msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: 2006-11-03 19:03+0100\n" "Last-Translator: J.Salvador Pérez \n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts.cocoamfstbicommand msgid "Command" msgstr "" #: lazarusidestrconsts.cocoamfstbijumpback msgctxt "lazarusidestrconsts.cocoamfstbijumpback" msgid "Jump Back" msgstr "" #: lazarusidestrconsts.cocoamfstbijumpforward msgctxt "lazarusidestrconsts.cocoamfstbijumpforward" msgid "Jump Forward" msgstr "" #: lazarusidestrconsts.cocoamfstbisearch msgid "Search Instantly" msgstr "" #: lazarusidestrconsts.dbgasmwindowlinktarget msgid "Link target line" msgstr "" #: lazarusidestrconsts.dbgasmwindowsourcefunc msgid "Function name" msgstr "" #: lazarusidestrconsts.dbgasmwindowsourceline msgid "Source line" msgstr "" #: lazarusidestrconsts.dbgeventbreakaddressbreakpoint #, object-pascal-format msgid "Address Breakpoint %s" msgstr "" #: lazarusidestrconsts.dbgeventbreakataddress #, object-pascal-format msgid "at $%s" msgstr "" #: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline #, object-pascal-format msgid "at $%s: from origin %s line %d" msgstr "" #: lazarusidestrconsts.dbgeventbreakataddresssourceline #, object-pascal-format msgid "at $%s: %s line %d" msgstr "" #: lazarusidestrconsts.dbgeventbreaksourcebreakpoint #, object-pascal-format msgid "Source Breakpoint %s" msgstr "" #: lazarusidestrconsts.dbgeventbreakunknownbreakpoint #, object-pascal-format msgid "Unknown Breakpoint %s" msgstr "" #: lazarusidestrconsts.dbgeventbreakwatchpoint #, object-pascal-format msgid "Watchpoint %s" msgstr "" #: lazarusidestrconsts.dbgeventunknownwatchpointscopeended #, object-pascal-format msgid "Unknown Watchpoint out of scope %s" msgstr "" #: lazarusidestrconsts.dbgeventunknownwatchpointtriggered #, object-pascal-format msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\"" msgstr "" #: lazarusidestrconsts.dbgeventwatchscopeended #, object-pascal-format msgid "Watchpoint for \"%s\" out of scope %s" msgstr "" #: lazarusidestrconsts.dbgeventwatchtriggered #, object-pascal-format msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\"" msgstr "" #: lazarusidestrconsts.dlfmousepredefinedscheme msgid "Use predefined scheme" msgstr "" #: lazarusidestrconsts.dlfmouseresetall msgid "Reset all settings" msgstr "" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" msgstr "" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint msgid "Add history point" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu msgid "Context Menu" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg msgid "Context Menu (debug)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab msgid "Context Menu (tab)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttondeclaration msgid "Jumps to implementation" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock msgid "Jumps to implementation/other block end" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonhistback msgid "History back" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonhistforw msgid "History forward" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle msgid "Toggle extra Caret" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonnothing msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing" msgid "Nothing/Default" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonpaste msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste" msgid "Paste" msgstr "Enganxa" #: lazarusidestrconsts.dlfmousesimplebuttonselcontinue #, object-pascal-format msgid "Continue %0:s (Bound to: %1:s)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain #, object-pascal-format msgid "Continue %0:s" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselect msgid "Select text" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselectbyline msgid "Select text (lines)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken msgid "Select text (tokens)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselectbyword msgid "Select text (words)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn msgid "Select text (Column mode)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonselectline msgid "Select text (Line mode)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark msgid "Set free bookmark" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull msgid "Select current Line (Full)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart msgid "Select current Line (Text)" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonsetpara msgid "Select current Paragraph" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonsetword msgid "Select current Word" msgstr "" #: lazarusidestrconsts.dlfmousesimplebuttonzoomreset msgid "Reset zoom" msgstr "" #: lazarusidestrconsts.dlfmousesimplediff msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" msgstr "" #: lazarusidestrconsts.dlfmousesimplegenericsect msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" msgid "General" msgstr "General" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on mouse down" msgstr "" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" msgstr "" #: lazarusidestrconsts.dlfmousesimplegutterleftupright msgid "Extended, Actions, right gutter half only" msgstr "" #: lazarusidestrconsts.dlfmousesimplegutterlines msgid "Use line numbers to select lines" msgstr "" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlfmousesimplerightmovecaret msgid "Right button click includes caret move" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsect msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel msgid "Alt-Ctrl Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel msgid "Alt-Ctrl Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectaltlabel msgid "Alt Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel msgid "Alt Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrllabel msgid "Ctrl Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel msgid "Ctrl Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectdrag msgid "Drag selection (copy/paste)" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectextra1label msgid "Extra-1 Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectextra2label msgid "Extra-2 Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel msgid "Alt Double" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel msgid "Ctrl Double" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" msgid "Double" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel msgid "Shift Double" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" msgid "Quad" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel" msgid "Triple" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidlabel msgid "Middle Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpagebtn msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn" msgid "Middle" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpageextra1 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1" msgid "Extra 1" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpageextra2 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2" msgid "Extra 2" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel msgid "Horizontal-Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpagelmod msgid "Left 1" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti msgid "Left 2" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectpageright msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.dlfmousesimpletextsectpagewheel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel" msgid "Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectrightlabel msgid "Right Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel msgid "Shift-Alt-Ctrl Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel msgid "Shift-Alt-Ctrl" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel msgid "Shift-Alt Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel msgid "Shift-Alt Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel msgid "Shift-Ctrl Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel msgid "Shift-Ctrl Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel msgid "Shift Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectwheellabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel" msgid "Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel msgid "Shift Wheel" msgstr "" #: lazarusidestrconsts.dlfmousesimplewarning msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelhsrolldef msgid "Scroll horizontal (System speed)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelhsrollline msgid "Scroll horizontal (Single line)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpage msgid "Scroll horizontal (Page)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf msgid "Scroll horizontal (Half page)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless msgid "Scroll horizontal (Page, less one line)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelnothing msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing" msgid "Nothing/Default" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelsrolldef msgid "Scroll (System speed)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelsrollline msgid "Scroll (Single line)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelsrollpage msgid "Scroll (Page)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf msgid "Scroll (Half page)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelsrollpageless msgid "Scroll (Page, less one line)" msgstr "" #: lazarusidestrconsts.dlfmousesimplewheelzoom msgid "Zoom" msgstr "" #: lazarusidestrconsts.dlfnopredefinedscheme msgid "< None >" msgstr "" #: lazarusidestrconsts.dlfreadonlycolor msgctxt "lazarusidestrconsts.dlfreadonlycolor" msgid "Read Only" msgstr "Només lectura" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" msgstr "Minúscules, primera lletra Maj." #: lazarusidestrconsts.dlgactivedesktop msgid "active" msgstr "" #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "" #: lazarusidestrconsts.dlgaddhiattrbracketmatch msgid "Brackets highlight" msgstr "" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtree msgid "Code folding tree" msgstr "" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur msgid "Code folding (current)" msgstr "" #: lazarusidestrconsts.dlgaddhiattrdefault msgid "Default Text" msgstr "" #: lazarusidestrconsts.dlgaddhiattrdefaultwindow msgid "Default Text / Window" msgstr "" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint msgid "Enabled breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrerrorline msgid "Error line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrexecutionpoint msgid "Execution point" msgstr "" #: lazarusidestrconsts.dlgaddhiattrfoldedcode msgid "Folded code marker" msgstr "" #: lazarusidestrconsts.dlgaddhiattrfoldedcodeline msgid "Fold