remove file %s from project?"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
+msgid "Removed required packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisprojinspprojectinspector
+msgid "Project Inspector - %s"
+msgstr ""
+
+#: lazarusidestrconsts:lisfpfindpalettecomponent
+msgid "Find palette component"
+msgstr ""
+
+#: lazarusidestrconsts:lisfpcomponents
+msgid "Components"
+msgstr "Komponenty"
+
+#: lazarusidestrconsts:liscmplstcomponents
+msgid "Components"
+msgstr "Komponenty"
+
+#: lazarusidestrconsts:liscmplstlist
+msgid "List"
+msgstr "Zoznam"
+
+#: lazarusidestrconsts:liscmplstpalette
+msgid "Palette"
+msgstr "Paleta"
+
+#: lazarusidestrconsts:liscmplstinheritance
+msgid "Inheritance"
+msgstr "Dedičnosť"
+
+#: lazarusidestrconsts:lismenueditormenueditor
+msgid "Menu Editor"
+msgstr "Editor menu"
+
+#: lazarusidestrconsts:lismenueditorselectmenu
+msgid "Select Menu:"
+msgstr "Zvoliť menu:"
+
+#: lazarusidestrconsts:lismenueditorselecttemplate
+msgid "Select Template:"
+msgstr "Zvoliť šablónu:"
+
+#: lazarusidestrconsts:lismenueditortemplatepreview
+msgid "Template Preview"
+msgstr "Ukážka šablóny"
+
+#: lazarusidestrconsts:lismenueditornewtemplatedescription
+msgid "New Template Description..."
+msgstr "Popis novej šablóny ..."
+
+#: lazarusidestrconsts:lismenueditorcancel
+msgid "Cancel"
+msgstr "Zrušiť"
+
+#: lazarusidestrconsts:lismenueditorinsertnewitemafter
+msgid "Insert New Item (after)"
+msgstr "Vložiť novú položku (za)"
+
+#: lazarusidestrconsts:lismenueditorinsertnewitembefore
+msgid "Insert New Item (before)"
+msgstr "Vložiť·novú·položku·(pred)"
+
+#: lazarusidestrconsts:lismenueditordeleteitem
+msgid "Delete Item"
+msgstr "Zmazať položku"
+
+#: lazarusidestrconsts:lismenueditorcreatesubmenu
+msgid "Create Submenu"
+msgstr "Vytvoriť podmenu"
+
+#: lazarusidestrconsts:lismenueditorhandleonclickevent
+msgid "Handle OnClick Event"
+msgstr ""
+
+#: lazarusidestrconsts:lismenueditormoveup
+msgid "Move Up (or left)"
+msgstr "Posunúť hore (alebo vľavo)"
+
+#: lazarusidestrconsts:lismenueditormovedown
+msgid "Move Down (or right)"
+msgstr "Posunúť dole (alebo vpravo)"
+
+#: lazarusidestrconsts:lismenueditorinsertfromtemplate
+msgid "Insert From Template..."
+msgstr "Vložiť zo šablóny ..."
+
+#: lazarusidestrconsts:lismenueditorsaveastemplate
+msgid "Save As Template..."
+msgstr "Uložiť ako šablónu ..."
+
+#: lazarusidestrconsts:lismenueditordeletefromtemplate
+msgid "Delete From Template..."
+msgstr "Zmazať zo šablóny ..."
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
+msgid "Standard File Menu"
+msgstr "Štandardné menu Súbor"
+
+#: lazarusidestrconsts:lismenutemplatefile
+msgid "File"
+msgstr "Súbor"
+
+#: lazarusidestrconsts:lismenutemplatenew
+msgid "New"
+msgstr "Nový"
+
+#: lazarusidestrconsts:liskmnewunit
+msgid "New Unit"
+msgstr "Nová unita"
+
+#: lazarusidestrconsts:lismenutemplateopen
+msgid "Open"
+msgstr "Otvoriť"
+
+#: lazarusidestrconsts:lismenutemplateopenrecent
+msgid "Open Recent"
+msgstr "Otvoriť nedávne"
+
+#: lazarusidestrconsts:lismenutemplatesave
+msgid "Save"
+msgstr "Uložiť"
+
+#: lazarusidestrconsts:lismenutemplatesaveas
+msgid "Save As"
+msgstr "Uložiť ako"
+
+#: lazarusidestrconsts:lismenutemplateclose
+msgid "Close"
+msgstr "Zatvoriť"
+
+#: lazarusidestrconsts:lismenutemplateexit
+msgid "Exit"
+msgstr "Skončiť"
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
+msgid "Standard Edit Menu"
+msgstr "Štandardné menu Upraviť"
+
+#: lazarusidestrconsts:lismenutemplateedit
+msgid "Edit"
+msgstr "Upraviť"
+
+#: lazarusidestrconsts:lismenutemplateundo
+msgid "Undo"
+msgstr "Späť"
+
+#: lazarusidestrconsts:lismenutemplateredo
+msgid "Redo"
+msgstr "Znova"
+
+#: lazarusidestrconsts:lismenutemplatecut
+msgid "Cut"
+msgstr "Vystrihnúť"
+
+#: lazarusidestrconsts:lismenutemplatecopy
+msgid "Copy"
+msgstr "Kopírovať"
+
+#: lazarusidestrconsts:lismenutemplatepaste
+msgid "Paste"
+msgstr "Vložiť"
+
+#: lazarusidestrconsts:lismenutemplatefind
+msgid "Find"
+msgstr "Nájsť"
+
+#: lazarusidestrconsts:lismenutemplatefindnext
+msgid "Find Next"
+msgstr "Nájsť ďalšie"
+
+#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
+msgid "Standard Help Menu"
+msgstr "Štandardné menu Nápoveda"
+
+#: lazarusidestrconsts:lismenutemplatehelp
+msgid "Help"
+msgstr "Nápoveda"
+
+#: lazarusidestrconsts:lismenutemplatecontents
+msgid "Contents"
+msgstr "Obsah"
+
+#: lazarusidestrconsts:lismenutemplatetutorial
+msgid "Tutorial"
+msgstr "Príručka"
+
+#: lazarusidestrconsts:lismenutemplateabout
+msgid "About"
+msgstr "O ..."
+
+#: lazarusidestrconsts:liscontributors
+msgid "Contributors"
+msgstr "Spolupracovníci"
+
+#: lazarusidestrconsts:lisacknowledgements
+msgid "Acknowledgements"
+msgstr "Poďakovanie"
+
+#: lazarusidestrconsts:lischaractermap
+msgid "Character Map"
+msgstr "Mapa znakov"
+
+#: lazarusidestrconsts:lisctdefchoosedirectory
+msgid "Choose Directory"
+msgstr "Zvoliť adresár"
+
+#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
+msgid "CodeTools Directory Values"
+msgstr ""
+
+#: lazarusidestrconsts:lisctdefvariable
+msgid "Variable: %s"
+msgstr "Premenná: %s"
+
+#: lazarusidestrconsts:lisctdefnovariableselected
+msgid "<no variable selected>"
+msgstr "<premenná nezvolená>"
+
+#: lazarusidestrconsts:lisctdefvariablename
+msgid "Variable Name"
+msgstr "Meno premennej"
+
+#: lazarusidestrconsts:liscldircleansubdirectories
+msgid "Clean sub directories"
+msgstr "Vyčistiť podadresáre"
+
+#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
+msgid "Remove files matching filter"
+msgstr "Odstrániť súbory vyhovujúce filtru"
+
+#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
+msgid "Simple Syntax (e.g. * instead of .*)"
+msgstr "Jednoduchá syntax (napr. * namiesto .*)"
+
+#: lazarusidestrconsts:liscldirkeepalltextfiles
+msgid "Keep all text files"
+msgstr "Ponechať všetky textové súbory"
+
+#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
+msgid "Keep files matching filter"
+msgstr "Ponechať všetky súbory vyhovujúce filtru"
+
+#: lazarusidestrconsts:liscldircleandirectory
+msgid "Clean Directory"
+msgstr "Vyčistiť adresár"
+
+#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
+msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
+msgstr ""
+
+#: lazarusidestrconsts:lisfixlfmfile
+msgid "Fix LFM file"
+msgstr "Opraviť súbor LFM"
+
+#: lazarusidestrconsts:lismissingevents
+msgid "Missing Events"
+msgstr "Chýbajúce udalosti"
+
+#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
+msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
+msgstr ""
+
+#: lazarusidestrconsts:lisnocodeselected
+msgid "No code selected"
+msgstr "Nie je vybratý kód"
+
+#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
+msgid "Please select some code to extract a new procedure/method."