start-line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupdefault msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" msgid "Global" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupgutter msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupifdef msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef" msgid "IfDef" msgstr "IfDef" #: lazarusidestrconsts.dlgaddhiattrgroupline msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" msgid "Line" msgstr "Línia" #: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors msgid "Outline Colors" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit msgid "Syncron Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlgaddhiattrgutterseparator msgid "Gutter Separator" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhiddencodeline msgid "Hide start-line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightall msgid "Incremental others" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightprefix msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix" msgid "Highlight prefix" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightword msgid "Highlight current word" msgstr "" #: lazarusidestrconsts.dlgaddhiattrincrementalsearch msgid "Incremental search" msgstr "" #: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint msgid "Invalid breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrlinehighlight msgid "Current line highlight" msgstr "" #: lazarusidestrconsts.dlgaddhiattrlinenumber msgid "Line number" msgstr "" #: lazarusidestrconsts.dlgaddhiattrmodifiedline msgid "Modified line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrmouselink msgid "Mouse link" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel10color msgid "Level 10" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel1color msgid "Level 1" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel2color msgid "Level 2" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel3color msgid "Level 3" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel4color msgid "Level 4" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel5color msgid "Level 5" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel6color msgid "Level 6" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel7color msgid "Level 7" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel8color msgid "Level 8" msgstr "" #: lazarusidestrconsts.dlgaddhiattroutlinelevel9color msgid "Level 9" msgstr "" #: lazarusidestrconsts.dlgaddhiattrrecentlyused msgid "Recently used item" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditarea msgid "Selected Area" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" msgid "Active Cell" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditother msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" msgid "Other Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" msgid "Syncronized Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" msgid "Active Cell" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditother msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" msgid "Other Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" msgid "Syncronized Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtextblock msgid "Text block" msgstr "" #: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint msgid "Unknown breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrwindowborder msgid "Window border" msgstr "" #: lazarusidestrconsts.dlgaddhiattrwordgroup msgid "Word-Brackets" msgstr "" #: lazarusidestrconsts.dlgaddhispecialvisiblechars msgid "Visualized Special Chars" msgstr "" #: lazarusidestrconsts.dlgaddnewmode msgid "Add new mode" msgstr "" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" msgstr "Afegeix punt i coma" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Ajusta la línia de sobre a causa del comentari de davant" #: lazarusidestrconsts.dlgalphabetically msgid "Alphabetically" msgstr "Alfabèticament" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always keep caret in visible area of editor" msgstr "" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" msgstr "" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" msgstr "Avisa al compilar" #: lazarusidestrconsts.dlganiconforerrorwarninghintisshown msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case." msgstr "" #: lazarusidestrconsts.dlgansicommenttab msgid "Ansi (* *)" msgstr "" #: lazarusidestrconsts.dlgapplicationsettings #, fuzzy #| msgid "Application Settings" msgid "Application settings" msgstr "Paràmetres de l'aplicació" #: lazarusidestrconsts.dlgassertcode #, fuzzy #| msgid "Include Assertion Code" msgid "Include assertion code" msgstr "Inclou el codi afirmat" #: lazarusidestrconsts.dlgassociateddebugdesktop #, object-pascal-format msgid "Associated debug desktop for \"%s\"" msgstr "" #: lazarusidestrconsts.dlgassociateddebugdesktophint msgid "If you select the desktop, the associated debug desktop will be selected as well." msgstr "" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" msgstr "Crea les formes automàticament" #: lazarusidestrconsts.dlgautocreateformshint msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically." msgstr "" #: lazarusidestrconsts.dlgautocreatenewforms #, fuzzy #| msgid "When creating new forms, add them to auto-created forms" msgid "Auto-create new forms" msgstr "Quan es creen noves formes, afegeix-les a les formes creades automàticament" #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" msgstr "Elimina el fitxer automàticament" #: lazarusidestrconsts.dlgautodisplayfuncproto msgid "Auto Display Function Prototypes" msgstr "" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse pointer when typing" msgstr "" #: lazarusidestrconsts.dlgautoindent msgctxt "lazarusidestrconsts.dlgautoindent" msgid "Auto indent" msgstr "" #: lazarusidestrconsts.dlgautoindentlink msgid "(Set up smart indent)" msgstr "" #: lazarusidestrconsts.dlgautoindenttype msgctxt "lazarusidestrconsts.dlgautoindenttype" msgid "Auto indent" msgstr "" #: lazarusidestrconsts.dlgautoremoveemptymethods msgid "Auto remove empty methods" msgstr "" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" msgstr "Canvia el nom del fitxer a minúscules automàticament" #: lazarusidestrconsts.dlgautosaveactivedesktop msgid "Auto save active desktop" msgstr "" #: lazarusidestrconsts.dlgautosaveactivedesktophint msgid "" "Save active desktop on IDE close\n" "Save debug desktop on IDE close and debug end" msgstr "" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" msgstr "Formes disponibles:" #: lazarusidestrconsts.dlgavailableformshint msgid "These forms must be created and freed in the program code." msgstr "" #: lazarusidestrconsts.dlgavoidunnecessaryjumps msgid "Avoid unnecessary jumps" msgstr "" #: lazarusidestrconsts.dlgbackcolor msgid "Background" msgstr "Rerefons" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(Cap subdirectori)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "El mateix nom (a un subdirectori)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" msgstr "Darrera dels mètodes" #: lazarusidestrconsts.dlgblockgroupoptions #, fuzzy msgctxt "lazarusidestrconsts.dlgblockgroupoptions" msgid "Selection" msgstr "Selecció" #: lazarusidestrconsts.dlgblockindent msgid "Block indent (spaces)" msgstr "" #: lazarusidestrconsts.dlgblockindentkeys msgid "Block indent" msgstr "" #: lazarusidestrconsts.dlgblockindentlink msgid "(edit keys)" msgstr "" #: lazarusidestrconsts.dlgblockindenttypecopy msgid "Space/tab as prev Line" msgstr "" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" msgstr "" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" msgstr "" #: lazarusidestrconsts.dlgblockindenttypetabonly msgid "Tabs, cut off" msgstr "" #: lazarusidestrconsts.dlgblockindenttypetabspace msgid "Tabs, then spaces" msgstr "" #: lazarusidestrconsts.dlgblocktabindent msgid "Block indent (tabs)" msgstr "" #: lazarusidestrconsts.dlgbookmarksetscroll msgid "Restore scroll position for bookmarks" msgstr "" #: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0." msgstr "" #: lazarusidestrconsts.dlgborderspacingcolor msgid "BorderSpacing frame" msgstr "" #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" msgstr "" #: lazarusidestrconsts.dlgbracketmatchgroup msgid "Matching bracket and quote pairs" msgstr "" #: lazarusidestrconsts.dlgcannotusedockedundockeddesktop msgid "You cannot use docked desktop in undocked environment and vice versa." msgstr "" #: lazarusidestrconsts.dlgcaretbackcolor msgid "Secondary carets (multi-caret mode)" msgstr "" #: lazarusidestrconsts.dlgcaretcolor msgctxt "lazarusidestrconsts.dlgcaretcolor" msgid "Caret (Text-Cursor)" msgstr "" #: lazarusidestrconsts.dlgcaretcolorinfo msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB." msgstr "" #: lazarusidestrconsts.dlgcaretforecolor msgid "Main or primary caret" msgstr "" #: lazarusidestrconsts.dlgcaretgroupoptions msgid "Caret (Text Cursor)" msgstr "" #: lazarusidestrconsts.dlgcaretscrollgroupoptions msgid "Caret (Text Cursor) past end of line" msgstr "" #: lazarusidestrconsts.dlgcasesensitive msgctxt "lazarusidestrconsts.dlgcasesensitive" msgid "&Case sensitive" msgstr "" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" msgstr "" #: lazarusidestrconsts.dlgccoorphanedfilefound #, object-pascal-format msgid "orphaned file found: %s" msgstr "" #: lazarusidestrconsts.dlgccoresults msgid "Results" msgstr "" #: lazarusidestrconsts.dlgccotest msgctxt "lazarusidestrconsts.dlgccotest" msgid "Test" msgstr "Prova" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "" #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "" #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "" #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "" #: lazarusidestrconsts.dlgccotestrtlunits msgid "Test: Checking RTL units ..." msgstr "" #: lazarusidestrconsts.dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "" #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "" #: lazarusidestrconsts.dlgccousingconfigfile #, object-pascal-format msgid "using config file %s" msgstr "" #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" msgstr "Ordre de la classe" #: lazarusidestrconsts.dlgcdtlast msgid "Last" msgstr "Últim" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" msgstr "minúscules" #: lazarusidestrconsts.dlgcdtpreview #, fuzzy #| msgid "Preview (Max line length = 1)" msgid "Preview (max line length = 1)" msgstr "Visualització prèvia (long. màx. línia = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" msgstr "Prefix de llegir" #: lazarusidestrconsts.dlgcdtstoredpostfix msgid "Stored postfix" msgstr "Postfix de desat" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" msgstr "MAJÚSCULES" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" msgstr "Prefix de la variable" #: lazarusidestrconsts.dlgcdtwriteprefix