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidselection
+msgid "Invalid selection"
+msgstr "Neplatný výber"
+
+#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
+msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
+msgstr ""
+
+#: lazarusidestrconsts:lisextractprocedure
+msgid "Extract Procedure"
+msgstr ""
+
+#: lazarusidestrconsts:lisnameofnewprocedure
+msgid "Name of new procedure"
+msgstr "Meno novej procedúry"
+
+#: lazarusidestrconsts:lisextract
+msgid "Extract"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidprocname
+msgid "Invalid proc name"
+msgstr ""
+
+#: lazarusidestrconsts:lispublicmethod
+msgid "Public Method"
+msgstr ""
+
+#: lazarusidestrconsts:lisprivatemethod
+msgid "Private Method"
+msgstr ""
+
+#: lazarusidestrconsts:lisprotectedmethod
+msgid "Protected Method"
+msgstr ""
+
+#: lazarusidestrconsts:lispublishedmethod
+msgid "Published Method"
+msgstr ""
+
+#: lazarusidestrconsts:lisprocedure
+msgid "Procedure"
+msgstr ""
+
+#: lazarusidestrconsts:lisprocedurewithinterface
+msgid "Procedure with interface"
+msgstr ""
+
+#: lazarusidestrconsts:lissubprocedure
+msgid "Sub Procedure"
+msgstr ""
+
+#: lazarusidestrconsts:lissubprocedureonsamelevel
+msgid "Sub Procedure on same level"
+msgstr ""
+
+#: lazarusidestrconsts:lisfreepascalcompilernotfound
+msgid "Free Pascal Compiler not found"
+msgstr ""
+
+#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
+msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidcompilerfilename
+msgid "Invalid Compiler Filename"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
+msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisfreepascalsourcesnotfound
+msgid "Free Pascal Sources not found"
+msgstr ""
+
+#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
+msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
+msgid "Invalid Free Pascal source directory"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
+msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:lislazarusdirectorynotfound
+msgid "Lazarus directory not found"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
+msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
+msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
+msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
+msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
+msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
+msgstr ""
+
+#: lazarusidestrconsts:lishlpoptshelpoptions
+msgid "Help Options"
+msgstr "Voľby nápovedy"
+
+#: lazarusidestrconsts:lishlpoptsviewers
+msgid "Viewers"
+msgstr ""
+
+#: lazarusidestrconsts:lishofpcdochtmlpath
+msgid "FPC Doc HTML Path"
+msgstr ""
+
+#: lazarusidestrconsts:lishlpoptsproperties
+msgid "Properties:"
+msgstr "Vlastnosti:"
+
+#: lazarusidestrconsts:lishlpoptsdatabases
+msgid "Databases"
+msgstr "Databázy"
+
+#: lazarusidestrconsts:lisencloseselection
+msgid "Enclose Selection"
+msgstr ""
+
+#: lazarusidestrconsts:lisenclose
+msgid "Enclose"
+msgstr ""
+
+#: lazarusidestrconsts:lischoosestructuretoencloseselection
+msgid "Choose structure to enclose selection"
+msgstr ""
+
+#: lazarusidestrconsts:liserrors
+msgid "Errors"
+msgstr "Chyby"
+
+#: lazarusidestrconsts:lislfmfile
+msgid "LFM file"
+msgstr "LFM súbor"
+
+#: lazarusidestrconsts:lisremoveallinvalidproperties
+msgid "Remove all invalid properties"
+msgstr ""
+
+#: lazarusidestrconsts:liscomptest
+msgid "Test"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pswitchpaths
+msgid "Switch Paths"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddfilestopackage
+msgid "Add files to package"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2paddtopackage
+msgid "Add to package"
+msgstr ""
+
+#: lazarusidestrconsts:lisa2pfilename2
+msgid "Filename"
+msgstr ""
+
+#: lazarusidestrconsts:lisfrifindorrenameidentifier
+msgid "Find or Rename Identifier"
+msgstr ""
+
+#: lazarusidestrconsts:lishelpselectordialog
+msgid "Help selector"
+msgstr ""
+
+#: lazarusidestrconsts:lisselectahelpitem
+msgid "Select a help item:"
+msgstr ""
+
+#: lazarusidestrconsts:liserrormovingcomponent
+msgid "Error moving component"
+msgstr ""
+
+#: lazarusidestrconsts:liserrormovingcomponent2
+msgid "Error moving component %s:%s"
+msgstr ""
+
+#: lazarusidestrconsts:lisinstalledpackages
+msgid "Installed Packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisavailablepackages
+msgid "Available packages"
+msgstr ""
+
+#: lazarusidestrconsts:lisexportlist
+msgid "Export list"
+msgstr ""
+
+#: lazarusidestrconsts:lisimportlist
+msgid "Import list"
+msgstr ""
+
+#: lazarusidestrconsts:lisuninstallselection
+msgid "Uninstall selection"
+msgstr ""
+
+#: lazarusidestrconsts:lispackagestoinstallintheide
+msgid "Packages to install in the IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lisinstallselection
+msgid "Install selection"
+msgstr ""
+
+#: lazarusidestrconsts:lispackageinfo
+msgid "Package Info"
+msgstr ""
+
+#: lazarusidestrconsts:lissaveandrebuildide
+msgid "Save and rebuild IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lissaveandexitdialog
+msgid "Save and exit dialog"
+msgstr ""
+
+#: lazarusidestrconsts:lisalignment
+msgid "Alignment"
+msgstr "Zarovnanie"
+
+#: lazarusidestrconsts:lishorizontal
+msgid "Horizontal"
+msgstr "Vodorovne"
+
+#: lazarusidestrconsts:lisnochange
+msgid "No change"
+msgstr "Bez zmeny"
+
+#: lazarusidestrconsts:listops
+msgid "Tops"
+msgstr "Horné okraje"
+
+#: lazarusidestrconsts:lisleftsides
+msgid "Left sides"
+msgstr "Ľavé strany"
+
+#: lazarusidestrconsts:liscenters
+msgid "Centers"
+msgstr "Stredy"
+
+#: lazarusidestrconsts:lisbottoms
+msgid "Bottoms"
+msgstr "Spodné okraje"
+
+#: lazarusidestrconsts:lisrightsides
+msgid "Right sides"
+msgstr "Pravé strany"
+
+#: lazarusidestrconsts:liscenterinwindow
+msgid "Center in window"
+msgstr "Centrovať v okne"
+
+#: lazarusidestrconsts:lisspaceequally
+msgid "Space equally"
+msgstr ""
+
+#: lazarusidestrconsts:listopspaceequally
+msgid "Top space equally"
+msgstr ""
+
+#: lazarusidestrconsts:lisbottomspaceequally
+msgid "Bottom space equally"
+msgstr ""
+
+#: lazarusidestrconsts:lisleftspaceequally
+msgid "Left space equally"
+msgstr ""
+
+#: lazarusidestrconsts:lisrightspaceequally
+msgid "Right space equally"
+msgstr ""
+
+#: lazarusidestrconsts:lisvertical
+msgid "Vertical"
+msgstr "Zvislo"
+
+#: lazarusidestrconsts:lisscalingfactor
+msgid "Scaling factor:"
+msgstr ""
+
+#: lazarusidestrconsts:liscustomprogram
+msgid "Custom Program"
+msgstr "Vlastný program"
+
+#: lazarusidestrconsts:lisprogram
+msgid "Program"
+msgstr "Program"
+
+#: lazarusidestrconsts:lisconsoleapplication
+msgid "Console application"
+msgstr "Konzolová aplikácia"
+
+#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
+msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
+msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:liscustomprogramafreepascalprogram
+msgid "Custom Program%sA freepascal program."