msgid "Write prefix" msgstr "Prefix d'escriure" #: lazarusidestrconsts.dlgcharcasefileact #, fuzzy #| msgid "Save As - auto rename pascal files lower case" msgid "Save As - auto rename Pascal files lower case" msgstr "Anomena i desa - fica el nom dels fitxers Pascal en minúscules" #: lazarusidestrconsts.dlgcheckandautosavefiles msgid "Check and Auto Save Files" msgstr "" #: lazarusidestrconsts.dlgcheckpackagesonformcreate msgid "Check packages on form create" msgstr "" #: lazarusidestrconsts.dlgcheckpackagesonformcreatehint msgid "The form may require a package to work. Install such a package automatically." msgstr "" #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Tria un fitxer de plantilla (*.dci)" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "Mostra els botons de tancar en el llibre de notes" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" msgstr "Esquema de Color" #: lazarusidestrconsts.dlgcmacro #, fuzzy #| msgid "C Style Macros (global)" msgid "C style macros (global)" msgstr "Macroinstruccions estil C (global)" #: lazarusidestrconsts.dlgcoansistr #, fuzzy #| msgid "Use ansi strings" msgctxt "lazarusidestrconsts.dlgcoansistr" msgid "Use Ansistrings" msgstr "Utilitza Ansi Strings" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style" msgstr "" #: lazarusidestrconsts.dlgcocfgcmpmessages #, fuzzy msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" msgid "Messages" msgstr "Missatges" #: lazarusidestrconsts.dlgcochecksandassertion msgid "Checks and assertion" msgstr "" #: lazarusidestrconsts.dlgcocompilercommands msgid "Compiler Commands" msgstr "" #: lazarusidestrconsts.dlgcocops #, fuzzy #| msgid "C Style Operators (*=, +=, /= and -=)" msgid "C style operators (*=, +=, /= and -=)" msgstr "Operadors estil C (*=, +=, /= i -=)" #: lazarusidestrconsts.dlgcocreatemakefile msgctxt "lazarusidestrconsts.dlgcocreatemakefile" msgid "Create Makefile" msgstr "Crea Makefile" #: lazarusidestrconsts.dlgcodebugging #, fuzzy #| msgid "Debugging info" msgctxt "lazarusidestrconsts.dlgcodebugging" msgid "Debugging" msgstr "Depuració" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Afegeix la trajectòria addicional del depurador (cap):" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" msgstr "Creació del codi" #: lazarusidestrconsts.dlgcodefoldenableboth msgid "Both" msgstr "" #: lazarusidestrconsts.dlgcodefoldenablefold msgid "Fold" msgstr "" #: lazarusidestrconsts.dlgcodefoldenablehide msgid "Hide" msgstr "" #: lazarusidestrconsts.dlgcodefoldpopuporder msgid "Reverse fold-order in Popup" msgstr "" #: lazarusidestrconsts.dlgcogdb #, fuzzy #| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)" msgid "Generate info for the debugger (slower / increases exe-size)" msgstr "Genera informació de depuració pel GDB (Compilació més lenta)" #: lazarusidestrconsts.dlgcoheaptrc #, fuzzy #| msgid "Use Heaptrc Unit (check for mem-leaks)" msgid "Use Heaptrc unit (check for mem-leaks)" msgstr "Utilitza unitat Heaptrc" #: lazarusidestrconsts.dlgcoincfiles #, fuzzy #| msgid "Include Files (-Fi):" msgid "Include files (-Fi):" msgstr "Fitxers Inclosos (-Fi):" #: lazarusidestrconsts.dlgcoinfoforgdb msgid "Debugger info" msgstr "" #: lazarusidestrconsts.dlgcolibraries msgid "Libraries (-Fl):" msgstr "Biblioteques (-Fl):" #: lazarusidestrconsts.dlgcolinking msgid "Linking" msgstr "Enllaçament" #: lazarusidestrconsts.dlgcoloadsavehint #, fuzzy #| msgid "Load/Save" msgctxt "lazarusidestrconsts.dlgcoloadsavehint" msgid "Compiler options can be saved to an XML file." msgstr "Carrega/Desa" #: lazarusidestrconsts.dlgcolorlink msgid "(Edit Color)" msgstr "" #: lazarusidestrconsts.dlgcolornotmodified msgid "Not modified" msgstr "" #: lazarusidestrconsts.dlgcolors msgctxt "lazarusidestrconsts.dlgcolors" msgid "Colors" msgstr "Colors" #: lazarusidestrconsts.dlgcolorstml msgid "TML Setup" msgstr "" #: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile #, object-pascal-format msgid "Sample text file not found: %1:s" msgstr "" #: lazarusidestrconsts.dlgcolorstmlerror msgid "Error:" msgstr "" #: lazarusidestrconsts.dlgcolorstmlfromfile msgid "File:" msgstr "" #: lazarusidestrconsts.dlgcolorstmlinfo #, object-pascal-format msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed." msgstr "" #: lazarusidestrconsts.dlgcolorstmlmissinginclude #, object-pascal-format msgid "Did not find all includes: %1:s" msgstr "" #: lazarusidestrconsts.dlgcolorstmlnofilesfound msgid "No files found." msgstr "" #: lazarusidestrconsts.dlgcolorstmlnosampletxt msgid "No sample text configured" msgstr "" #: lazarusidestrconsts.dlgcolorstmlok msgid "OK" msgstr "" #: lazarusidestrconsts.dlgcolorstmlrefresh msgid "Reload" msgstr "" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "Paràmetres de la línia d'ordres (sense nom d'aplicació)" #: lazarusidestrconsts.dlgcommentalignmaxdefault msgid "Max indent for new line if prefix is based on start of comment on first comment line:" msgstr "" #: lazarusidestrconsts.dlgcommentalignmaxtoken msgid "Limit indent to" msgstr "" #: lazarusidestrconsts.dlgcommentcontinue msgid "Prefix comments on linebreak" msgstr "" #: lazarusidestrconsts.dlgcommentcontinuematch msgid "Match current line" msgstr "" #: lazarusidestrconsts.dlgcommentcontinuematchasterisk msgid "Match text including \"*\" of token \"(*\"" msgstr "" #: lazarusidestrconsts.dlgcommentcontinuematchline msgid "Match whole line" msgstr "" #: lazarusidestrconsts.dlgcommentcontinuematchtext #, object-pascal-format msgid "Match text after token \"%s\"" msgstr "" #: lazarusidestrconsts.dlgcommentcontinuematchtoken #, object-pascal-format msgid "Match text including token \"%s\"" msgstr "" #: lazarusidestrconsts.dlgcommentcontinueprefix msgid "Prefix new line" msgstr "" #: lazarusidestrconsts.dlgcommentcontinueprefixinddefault msgid "Align Prefix at indent of previous line" msgstr "" #: lazarusidestrconsts.dlgcommentcontinueprefixindmatch msgid "Align Prefix below start of comment on first comment line" msgstr "" #: lazarusidestrconsts.dlgcommentcontinueprefixindnone msgid "Do not indent prefix" msgstr "" #: lazarusidestrconsts.dlgcommentindentgroupoptions msgid "Comments and Strings" msgstr "" #: lazarusidestrconsts.dlgcommentshlashextendalways msgid "Extend if matched or not matched" msgstr "" #: lazarusidestrconsts.dlgcommentshlashextendalwayssplit msgid "Extend if matched or not matched (not at EOL)" msgstr "" #: lazarusidestrconsts.dlgcommentshlashextendmatch msgid "Extend if matched" msgstr "" #: lazarusidestrconsts.dlgcommentshlashextendmatchsplit msgid "Extend if matched and caret in the middle of text (not at EOL)" msgstr "" #: lazarusidestrconsts.dlgcompilationandlinking msgid "Compilation and Linking" msgstr "" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler messages" msgstr "" #: lazarusidestrconsts.dlgcompilermessages msgid "Compiler messages language file (*.msg)" msgstr "" #: lazarusidestrconsts.dlgcompleteproperties msgid "Complete properties" msgstr "Completa les propietats" #: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected msgid "Component under mouse cursor is first selected, then the popup menu commands work on it." msgstr "" #: lazarusidestrconsts.dlgconfigandtarget msgid "Config and Target" msgstr "" #: lazarusidestrconsts.dlgconfigfiles #, fuzzy #| msgid "Config Files:" msgid "Config files" msgstr "Fitxers de configuració:" #: lazarusidestrconsts.dlgconsolesizenotsupported msgid "Current debugger does not support this." msgstr "" #: lazarusidestrconsts.dlgcootherdebugginginfo msgid "Other debugging info" msgstr "" #: lazarusidestrconsts.dlgcooverflow msgid "Overflow" msgstr "Sobreeiximent" #: lazarusidestrconsts.dlgcoparsing msgid "Parsing" msgstr "Analització" #: lazarusidestrconsts.dlgcopypastekeepfolds msgid "Copy/Paste with fold info" msgstr "" #: lazarusidestrconsts.dlgcopywordatcursoroncopynone msgid "Copy current word when no selection exists" msgstr "" #: lazarusidestrconsts.dlgcorange msgctxt "lazarusidestrconsts.dlgcorange" msgid "Range" msgstr "Abast" #: lazarusidestrconsts.dlgcorelocatable msgid "Relocatable" msgstr "" #: lazarusidestrconsts.dlgcosetasdefault msgid "Set compiler options as default" msgstr "" #: lazarusidestrconsts.dlgcoshowoptions #, fuzzy #| msgid "Show Options" msgid "&Show Options" msgstr "Mostra les opcions" #: lazarusidestrconsts.dlgcosmartlinkable #, fuzzy #| msgid "Smart Linkable" msgid "Smart linkable" msgstr "Enllaçament intel·ligent" #: lazarusidestrconsts.dlgcosources #, fuzzy #| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Altres fonts (fitxers .pp/.pas, només utilitzat per l'IDE no pel compilador)" #: lazarusidestrconsts.dlgcostack msgid "Stack" msgstr "Pila" #: lazarusidestrconsts.dlgcostrip #, fuzzy #| msgid "Strip Symbols From Executable" msgid "Strip symbols from executable" msgstr "Elimina els símbols de l'executable" #: lazarusidestrconsts.dlgcosymboltype msgid "Type of debug info" msgstr "" #: lazarusidestrconsts.dlgcosymboltypeauto msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" msgid "Automatic" msgstr "" #: lazarusidestrconsts.dlgcosymboltypedwarf2 msgid "Dwarf 2" msgstr "" #: lazarusidestrconsts.dlgcosymboltypedwarf2set msgid "Dwarf 2 with sets" msgstr "" #: lazarusidestrconsts.dlgcosymboltypedwarf3 msgid "Dwarf 3 (beta)" msgstr "" #: lazarusidestrconsts.dlgcosymboltypestabs msgid "Stabs" msgstr "" #: lazarusidestrconsts.dlgcotrashvariables msgid "Trash variables" msgstr "" #: lazarusidestrconsts.dlgcounitstyle #, fuzzy #| msgid "Unit Style" msgid "Unit style" msgstr "Estil de la unitat:" #: lazarusidestrconsts.dlgcovalgrind msgid "Generate code for valgrind" msgstr "Genera codi pel Valgrind" #: lazarusidestrconsts.dlgcoverbosity msgid "Verbosity" msgstr "" #: lazarusidestrconsts.dlgcppinline #, fuzzy #| msgid "C++ Styled INLINE" msgid "C++ styled INLINE" msgstr "INLINE estil C++" #: lazarusidestrconsts.dlgcreatenewrunparameterssettings msgid "Create new Run Parameters settings" msgstr "" #: lazarusidestrconsts.dlgcurlycommenttab msgid "Curly { }" msgstr "" #: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow msgid "Currently respected by messages window, jump history and search results." msgstr "" #: lazarusidestrconsts.dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "El cursor darrera EOL" #: lazarusidestrconsts.dlgcursormoveclearsselection msgid "Caret left/right clears selection (no move)" msgstr "" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Caret skips selection" msgstr "" #: lazarusidestrconsts.dlgcursorskipstab msgid "Caret skips tabs" msgstr "" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Extensions definides per l'usuari (.pp.xxx)" #: lazarusidestrconsts.dlgdebugdesktop msgid "debug" msgstr "" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" msgstr "Tipus i trajectòria del depurador" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" msgstr "Font de l'editor predeterminat" #: lazarusidestrconsts.dlgdefaulttabfont msgid "Default tab font" msgstr "" #: lazarusidestrconsts.dlgdefaultwinpos msgid "Default Window/Console position and size" msgstr "" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" msgstr "Valor per defecte" #: lazarusidestrconsts.dlgdeletemode msgid "Delete mode" msgstr "" #: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption #, fuzzy msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption" msgid "Delete" msgstr "Elimina" #: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint msgid "Delete selected desktop" msgstr "" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " msgstr "Elimina la plantilla" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " msgstr "" #: lazarusidestrconsts.dlgdesktophints msgid "Hints" msgstr "" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " msgstr "" #: lazarusidestrconsts.dlgdesktopname msgid "Desktop name" msgstr "" #: lazarusidestrconsts.dlgdesktopsexported #, object-pascal-format msgid "%d desktop(s) successfully exported to \"%s\"" msgstr "" #: lazarusidestrconsts.dlgdesktopsimported #, object-pascal-format msgid "%d desktop(s) successfully imported from \"%s\"" msgstr "" #: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor msgid "Different values background" msgstr "" #: lazarusidestrconsts.dlgdirection msgid "Direction" msgstr "Direcció" #: lazarusidestrconsts.dlgdisableantialiasing msgid "Disable anti-aliasing" msgstr "" #: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep msgid "Distance between grid points is the smallest step when moving a control." msgstr "" #: lazarusidestrconsts.dlgdividercolordefault msgid "Use right margin color" msgstr "" #: lazarusidestrconsts.dlgdividerdrawdepth msgid "Draw divider level" msgstr "" #: lazarusidestrconsts.dlgdividernestcolor msgid "Nested line color" msgstr "" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" msgstr "" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" msgstr "" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" msgstr "" #: lazarusidestrconsts.dlgdivpasstructglobalname msgid "Class/Struct" msgstr "" #: lazarusidestrconsts.dlgdivpasstructlocalname msgid "Class/Struct (local)" msgstr "" #: lazarusidestrconsts.dlgdivpastryname msgid "Try/Except" msgstr "" #: lazarusidestrconsts.dlgdivpasunitsectionname msgid "Unit sections" msgstr "" #: lazarusidestrconsts.dlgdivpasusesname msgid "Uses clause" msgstr "" #: lazarusidestrconsts.dlgdivpasvarglobalname msgid "Var/Type" msgstr "" #: lazarusidestrconsts.dlgdivpasvarlocalname msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgdrawcomponentsnamebelowit msgid "Draw the component's name below it." msgstr "" #: lazarusidestrconsts.dlgedback msgid "Back" msgstr "Torna" #: lazarusidestrconsts.dlgedbold msgid "Bold" msgstr "Negreta" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" msgstr "Subdirectori" #: lazarusidestrconsts.dlgedcodetempl #, fuzzy #| msgid "Code templates" msgctxt "lazarusidestrconsts.dlgedcodetempl" msgid "Code Templates" msgstr "Plantilles del codi" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Add close statement for Pascal blocks" msgstr "" #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" msgstr "Extensió definida per l'usuari" #: lazarusidestrconsts.dlgeddelayinsec #, object-pascal-format msgid "(%s sec delay)" msgstr "" #: lazarusidestrconsts.dlgeddisplay msgid "Display" msgstr "Visualitza a pantalla" #: lazarusidestrconsts.dlgedfiles #, fuzzy #| msgid "Editor files" msgid "Editor Files" msgstr "Fitxers de l'editor" #: lazarusidestrconsts.dlgedidcomlet msgctxt "lazarusidestrconsts.dlgedidcomlet" msgid "Identifier completion" msgstr "Completa l'identificador" #: lazarusidestrconsts.dlgedinvert msgid "Invert" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit msgid "Ignore Locks, use longest unused editor" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit msgid "Ignore Locks, if editor is current" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin msgid "Ignore Locks, if editor in current window" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionlockedinview msgid "Locked, if text in view" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlocked msgid "Unlocked" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview msgid "Unlocked, if text in centered view" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin msgid "New tab, existing or new window" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin msgid "New tab in new window" msgstr "" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin msgid "New tab in existing window" msgstr "" #: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." msgstr "" #: lazarusidestrconsts.dlgeditaccessdesclockedinview msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlocked msgid "This option will use any not locked Editor." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet." msgstr "" #: lazarusidestrconsts.dlgedital msgid "Italic" msgstr "Itàlica" #: lazarusidestrconsts.dlgeditexportbackcolor msgid "Use Background color in HTML export" msgstr "" #: lazarusidestrconsts.dlgeditmaxlength msgid "(Edit Max Length)" msgstr "" #: lazarusidestrconsts.dlgeditorfontsize msgid "Editor font size" msgstr "" #: lazarusidestrconsts.dlgeditoroptions msgctxt "lazarusidestrconsts.dlgeditoroptions" msgid "Editor options" msgstr "" #: lazarusidestrconsts.dlgeditschemdefaults msgid "Scheme globals" msgstr "" #: lazarusidestrconsts.dlgedmisc #, fuzzy msgctxt "lazarusidestrconsts.dlgedmisc" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgedoff msgid "Off" msgstr "" #: lazarusidestrconsts.dlgedon msgid "On" msgstr "" #: lazarusidestrconsts.dlgedtabindent msgid "Tab and Indent" msgstr "" #: lazarusidestrconsts.dlgedunder msgid "Underline" msgstr "Subratllat" #: lazarusidestrconsts.dlgelastictabs msgid "Elastic tabs" msgstr "" #: lazarusidestrconsts.dlgelastictabswidths msgid "Elastic min Widths" msgstr "" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" msgstr "" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" msgstr "" #: lazarusidestrconsts.dlgenvask msgid "Ask" msgstr "Demana" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Nota: Els fitxers del projecte son tots els fitxers del directori del projecte" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" msgstr "Còpia de seguretat" #: lazarusidestrconsts.dlgenvfiles msgid "Files" msgstr "Fitxers" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" msgstr "Graella" #: lazarusidestrconsts.dlgenvidestartup msgid "IDE Startup" msgstr "" #: lazarusidestrconsts.dlgenvlanguage msgctxt "lazarusidestrconsts.dlgenvlanguage" msgid "Language" msgstr "Llenguatge" #: lazarusidestrconsts.dlgenvlanguagerestarthint msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint" msgid "Restart the IDE to complete the language change." msgstr "" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" msgstr "Línies de la guia" #: lazarusidestrconsts.dlgenvmisc msgctxt "lazarusidestrconsts.dlgenvmisc" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgenvnone msgctxt "lazarusidestrconsts.dlgenvnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.dlgenvotherfiles #, fuzzy #| msgid "Other files" msgid "Other Files" msgstr "Altres fitxers" #: lazarusidestrconsts.dlgenvproject #, fuzzy #| msgid "Project" msgid "Tabs for project" msgstr "Projecte" #: lazarusidestrconsts.dlgenvtype msgctxt "lazarusidestrconsts.dlgenvtype" msgid "Type" msgstr "Tipus" #: lazarusidestrconsts.dlgeofocusmessagesatcompilation msgid "Focus messages at compilation" msgstr "" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra character spacing" msgstr "" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" msgstr "Espaiat extra entre línies" #: lazarusidestrconsts.dlgextsymb msgid "Use external debug symbols file" msgstr "" #: lazarusidestrconsts.dlgfileassociationinos msgid "Opening Files from OS" msgstr "" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" msgstr "Extensions d'Arxiu" #: lazarusidestrconsts.dlgfiles #, object-pascal-format msgid "%s files" msgstr "" #: lazarusidestrconsts.dlgfilterall #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterall" msgid "All files" msgstr "Tots els fitxers" #: lazarusidestrconsts.dlgfiltercodetoolstemplatefile msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile" msgid "CodeTools template file" msgstr "" #: lazarusidestrconsts.dlgfilterdcifile msgid "DCI file" msgstr "" #: lazarusidestrconsts.dlgfilterdelphiform msgid "Delphi form" msgstr "" #: lazarusidestrconsts.dlgfilterdelphipackage msgctxt "lazarusidestrconsts.dlgfilterdelphipackage" msgid "Delphi package" msgstr "" #: lazarusidestrconsts.dlgfilterdelphiproject #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterdelphiproject" msgid "Delphi project" msgstr "Projecte Delphi" #: lazarusidestrconsts.dlgfilterdelphiunit msgctxt "lazarusidestrconsts.dlgfilterdelphiunit" msgid "Delphi unit" msgstr "" #: lazarusidestrconsts.dlgfilterexecutable msgctxt "lazarusidestrconsts.dlgfilterexecutable" msgid "Executable" msgstr "" #: lazarusidestrconsts.dlgfilterfpcmessagefile msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile" msgid "FPC message file" msgstr "" #: lazarusidestrconsts.dlgfilterfppkgconfigurationfile msgid "Fppkg configuration file" msgstr "" #: lazarusidestrconsts.dlgfilterhtml msgid "HTML files" msgstr "" #: lazarusidestrconsts.dlgfilterimagesbitmap msgid "Bitmap images" msgstr "" #: lazarusidestrconsts.dlgfilterimagespixmap msgid "Pixmap images" msgstr "" #: lazarusidestrconsts.dlgfilterimagespng msgid "PNG images" msgstr "" #: lazarusidestrconsts.dlgfilterlazarusdesktopsettings msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings" msgid "Lazarus Desktop Settings" msgstr "" #: lazarusidestrconsts.dlgfilterlazaruseditorfile msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile" msgid "Editor file types" msgstr "" #: lazarusidestrconsts.dlgfilterlazarusfile #, fuzzy #| msgid "Lazarus File" msgctxt "lazarusidestrconsts.dlgfilterlazarusfile" msgid "Lazarus file" msgstr "Arxiu Lazarus" #: lazarusidestrconsts.dlgfilterlazarusform #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterlazarusform" msgid "Lazarus form" msgstr "Forma Lazarus" #: lazarusidestrconsts.dlgfilterlazarusinclude msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude" msgid "Lazarus include file" msgstr "" #: lazarusidestrconsts.dlgfilterlazarusotherfile msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile" msgid "Lazarus other file" msgstr "" #: lazarusidestrconsts.dlgfilterlazaruspackage #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage" msgid "Lazarus package" msgstr "Paquet Lazarus" #: lazarusidestrconsts.dlgfilterlazarusproject #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterlazarusproject" msgid "Lazarus project" msgstr "Projecte Lazarus" #: lazarusidestrconsts.dlgfilterlazarusprojectsource #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource" msgid "Lazarus project source" msgstr "Font de projecte Lazarus" #: lazarusidestrconsts.dlgfilterlazarussession msgid "Lazarus session" msgstr "" #: lazarusidestrconsts.dlgfilterlazarusunit #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterlazarusunit" msgid "Lazarus unit" msgstr "Unitat Lazarus" #: lazarusidestrconsts.dlgfilterpackagelistfiles msgid "Package list files" msgstr "" #: lazarusidestrconsts.dlgfilterpascalfile msgctxt "lazarusidestrconsts.dlgfilterpascalfile" msgid "Pascal file" msgstr "" #: lazarusidestrconsts.dlgfilterprograms msgctxt "lazarusidestrconsts.dlgfilterprograms" msgid "Programs" msgstr "" #: lazarusidestrconsts.dlgfilterxml #, fuzzy msgctxt "lazarusidestrconsts.dlgfilterxml" msgid "XML files" msgstr "Arxius XML" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" msgstr "Cerca el text al cursor" #: lazarusidestrconsts.dlgfolddiffchunk msgid "Chunk" msgstr "" #: lazarusidestrconsts.dlgfolddiffchunksect msgid "Chunk section" msgstr "" #: lazarusidestrconsts.dlgfoldhtmlasp msgid "ASP" msgstr "" #: lazarusidestrconsts.dlgfoldhtmlcomment msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" msgid "Comment" msgstr "" #: lazarusidestrconsts.dlgfoldhtmlnode msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" msgid "Node" msgstr "" #: lazarusidestrconsts.dlgfoldlfmitem msgid "Item" msgstr "" #: lazarusidestrconsts.dlgfoldlfmlist msgid "List <>" msgstr "" #: lazarusidestrconsts.dlgfoldlfmobject msgid "Object (inherited, inline)" msgstr "" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgfoldpasanonprocedure msgid "Anonymous Procedure" msgstr "" #: lazarusidestrconsts.dlgfoldpasansicomment msgid "Comment (* *)" msgstr "" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" msgstr "" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" msgstr "" #: lazarusidestrconsts.dlgfoldpasborcomment msgid "Comment { }" msgstr "" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" msgstr "" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" msgstr "" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" msgstr "" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" msgstr "" #: lazarusidestrconsts.dlgfoldpasfordo msgid "For/Do" msgstr "" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" msgstr "" #: lazarusidestrconsts.dlgfoldpasifthen msgid "If/Then/Else" msgstr "" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" msgid "Procedure" msgstr "Procediment" #: lazarusidestrconsts.dlgfoldpasprogram msgctxt "lazarusidestrconsts.dlgfoldpasprogram" msgid "Program" msgstr "programa" #: lazarusidestrconsts.dlgfoldpasrecord msgctxt "lazarusidestrconsts.dlgfoldpasrecord" msgid "Record" msgstr "" #: lazarusidestrconsts.dlgfoldpasrecordcase msgid "Record case" msgstr "" #: lazarusidestrconsts.dlgfoldpasrecordcasesect msgid "Record case section" msgstr "" #: lazarusidestrconsts.dlgfoldpasrepeat msgctxt "lazarusidestrconsts.dlgfoldpasrepeat" msgid "Repeat" msgstr "" #: lazarusidestrconsts.dlgfoldpasslashcomment msgid "Comment //" msgstr "" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" msgstr "" #: lazarusidestrconsts.dlgfoldpasunit msgctxt "lazarusidestrconsts.dlgfoldpasunit" msgid "Unit" msgstr "Unitat" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" msgstr "" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" msgstr "" #: lazarusidestrconsts.dlgfoldpasuses msgctxt "lazarusidestrconsts.dlgfoldpasuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" msgstr "" #: lazarusidestrconsts.dlgfoldpaswhiledo msgid "While/Do" msgstr "" #: lazarusidestrconsts.dlgfoldpaswithdo msgid "With/Do" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcdata msgid "CData" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcomment msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" msgid "Comment" msgstr "" #: lazarusidestrconsts.dlgfoldxmldoctype msgid "DocType" msgstr "" #: lazarusidestrconsts.dlgfoldxmlnode msgctxt "lazarusidestrconsts.dlgfoldxmlnode" msgid "Node" msgstr "" #: lazarusidestrconsts.dlgfoldxmlprocess msgid "Processing Instruction" msgstr "" #: lazarusidestrconsts.dlgforcedpiscalingindesigntime msgid "Force DPI scaling in design-time" msgstr "" #: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account." msgstr "" #: lazarusidestrconsts.dlgforceuniqueinstancemodalerror msgid "The running Lazarus instance cannot accept any files." msgstr "" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" msgstr "Color primer pla " #: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector msgid "Change Object Inspector contents on clicking form title bar" msgstr "" #: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint msgid "Show a form's properties in Object Inspector by clicking on its title bar." msgstr "" #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "Política d'inserir procediments" #: lazarusidestrconsts.dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Manté l'ordre dels procediments" #: lazarusidestrconsts.dlgfpcexecutable #, object-pascal-format msgid "Compiler executable (e.g. %s)" msgstr "" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" msgstr "Directori del codi font del FPC" #: lazarusidestrconsts.dlgfppkgconfigurationfile msgid "Fppkg configuration file (e.g. fppkg.cfg)" msgstr "" #: lazarusidestrconsts.dlgframecolor msgid "Text-mark" msgstr "" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" msgstr "Editor de forma" #: lazarusidestrconsts.dlgfrombeginning msgid "From b&eginning" msgstr "" #: lazarusidestrconsts.dlgfromcursor msgid "From c&ursor" msgstr "" #: lazarusidestrconsts.dlgglobal msgid "&Global" msgstr "" #: lazarusidestrconsts.dlggprof msgid "Generate code for gprof" msgstr "Genera codi pel gprof" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" msgstr "Color capturador" #: lazarusidestrconsts.dlggrayeddesktopsdocked msgid "Grayed desktops are for docked environment." msgstr "" #: lazarusidestrconsts.dlggrayeddesktopsundocked msgid "Grayed desktops are for undocked environment." msgstr "" #: lazarusidestrconsts.dlggridcolor msgid "Grid color" msgstr "Color de la graella" #: lazarusidestrconsts.dlggridconsistsofsmalldots msgid "Grid consists of small dots which help aligning controls." msgstr "" #: lazarusidestrconsts.dlggridx msgid "Grid size X" msgstr "Tamany X de la graella" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" msgstr "Tamany horitzontal del pas de la graella" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" msgstr "Tamany Y de la graella" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" msgstr "Tamany vertical del pas de la graella" #: lazarusidestrconsts.dlggroupcodeexplorer #, fuzzy msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" msgid "Code Explorer" msgstr "Explorador del codi" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" msgstr "" #: lazarusidestrconsts.dlggroupdebugger msgctxt "lazarusidestrconsts.dlggroupdebugger" msgid "Debugger" msgstr "" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" msgstr "" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" msgid "Environment" msgstr "Entorn" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" msgstr "" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" msgstr "Mostra les línies de la guia" #: lazarusidestrconsts.dlgguidelineshint msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown." msgstr "" #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgguttercollapsedcolor msgid "Collapsed" msgstr "" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" msgstr "Color del canal" #: lazarusidestrconsts.dlgguttercurrentlinenumber msgid "Current Line (number)" msgstr "" #: lazarusidestrconsts.dlgguttercurrentlineother msgid "Current Line (other)" msgstr "" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" msgstr "" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" msgstr "" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" msgstr "Desplaça mitja pàgina" #: lazarusidestrconsts.dlgheapandstacksize msgid "Heap and stack sizes" msgstr "" #: lazarusidestrconsts.dlgheapsize #, fuzzy #| msgid "Heap Size" msgid "Heap size" msgstr "Tamany del montícul" #: lazarusidestrconsts.dlgheightofonepropertyingrid msgid "Height of one property in the grid." msgstr "" #: lazarusidestrconsts.dlgheightpos msgid "Height:" msgstr "Alçada" #: lazarusidestrconsts.dlghideideonrun #, fuzzy #| msgid "Hide IDE windows on run" msgid "Hide IDE windows on Run/Debug" msgstr "Amaga les finestres de l'IDE durant l'execució" #: lazarusidestrconsts.dlghideideonrunhint msgid "Do not show the IDE at all while program is running." msgstr "" #: lazarusidestrconsts.dlghidesingletabinnotebook msgid "Hide tab in single page windows" msgstr "" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" msgstr "" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" msgstr "" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Caret" msgstr "" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Caret" msgstr "" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show hints for parameter \"Sender\" not used" msgstr "" #: lazarusidestrconsts.dlghintsunused #, fuzzy #| msgid "Show Hints for unused units in main source" msgid "Show hints for unused units in main" msgstr "Mostra els suggeriments per les unitats no utilitzades en la font principal" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "La tecla d'inici salta al començament més proper" #: lazarusidestrconsts.dlghostapplication msgid "Host application" msgstr "Aplicació de l'amfitrió" #: lazarusidestrconsts.dlgidentifiercompletion #, fuzzy #| msgid "Identifier completion" msgctxt "lazarusidestrconsts.dlgidentifiercompletion" msgid "Identifier Completion" msgstr "Completa l'identificador" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" msgstr "Política d'identificador" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" msgstr "" #: lazarusidestrconsts.dlgifdefblockactive msgid "Active $IFDEF code" msgstr "" #: lazarusidestrconsts.dlgifdefblockinactive msgid "Inactive $IFDEF code" msgstr "" #: lazarusidestrconsts.dlgifdefblocktmpactive msgid "Included mixed state $IFDEF code" msgstr "" #: lazarusidestrconsts.dlgifdefnodeactive msgid "Active $IFDEF node" msgstr "" #: lazarusidestrconsts.dlgifdefnodeinactive msgid "Inactive $IFDEF node" msgstr "" #: lazarusidestrconsts.dlgifdefnodetmpactive msgid "Included mixed state $IFDEF node" msgstr "" #: lazarusidestrconsts.dlgimportdesktopexists msgid "" "A desktop with the same name already exists.