+msgstr ""
+
+#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
+msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
+msgstr ""
+
+#: lazarusidestrconsts:lisnpselectaprojecttype
+msgid "Select a project type"
+msgstr ""
+
+#: lazarusidestrconsts:lisnpcreateanewproject
+msgid "Create a new project"
+msgstr ""
+
+#: lazarusidestrconsts:lisnpcreate
+msgid "Create"
+msgstr ""
+
+#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
+msgid "Choose a base class for the favourite property %s%s%s."
+msgstr ""
+
+#: lazarusidestrconsts:lisoifaddtofavouriteproperties
+msgid "Add to favourite properties"
+msgstr ""
+
+#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
+msgid "Remove from favourite properties"
+msgstr ""
+
+#: lazarusidestrconsts:lisreplacingselectionfailed
+msgid "Replacing selection failed."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletofindinlfmstream
+msgid "Unable to find %s in LFM Stream."
+msgstr ""
+
+#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
+msgid "Error parsing lfm component stream."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
+msgid "Unable to create temporary lfm buffer."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletogetsourcefordesigner
+msgid "Unable to get source for designer."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletogathereditorchanges
+msgid "Unable to gather editor changes."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
+msgid "Unable to stream selected components."
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletochangeclassofto
+msgid "%s%sUnable to change class of %s to %s"
+msgstr ""
+
+#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
+msgid "Can only change the class of TComponents."
+msgstr "Možno zmeniť len triedu z TComponents."
+
+#: lazarusidestrconsts:lisoldclass
+msgid "Old Class"
+msgstr "Stará trieda"
+
+#: lazarusidestrconsts:lisnewclass
+msgid "New Class"
+msgstr "Nová trieda"
+
+#: lazarusidestrconsts:lisoldancestors
+msgid "Old Ancestors"
+msgstr "Starý predok"
+
+#: lazarusidestrconsts:lisnewancestors
+msgid "New Ancestors"
+msgstr "Nový predok"
+
+#: lazarusidestrconsts:lisceocodeexplorer
+#, fuzzy
+msgid "CodeExplorer Options"
+msgstr "Voľby CodeExplorer"
+
+#: lazarusidestrconsts:lisceoupdate
+msgid "Update"
+msgstr "Aktualizoavť"
+
+#: lazarusidestrconsts:lisceorefreshautomatically
+msgid "Refresh automatically"
+msgstr "Obnoviť automaticky"
+
+#: lazarusidestrconsts:lisceoneveronlymanually
+msgid "Never, only manually"
+msgstr "Nikdy, len manuálne"
+
+#: lazarusidestrconsts:lisceowhenswitchingfile
+msgid "When switching file in source editor"
+msgstr ""
+
+#: lazarusidestrconsts:lisceoonidle
+msgid "On idle"
+msgstr "Pri nečinnosti"
+
+#: lazarusidestrconsts:liscefollowcursor
+msgid "Follow cursor"
+msgstr ""
+
+#: lazarusidestrconsts:lismenulazdoc
+msgid "LazDoc Editor"
+msgstr "Editor LazDoc"
+
+#: lazarusidestrconsts:lislazdocmainformcaption
+msgid "LazDoc editor"
+msgstr "Editor LazDoc"
+
+#: lazarusidestrconsts:lislazdocnotagcaption
+msgid "<NONE>"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocnodocumentation
+msgid "Documentation entry does not exist"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocinherited
+msgid "Inherited"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocshorttag
+msgid "Short"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocdescrtag
+msgid "Description"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocerrorstag
+msgid "Errors"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocseealsotag
+msgid "See also"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocaddpathbutton
+msgid "Add path"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocdeletepathbutton
+msgid "Remove path"
+msgstr ""
+
+#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
+msgid "NOTE: only absolute paths are supported now"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocpathsgroupbox
+msgid "LazDoc settings"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintboldformat
+msgid "Insert bold formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintitalicformat
+msgid "Insert italic formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintunderlineformat
+msgid "Insert underline formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintinsertcodetag
+msgid "Insert code formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintremarktag
+msgid "Insert remark formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdochintvartag
+msgid "Insert var formatting tag"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocaddlinkbutton
+msgid "Add link"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocdeletelinkbutton
+msgid "Delete link"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocexampletag
+msgid "Example"
+msgstr ""
+
+#: lazarusidestrconsts:lislazdocbrowseexamplebutton
+msgid "Browse"
+msgstr ""
+
+#: lazarusidestrconsts:lisldmoveentriestoinherited
+msgid "Move entries to inherited"
+msgstr ""
+
+#: lazarusidestrconsts:lisldcopyfrominherited
+msgid "Copy from inherited"
+msgstr ""
+
+#: lazarusidestrconsts:lisenablemacros
+msgid "Enable Macros"
+msgstr ""
+
+#: lazarusidestrconsts:lisctselectcodemacro
+msgid "Select Code Macro"
+msgstr ""
+
+#: lazarusidestrconsts:lispdprogress
+msgid "Progress"
+msgstr ""
+
+#: lazarusidestrconsts:lispdabort
+msgid "Abort"
+msgstr ""
+
+#: lazarusidestrconsts:lisposaveinlpifil
+msgid "Save in .lpi file"
+msgstr ""
+
+#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
+msgid "Save in .lps file in project directory"
+msgstr ""
+
+#: lazarusidestrconsts:lisposaveinideconfigdirectory
+msgid "Save in IDE config directory"
+msgstr ""
+
+#: lazarusidestrconsts:lispodonotsaveanysessioninfo
+msgid "Do not save any session info"
+msgstr ""
+
+#: lazarusidestrconsts:lisposavesessioninformationin
+msgid "Save session information in"
+msgstr ""
+
+#: lazarusidestrconsts:lismvsavemessagestofiletxt
+msgid "Save messages to file (*.txt)"
+msgstr ""
+
+#: lazarusidestrconsts:lisshowoldtaborder
+msgid "Show old tab order"
+msgstr ""
+
+#: lazarusidestrconsts:listaborderof
+msgid "Tab Order of"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchorenabledhint
+msgid "Enabled = Include %s in Anchors"
+msgstr ""
+
+#: lazarusidestrconsts:lisaroundborderspacehint
+msgid "Borderspace around the control. The other four borderspaces are added to this value."
+msgstr ""
+
+#: lazarusidestrconsts:listopborderspacespinedithint
+msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
+msgstr ""
+
+#: lazarusidestrconsts:lisbottomborderspacespinedithint
+msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
+msgstr ""
+
+#: lazarusidestrconsts:lisleftborderspacespinedithint
+msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
+msgstr ""
+
+#: lazarusidestrconsts:lisrightborderspacespinedithint
+msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
+msgstr ""
+
+#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
+msgid "Center control vertically relative to the given sibling"
+msgstr ""
+
+#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
+msgid "Center control horizontally relative to the given sibling"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
+msgid "Anchor to top side of sibling, keep border space"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
+msgid "Anchor to bottom side of sibling, keep border space"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
+msgid "Anchor to left side of sibling, keep border space"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
+msgid "Anchor to right side of sibling, keep border space"
+msgstr ""
+
+#: lazarusidestrconsts:listopsiblingcomboboxhint
+msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
+msgstr ""
+
+#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
+msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
+msgstr ""
+
+#: lazarusidestrconsts:lisrightsiblingcomboboxhint
+msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
+msgstr ""
+
+#: lazarusidestrconsts:lisleftsiblingcomboboxhint
+msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
+msgstr ""
+
+#: lazarusidestrconsts:lisborderspace
+msgid "BorderSpace"
+msgstr ""
+
+#: lazarusidestrconsts:lissibling
+msgid "Sibling"
+msgstr ""
+
+#: lazarusidestrconsts:lisenabled
+msgid "Enabled"
+msgstr ""
+
+#: lazarusidestrconsts:lisrightanchoring
+msgid "Right anchoring"
+msgstr ""
+
+#: lazarusidestrconsts:listopanchoring
+msgid "Top anchoring"
+msgstr ""
+
+#: lazarusidestrconsts:lisleftgroupboxcaption
+msgid "Left anchoring"
+msgstr ""
+
+#: lazarusidestrconsts:lisbottomgroupboxcaption
+msgid "Bottom anchoring"
+msgstr ""
+
+#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
+msgid "Unable to set AnchorSide Control"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchoreditornocontrolselected
+msgid "Anchor Editor - no control selected"
+msgstr ""
+
+#: lazarusidestrconsts:lisanchorsofselectedcontrols
+msgid "Anchors of selected controls"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
+msgid "Additional search path"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
+msgid "Debugger general options"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
+msgid "Show message on stop"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
+msgid "Debugger specific options (depends on type of debugger)"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
+msgid "Event Log"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
+msgid "Clear log on run"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
+msgid "Limit linecount to"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
+msgid "Breakpoint"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmprocess
+msgid "Process"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmthread
+msgid "Thread"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmmodule
+msgid "Module"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmoutput
+msgid "Output"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmwindow
+msgid "Window"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrminterface
+msgid "Interface"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
+msgid "Language Exceptions"
+msgstr "Výnimky jazyka"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
+msgid "Ignore these exceptions"
+msgstr "Ignorovať tieto výnimky"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
+msgid "Break on Lazarus Exceptions"
+msgstr "Prerušiť pri výnimkách Lazarus"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
+msgid "OS Exceptions"
+msgstr "Výnimky OS"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmsignals
+msgid "Signals"
+msgstr "Signály"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmname
+msgid "Name"
+msgstr "Meno"
+
+#: lazarusidestrconsts:lisdebugoptionsfrmid
+msgid "ID"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
+msgid "Handled by"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresume
+msgid "Resume"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
+msgid "Handled by Program"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
+msgid "Handled by Debugger"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
+msgid "Resume Handled"
+msgstr ""
+
+#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
+msgid "Resume Unhandled"
+msgstr ""
+
+#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
+msgid "Help for FreePascal Compiler message"
+msgstr "Nápoveda pre správu FreePascal·Compiler"
+
+#: lazarusidestrconsts:lisrelativepaths
+msgid "Relative paths"
+msgstr "Relatívne cesty"
+
+#: lazarusidestrconsts:lislazbuildsavesettings
+msgid "Save settings"
+msgstr "Uložiť nastavenia"
+
+#: lazarusidestrconsts:rsformdatafiledfm
+msgid "Form data file (*.dfm)|*.dfm"
+msgstr "Dátový súbor formulára ·(*.dfm)|*.dfm"
+
+#: lazarusidestrconsts:liswlwatchlist
+msgid "Watch list"
+msgstr ""
+
+#: lazarusidestrconsts:liswlexpression
+msgid "Expression"
+msgstr ""
+
+#: lazarusidestrconsts:liskmchoosekeymappingscheme
+msgid "Choose Keymapping scheme"
+msgstr ""
+
+#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
+msgid "Note: All keys will be set to the values of the choosen scheme."
+msgstr ""
+
+#: lazarusidestrconsts:liskmkeymappingscheme
+msgid "Keymapping Scheme"
+msgstr ""
+
+#: lazarusidestrconsts:lisifdok
+msgid "OK"
+msgstr "OK"
+
+#: lazarusidestrconsts:lispvueditvirtualunit
+msgid "Edit virtual unit"
+msgstr ""
+
+#: lazarusidestrconsts:versioninfotitle
+msgid "Version Info"
+msgstr ""
+
+#: lazarusidestrconsts:lisplistobjects
+msgid "&Objects"
+msgstr "&Objekty"
+
+#: lazarusidestrconsts:lisplistjumptoselection
+msgid "Jump To Selection"
+msgstr "Skoč na výber"
+
+#: lazarusidestrconsts:lisplistfilterany
+msgid "Filter by matching any part of method"
+msgstr ""
+
+#: lazarusidestrconsts:lisplistfilterstart
+msgid "Filter by matching with start of method"
+msgstr ""
+
+#: lazarusidestrconsts:lisplistchangefont
+msgid "Change Font"
+msgstr "Zmeniť font"
+
+#: lazarusidestrconsts:lisplistcopymethodtoclipboard
+msgid "Copy method name to the clipboard"
+msgstr "Kopírovať meno metódy"
+
+#: lazarusidestrconsts:lisplisttype
+msgid "Type"
+msgstr ""
+
+#: lazarusidestrconsts:lisplistall
+msgid "<All>"
+msgstr "<Všetko>"
+
+#: lazarusidestrconsts:lisplistnone
+msgid "<None>"
+msgstr "<Žiadne>"
+
+#: lazarusidestrconsts:lisuiclearincludedbyreference
+msgid "Clear include cache"
+msgstr ""
+
+#: lazarusidestrconsts:lischangeparent
+msgid "Change parent ..."
+msgstr ""
+
+#: lazarusidestrconsts:lislazaruside
+msgid "Lazarus IDE"
+msgstr ""
+
+#: lazarusidestrconsts:lisdirectives
+msgid "Directives"
+msgstr "Direktívy"
+
+#: lazarusidestrconsts:rscreatenewdefine
+msgid "Create new define"
+msgstr ""
+
+#: lazarusidestrconsts:rsconditionaldefines
+msgid "Conditional defines"
+msgstr ""
+
+#: lazarusidestrconsts:rsaddinverse
+msgid "Add Inverse"
+msgstr ""
+
+#: lazarusidestrconsts:rsremove
+msgid "&Remove"
+msgstr ""
+
+#: lazarusidestrconsts:lisautomaticallyonlinebreak
+msgid "line break"
+msgstr "koniec riadku"
+
+#: lazarusidestrconsts:lisautomaticallyonspace
+msgid "space"
+msgstr "medzera"
+
+#: lazarusidestrconsts:lisautomaticallyonwordend
+#, fuzzy
+msgid "word end"
+msgstr "koniec slova"
+
+#: lazarusidestrconsts:lisautomaticallyremovecharacter
+msgid "do not add character"
+msgstr ""
+
+#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
+msgid "This package provides the same as the following packages:"
+msgstr "Tento balíček poskytuje to isté ako balíčky:"
+
+#: lazarusidestrconsts:lispldpackagelinks
+msgid "Package Links"
+msgstr ""
+
+#: lazarusidestrconsts:lissamoverridefirstselected
+msgid "Override first selected"
+msgstr ""
+
+#: lazarusidestrconsts:lissamoverrideallselected
+msgid "Override all selected"
+msgstr ""
+