\n" "Please confirm the desktop name:" msgstr "" #: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl msgid "Include code templates" msgstr "" #: lazarusidestrconsts.dlgincludeidentifierscontainingprefix msgid "Include identifiers containing prefix" msgstr "" #: lazarusidestrconsts.dlgincludekeywordstoidentcompl msgid "Include all keywords and operators" msgstr "" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" msgstr "Inclou les variables del sistema" #: lazarusidestrconsts.dlgincludewordstoidentcompl msgid "Include words" msgstr "" #: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude msgid "don't include" msgstr "" #: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits msgid "from all units" msgstr "" #: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit msgid "from current unit" msgstr "" #: lazarusidestrconsts.dlgindentsindentgroupoptions msgid "Indent" msgstr "" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Tabs" msgstr "" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" msgstr "Davant dels mètodes" #: lazarusidestrconsts.dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "El nom del constructor ha de ser 'init' (el del destructor ha de ser 'done')" #: lazarusidestrconsts.dlginsertclassparts msgid "Insert class parts" msgstr "" #: lazarusidestrconsts.dlginsertimplementation msgid "Implementation" msgstr "" #: lazarusidestrconsts.dlginsertinterface msgid "Interface" msgstr "" #: lazarusidestrconsts.dlginsertmethods msgid "Insert method implementations" msgstr "" #: lazarusidestrconsts.dlginsertsection msgid "Insert into Uses section of" msgstr "" #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" msgstr "Insereix espai després de" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" msgstr "Insereix espai davant de" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" msgstr "Interval en seg." #: lazarusidestrconsts.dlgjumpcodeblockpos msgid "Vertical position for a code block jump in % (0=top, 100=bottom)" msgstr "" #: lazarusidestrconsts.dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Salt (p.ex. Salta mètodes)" #: lazarusidestrconsts.dlgjumpsinglelinepos msgid "Vertical position for a single line jump in % (0=top, 100=bottom)" msgstr "" #: lazarusidestrconsts.dlgjumptomethodbody msgid "Jump directly to method body" msgstr "" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep caret X position when navigating up/down" msgstr "" #: lazarusidestrconsts.dlgkeylink msgid "(Edit Key)" msgstr "" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" msgstr "Accessos ràpids" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" msgstr "Errors dels accessos ràpids" #: lazarusidestrconsts.dlgkeywordpolicy msgid "Keyword policy" msgstr "Política de paraula clau" #: lazarusidestrconsts.dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Permet LABEL i GOTO" #: lazarusidestrconsts.dlglang msgctxt "lazarusidestrconsts.dlglang" msgid "Language" msgstr "Llenguatge" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" msgstr "Últim (p.ex. al final del codi font)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Directori Lazarus (predeterminat per a tots els projectes)" #: lazarusidestrconsts.dlglazarusinstances msgid "Lazarus instances" msgstr "" #: lazarusidestrconsts.dlglefttopclr #, fuzzy #| msgid "Guid lines Left,Top" msgid "Guide lines Left,Top" msgstr "Color per esquerra, amunt" #: lazarusidestrconsts.dlglevel1opt msgid "1 (quick, debugger friendly with small limitations)" msgstr "" #: lazarusidestrconsts.dlglevel2opt msgid "2 (-O1 + quick optimizations)" msgstr "" #: lazarusidestrconsts.dlglevel3opt msgid "3 (-O2 + slow optimizations)" msgstr "" #: lazarusidestrconsts.dlglevel4opt msgid "4 (-O3 + aggressive optimizations, beware)" msgstr "" #: lazarusidestrconsts.dlglevelnoneopt #, fuzzy #| msgid "Level 0 (no extra optimizations)" msgid "0 (no optimization, for debugging)" msgstr "Nivell 0 (sense optimitzacions extres)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" msgstr "Divisió entre línies" #: lazarusidestrconsts.dlglinksmart #, fuzzy #| msgid "Link Smart" msgid "Link smart" msgstr "Enllaçament intel·ligent" #: lazarusidestrconsts.dlglnumsbct #, fuzzy #| msgid "Display Line Numbers in Run-time Error Backtraces" msgid "Display line numbers in run-time error backtraces" msgstr "Mostra els números de línia en errors en temps d'execució en seguiments inversos" #: lazarusidestrconsts.dlgmainviewforms #, fuzzy #| msgid "View project forms" msgid "View Project Forms" msgstr "Mostra les formes del projecte" #: lazarusidestrconsts.dlgmainviewframes msgid "View Project Frames" msgstr "" #: lazarusidestrconsts.dlgmainviewunits #, fuzzy #| msgid "View project units" msgctxt "lazarusidestrconsts.dlgmainviewunits" msgid "View Project Units" msgstr "Mostra les unitats del projecte" #: lazarusidestrconsts.dlgmakeexecutable msgid "\"Make\" executable" msgstr "" #: lazarusidestrconsts.dlgmanagedesktops msgid "Manage desktops" msgstr "" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" msgstr "Marge i canal" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" msgstr "Color del marcador" #: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec #, object-pascal-format msgid "(%s sec delay after caret move)" msgstr "" #: lazarusidestrconsts.dlgmarkupfoldcolor msgid "Vertical-mark" msgstr "" #: lazarusidestrconsts.dlgmarkupgroup msgid "Highlight all occurrences of Word under Caret" msgstr "" #: lazarusidestrconsts.dlgmarkupoutline msgid "Outline (global)" msgstr "" #: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor msgid "Warning: There are no colors configured for the selected language" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefined msgctxt "lazarusidestrconsts.dlgmarkupuserdefined" msgid "User defined markup" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefineddelcaption msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption" msgid "Delete" msgstr "Elimina" #: lazarusidestrconsts.dlgmarkupuserdefineddelprompt #, object-pascal-format msgid "Delete list \"%s\"?" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd msgid "Add Word or Term by key" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove msgid "Remove Word or Term by key" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle msgid "Toggle Word or Term by key" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedduplicate msgid "Duplicate Term" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg #, object-pascal-format msgid "The term %s already exists. Duplicates will be removed when the list is saved." msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedgloballist msgid "Add/Remove in all editors" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedlistdel msgid "Delete list" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedlistname msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname" msgid "Name" msgstr "Nom" #: lazarusidestrconsts.dlgmarkupuserdefinedlistnew msgid "Add list" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase msgid "Case sensitive" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound msgid "Set bound at term end" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound msgid "Set bound at term start" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen msgid "Ignore bounds for terms longer than" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect msgid "selection" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword msgid "current word" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts msgid "Settings for terms added by key" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect msgid "Smart match selection bounds" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednewname msgid "New list" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednolists msgid "No lists" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinednolistssel msgid "Select ..." msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys msgid "Key mappings" msgstr "" #: lazarusidestrconsts.dlgmarkupuserdefinedpagemain msgid "Main settings" msgstr "" #: lazarusidestrconsts.dlgmarkupwordbracket msgid "Keyword brackets on caret (global)" msgstr "" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Match whole words, if length is less or equal to:" msgstr "" #: lazarusidestrconsts.dlgmarkupwordkeycombo #, object-pascal-format msgid "Markup current word by key: %s" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore keywords" msgstr "" #: lazarusidestrconsts.dlgmarkupwordoncaretmove msgid "Automatically markup current word on caret move" msgstr "" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim spaces (when highlighting current selection)" msgstr "" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" msgstr "Número màxim de comptador" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" msgstr "Longitud màxima de la línia" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" msgstr "Núm.màx. de fitxers recents" #: lazarusidestrconsts.dlgmaxrecenthint msgid "Value 0 means unlimited." msgstr "" #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" msgstr "Màx.fitxers projecte recents" #: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod msgid "Middle-click-modifier to close all other tabs" msgstr "" #: lazarusidestrconsts.dlgmiddletabcloserightpagesmod msgid "Middle-click-modifier to close tabs on the right" msgstr "" #: lazarusidestrconsts.dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "Barreja els mètodes i les propietats" #: lazarusidestrconsts.dlgmode msgid "Mode" msgstr "" #: lazarusidestrconsts.dlgmouseaction msgid "Mouse Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn1 msgctxt "lazarusidestrconsts.dlgmouseoptbtn1" msgid "Single" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn2 msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" msgid "Double" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn3 msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" msgid "Triple" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn4 msgctxt "lazarusidestrconsts.dlgmouseoptbtn4" msgid "Quad" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1" msgid "Extra 1" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2" msgid "Extra 2" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.dlgmouseoptbtnwheeldown msgid "Wheel down" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnwheelleft msgid "Wheel left" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnwheelright msgid "Wheel right" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnwheelup msgid "Wheel up" msgstr "" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" msgstr "" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" msgstr "" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" msgstr "" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadalt msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcaret msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret" msgid "Caret" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcontext msgid "Context" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcount msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadctrl msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptheaddesc msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" msgid "Order" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" msgstr "" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodalt msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptmodctrl msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodeall msgctxt "lazarusidestrconsts.dlgmouseoptnodeall" msgid "All" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterchanges msgid "Line Changes" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview msgid "Overview" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks msgid "Overview Mark" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlgmouseoptnodeselect msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" msgid "Selection" msgstr "Selecció" #: lazarusidestrconsts.dlgmouseoptopt2label msgid "Opt" msgstr "" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" msgstr "" #: lazarusidestrconsts.dlgmouseoptotheracthint msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." msgstr "" #: lazarusidestrconsts.dlgmouseoptotheracttoggle msgid "Filter Mod-Keys" msgstr "" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentdebug #, fuzzy msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug" msgid "Debug" msgstr "Depuració" #: lazarusidestrconsts.dlgmsgwincolorurgenterror #, fuzzy msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.dlgmsgwincolorurgentfatal msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal" msgid "Fatal" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgenthint msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint" msgid "Hint" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentimportant msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant" msgid "Important" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentnone msgid "Normal" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentnote msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote" msgid "Note" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentpanic msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic" msgid "Panic" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentprogress msgid "Time and statistics" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose" msgid "Verbose" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose2 msgid "Verbose 2" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose3 msgid "Verbose 3" msgstr "" #: lazarusidestrconsts.dlgmsgwincolorurgentwarning msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning" msgid "Warning" msgstr "" #: lazarusidestrconsts.dlgmulticaretcolumnmode msgid "Navigation keys move all carets (column-select)" msgstr "" #: lazarusidestrconsts.dlgmulticaretdelskipcr msgid "Skip delete key at EOL (do not join lines)" msgstr "" #: lazarusidestrconsts.dlgmulticaretgroupoptions msgid "Multi-caret" msgstr "" #: lazarusidestrconsts.dlgmulticaretmode msgid "Navigation keys move all carets" msgstr "" #: lazarusidestrconsts.dlgmulticaretoncolumnselection msgid "Enable multi-caret for column selection" msgstr "" #: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew msgid "always start a new instance" msgstr "" #: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance msgid "do not allow multiple instances" msgstr "" #: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning msgid "open files in a running instance" msgstr "" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" msgstr "Sel·lecció múltiple" #: lazarusidestrconsts.dlgmultiwinaccessgroup msgid "Jump target priority between multiple editors" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccessorder msgid "Order to use for editors matching the same criteria" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccessorderedit msgid "Most recent focused editor for this file" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccessorderwin msgid "Editor (for file) in most recent focused window" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccesstype msgid "Priority list of criteria to choose an editor:" msgstr "" #: lazarusidestrconsts.dlgmultiwinoptions msgid "Pages and Windows" msgstr "" #: lazarusidestrconsts.dlgmultiwintabgroup msgid "Notebook Tabs" msgstr "" #: lazarusidestrconsts.dlgnaming msgid "Naming" msgstr "Anomenat" #: lazarusidestrconsts.dlgnewdesktop msgid "New desktop ..." msgstr "" #: lazarusidestrconsts.dlgnewprojecttype msgid "New Project Type" msgstr "" #: lazarusidestrconsts.dlgnoautomaticrenaming #, fuzzy #| msgid "no automatic renaming" msgid "No automatic renaming" msgstr "no canviïs el nom automàticament" #: lazarusidestrconsts.dlgnoavailableunits msgid "No available units to add." msgstr "" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" msgstr "" #: lazarusidestrconsts.dlgnonformbackgroundcolor msgid "Other Designer background (e. g. TDataModule)" msgstr "" #: lazarusidestrconsts.dlgnotebooktabpos msgid "Source notebook tabs position" msgstr "" #: lazarusidestrconsts.dlgnotsplitlineafter #, fuzzy #| msgid "Do not split line after:" msgid "Do not split line after" msgstr "No separis la línia després de:" #: lazarusidestrconsts.dlgnotsplitlinefront #, fuzzy #| msgid "Do not split line In front of:" msgid "Do not split line in front of" msgstr "No separis la línia abans de:" #: lazarusidestrconsts.dlgnsprincipalclass msgid "NSPrincipalClass" msgstr "" #: lazarusidestrconsts.dlgobjinsp #, fuzzy msgctxt "lazarusidestrconsts.dlgobjinsp" msgid "Object Inspector" msgstr "Inspector dels objectes" #: lazarusidestrconsts.dlgoiitemheight #, fuzzy #| msgid "Item height" msgid "Item height (0 = auto)" msgstr "Alçada de l'element" #: lazarusidestrconsts.dlgoimiscellaneous msgctxt "lazarusidestrconsts.dlgoimiscellaneous" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" msgstr "" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" msgstr "" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" msgstr "" #: lazarusidestrconsts.dlgoptimizationlevels msgid "Optimization levels" msgstr "" #: lazarusidestrconsts.dlgotheroptimizations msgid "Other optimizations" msgstr "" #: lazarusidestrconsts.dlgotherunitfiles #, fuzzy #| msgid "Other unit files (-Fu) (delimiter is semicolon):" msgid "Other unit files (-Fu):" msgstr "Altres fitxers d'unitats (-Fu) (El delimitador és punt i coma):" #: lazarusidestrconsts.dlgoverviewgutterback1color msgid "Background 1" msgstr "" #: lazarusidestrconsts.dlgoverviewgutterback2color msgid "Background 2" msgstr "" #: lazarusidestrconsts.dlgoverviewguttercolor msgid "Overview Gutter" msgstr "" #: lazarusidestrconsts.dlgoverviewgutterpagecolor msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor" msgid "Page" msgstr "" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite block" msgstr "" #: lazarusidestrconsts.dlgoverwritedesktop #, object-pascal-format msgid "" "Desktop with the name \"%s\" was found.\n" "Should the old desktop be overwritten?" msgstr "" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" msgstr "Suggeriments per a la paleta de components" #: lazarusidestrconsts.dlgpasext #, fuzzy #| msgid "Default pascal extension" msgid "Default Pascal extension" msgstr "Extensió Pascal predeterminada" #: lazarusidestrconsts.dlgpasextkeywords msgid "Highlight control statements as keywords" msgstr "" #: lazarusidestrconsts.dlgpasextkeywordsgroup msgid "Extended Pascal Keyword Options" msgstr "" #: lazarusidestrconsts.dlgpaskeywordsmarkup msgid "Markup (on caret)" msgstr "" #: lazarusidestrconsts.dlgpaskeywordsmatches msgid "Matching Keywords" msgstr "" #: lazarusidestrconsts.dlgpaskeywordsoutline msgid "Outline" msgstr "" #: lazarusidestrconsts.dlgpassoptslinker #, fuzzy #| msgid "Pass options to linker (delimiter is space)" msgid "Pass options to linker with \"-k\", delimiter is space" msgstr "Passa les opcions a l'enllaçador (el delimitador és l'espai)" #: lazarusidestrconsts.dlgpasstringkeywords msgid "Highlight \"String\" keyword(s)" msgstr "" #: lazarusidestrconsts.dlgpasstringkeywordsoptdefault msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" msgid "Default" msgstr "Predeterminat" #: lazarusidestrconsts.dlgpasstringkeywordsoptnone msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.dlgpasstringkeywordsoptstring msgid "Only \"String\"" msgstr "" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent block" msgstr "" #: lazarusidestrconsts.dlgpersistentcursor msgid "Visible caret in unfocused editor" msgstr "" #: lazarusidestrconsts.dlgpersistentcursornoblink msgid "Caret in unfocused editor does not blink" msgstr "" #: lazarusidestrconsts.dlgpoansiutf8 msgid "ANSI codepage is UTF-8 (Windows 10 1903+)" msgstr "" #: lazarusidestrconsts.dlgpoapplication msgid "Application" msgstr "Aplicació" #: lazarusidestrconsts.dlgpoasinvoker msgid "as invoker (asInvoker)" msgstr "" #: lazarusidestrconsts.dlgpoclearicon msgid "&Clear Icon" msgstr "" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" msgstr "" #: lazarusidestrconsts.dlgpodebugger msgctxt "lazarusidestrconsts.dlgpodebugger" msgid "Debugger" msgstr "" #: lazarusidestrconsts.dlgpodefaulticon msgid "Load &Default" msgstr "" #: lazarusidestrconsts.dlgpodpiawareness msgid "DPI awareness" msgstr "" #: lazarusidestrconsts.dlgpodpiawarenessoff msgid "off" msgstr "" #: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor msgid "Vista-8: off, 8.1+: per monitor" msgstr "" #: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor msgid "Vista-8: on, 8.1+: per monitor" msgstr "" #: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2 msgid "Vista-8: on, 8.1/10+: per monitor/V2" msgstr "" #: lazarusidestrconsts.dlgpodpiawarenesson msgid "on" msgstr "" #: lazarusidestrconsts.dlgpoexecutionlevel msgid "Execution Level" msgstr "" #: lazarusidestrconsts.dlgpofroms msgid "Forms" msgstr "Formes" #: lazarusidestrconsts.dlgpohighestavailable msgid "highest available (highestAvailable)" msgstr "" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" msgstr "" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" msgstr "" #: lazarusidestrconsts.dlgpoicondesc #, object-pascal-format msgid "(size: %d:%d, bpp: %d)" msgstr "" #: lazarusidestrconsts.dlgpoicondescnone msgctxt "lazarusidestrconsts.dlgpoicondescnone" msgid "(none)" msgstr "" #: lazarusidestrconsts.dlgpointertypecheck msgid "@ returns a typed pointer" msgstr "" #: lazarusidestrconsts.dlgpoloadicon msgid "&Load Icon" msgstr "" #: lazarusidestrconsts.dlgpolongpathaware msgid "Long path awareness (Windows 10 1607+)" msgstr "" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgporequireadministrator msgid "require administrator (requireAdministrator)" msgstr "" #: lazarusidestrconsts.dlgporesources msgid "Resources" msgstr "" #: lazarusidestrconsts.dlgposaveicon msgid "&Save Icon" msgstr "" #: lazarusidestrconsts.dlgposavesession msgid "Session" msgstr "Sessió" #: lazarusidestrconsts.dlgpotitle msgid "Title:" msgstr "Títol" #: lazarusidestrconsts.dlgpouiaccess msgid "UI Access (uiAccess)" msgstr "" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging" msgstr "" #: lazarusidestrconsts.dlgpouselclscaling msgid "Use LCL scaling (Hi-DPI)" msgstr "" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest resource (and enable themes)" msgstr "" #: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick msgid "Prefer double-click over single-click" msgstr "" #: lazarusidestrconsts.dlgpriorities msgid "Priorities" msgstr "" #: lazarusidestrconsts.dlgproject msgctxt "lazarusidestrconsts.dlgproject" msgid "Project" msgstr "" #: lazarusidestrconsts.dlgprojectoptionsfor #, object-pascal-format msgid "Options for Project: %s" msgstr "" #: lazarusidestrconsts.dlgprojecttoopenorcreate msgid "Project to Open or Create" msgstr "" #: lazarusidestrconsts.dlgprojfiles #, fuzzy #| msgid "Project files" msgid "Project Files" msgstr "Fitxers de projecte" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt on replace" msgstr "" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" msgstr "Ompleix les propietats" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" msgstr "Nom de propietat" #: lazarusidestrconsts.dlgqopenlastprj #, fuzzy #| msgid "Open last project at start" msgid "Open last project and packages at start" msgstr "Obre l'últim projecte a l'iniciar" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" msgstr "" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" msgstr "Mostra la graella" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" msgstr "Ajusta a la graella" #: lazarusidestrconsts.dlgreallydeletedesktop #, object-pascal-format msgid "Really delete desktop \"%s\"?" msgstr "" #: lazarusidestrconsts.dlgredirappend msgid "To file (append)" msgstr "" #: lazarusidestrconsts.dlgredirinput msgid "From file" msgstr "" #: lazarusidestrconsts.dlgredirinputend msgid "From file (at EOF)" msgstr "" #: lazarusidestrconsts.dlgrediroff msgid "No redirection" msgstr "" #: lazarusidestrconsts.dlgrediroverwrite msgid "To file (overwrite)" msgstr "" #: lazarusidestrconsts.dlgredirstderr msgid "Redirect StdErr" msgstr "" #: lazarusidestrconsts.dlgredirstdin msgid "Redirect StdIn" msgstr "" #: lazarusidestrconsts.dlgredirstdnotsupported msgid "Current debugger does not support redirection." msgstr "" #: lazarusidestrconsts.dlgredirstdout msgid "Redirect StdOut" msgstr "" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" msgstr "" #: lazarusidestrconsts.dlgregularexpressions msgid "Regular e&xpressions" msgstr "" #: lazarusidestrconsts.dlgrenamedesktop msgid "Rename desktop" msgstr "" #: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption #, fuzzy msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption" msgid "Rename" msgstr "Canvia el nom" #: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint msgid "Rename selected desktop" msgstr "" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" msgstr "Reemplaça Tot" #: lazarusidestrconsts.dlgreplacewith #, fuzzy #| msgid "&Replace with" msgid "Replace wit&h" msgstr "&Reemplaça amb" #: lazarusidestrconsts.dlgreport msgid "Report" msgstr "Informa" #: lazarusidestrconsts.dlgreset msgctxt "lazarusidestrconsts.dlgreset" msgid "Reset" msgstr "" #: lazarusidestrconsts.dlgresetall msgid "Reset all" msgstr "" #: lazarusidestrconsts.dlgrightbottomclr #, fuzzy #| msgid "color for right, bottom" msgid "Guide lines Right,Bottom" msgstr "Color per dreta, avall" #: lazarusidestrconsts.dlgrightclickselects #, fuzzy #| msgid "Right Click selects" msgid "Right click selects" msgstr "Clic dret selecciona" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" msgstr "Marge dret" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" msgstr "Directori de treball" #: lazarusidestrconsts.dlgrubberbandselectsgrandchildren msgid "Select grandchildren" msgstr "" #: lazarusidestrconsts.dlgruberbandcreationcolor #, fuzzy #| msgid "Creation" msgid "Rubberband Creation" msgstr "Creació" #: lazarusidestrconsts.dlgruberbandselectioncolor #, fuzzy #| msgid "Selection" msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" msgid "Rubberband Selection" msgstr "Selecció" #: lazarusidestrconsts.dlgrunninginstancemodalerror #, object-pascal-format msgid "" "The running Lazarus instance cannot accept any files.\n" "Do you want to open them in a new IDE instance?\n" "\n" "%s" msgstr "" #: lazarusidestrconsts.dlgrunninginstancenotrespondingerror msgid "Lazarus instance is running but not responding." msgstr "" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Pantalla(no per win32, p.ex. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts.dlgrunoenvironment msgctxt "lazarusidestrconsts.dlgrunoenvironment" msgid "Environment" msgstr "Entorn" #: lazarusidestrconsts.dlgrunolocal msgid "Local" msgstr "Local" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" msgstr "Variables del sistema" #: lazarusidestrconsts.dlgrunousedisplay msgid "Use display" msgstr "Utilitza la pantalla" #: lazarusidestrconsts.dlgrunouseroverrides msgid "User overrides" msgstr "L'usuari substitueix" #: lazarusidestrconsts.dlgrunparameters #, fuzzy #| msgid "Run parameters" msgid "Run Parameters" msgstr "Executa els paràmetres" #: lazarusidestrconsts.dlgrunwithdebug msgid "Run uses the debugger (disable for release-mode)" msgstr "" #: lazarusidestrconsts.dlgsavecurrentdesktop msgid "Save current desktop" msgstr "" #: lazarusidestrconsts.dlgsavecurrentdesktopas msgid "Save current desktop as" msgstr "" #: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption msgid "Save active desktop as ..." msgstr "" #: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint msgid "Save active desktop as" msgstr "" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" msgstr "" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "Desa l'informació de l'editor pels fitxers tancats" #: lazarusidestrconsts.dlgsaveeditorinfohint msgid "The files are available in the \"Open Recent\" history list." msgstr "" #: lazarusidestrconsts.dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "Desa l'informació de l'editor només per fitxers del projecte" #: lazarusidestrconsts.dlgsaveeditorinfoprojecthint msgid "Only files that belong to this project." msgstr "" #: lazarusidestrconsts.dlgsavein msgid "Save in" msgstr "" #: lazarusidestrconsts.dlgscrollbarpasteolfixed msgid "Force 1024 columns minimum for horizontal scroll range" msgstr "" #: lazarusidestrconsts.dlgscrollbarpasteolnone msgid "Do not add any permanent space to horizontal scroll range" msgstr "" #: lazarusidestrconsts.dlgscrollbarpasteolpage msgid "Always add one page to horizontal scroll range" msgstr "" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" msgstr "Desplaça un menys" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling" msgstr "" #: lazarusidestrconsts.dlgscrollhint msgctxt "lazarusidestrconsts.dlgscrollhint" msgid "Show scroll hint" msgstr "Mostra el suggeriment deplaçat" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" msgstr "Desplaça fins el final del fitxer" #: lazarusidestrconsts.dlgscrollpastendline #, fuzzy #| msgid "Scroll past end of line" msgid "Allow Caret to move past the end of line" msgstr "Desplaça fins el final de la línia" #: lazarusidestrconsts.dlgseachdirectorynotfound #, object-pascal-format msgid "Search directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." msgstr "L'usuari ha finalitzat la recerca." #: lazarusidestrconsts.dlgsearchcaption #, fuzzy #| msgid "Searching..." msgid "Searching ..." msgstr "Cercant..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" msgstr "trajectòries" #: lazarusidestrconsts.dlgsearchscope msgid "Search scope" msgstr "" #: lazarusidestrconsts.dlgselectallchildcontrols msgid "Select all child controls together with their parent." msgstr "" #: lazarusidestrconsts.dlgselectallnoscroll msgid "Do not scroll on Select-All / Paragraph or To-Brace" msgstr "" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected text" msgstr "" #: lazarusidestrconsts.dlgsetactivedesktopbtncaption msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption" msgid "Set active" msgstr "" #: lazarusidestrconsts.dlgsetactivedesktopbtnhint msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint" msgid "Set active" msgstr "" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" msgstr "Predetermina tots els elements" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" msgstr "Predetermina l'element" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" msgstr "Variable de propietat" #: lazarusidestrconsts.dlgsetpropertyvariablehint msgid "The parameter name for the default setter procedure." msgstr "" #: lazarusidestrconsts.dlgsetpropertyvariableisprefix msgid "is prefix" msgstr "" #: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name." msgstr "" #: lazarusidestrconsts.dlgsetpropertyvariableuseconst msgid "use const" msgstr "" #: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint msgid "If checked, the setter parameter is marked with \"const\"." msgstr "" #: lazarusidestrconsts.dlgshowallunits msgid "Show all units" msgstr "" #: lazarusidestrconsts.dlgshowcaptionsofnonvisuals msgid "Show captions of nonvisual components" msgstr "" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "Mostra els procediments compilats" #: lazarusidestrconsts.dlgshowcompilinglinenumbers #, fuzzy msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" msgstr "Mostra els números de línia" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" msgstr "Mostra els condicionals" #: lazarusidestrconsts.dlgshowdebuginfo msgid "Show debug info" msgstr "Mostra l'informació de la depuració" #: lazarusidestrconsts.dlgshowdesignerhints msgid "Show designer hints" msgstr "" #: lazarusidestrconsts.dlgshowdesignerhintshint msgid "Hint shows control's position or size while moving or resizing it." msgstr "" #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" msgstr "Mostra-ho tot" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "Mostra informació per l'executable (sols Win32)" #: lazarusidestrconsts.dlgshowfilenameincaption msgid "Show file name in caption" msgstr "" #: lazarusidestrconsts.dlgshowgeneralinfo msgid "Show general info" msgstr "Mostra l'informació general" #: lazarusidestrconsts.dlgshowgutterhints msgid "Show gutter hints" msgstr "Mostra els suggeriments sense importància" #: lazarusidestrconsts.dlgshowhint #, fuzzy #| msgid "Show Hints" msgctxt "lazarusidestrconsts.dlgshowhint" msgid "Show hints" msgstr "Mostra les indicacions" #: lazarusidestrconsts.dlgshowingwindows msgid "Showing Windows" msgstr "" #: lazarusidestrconsts.dlgshowlinenumbers msgctxt "lazarusidestrconsts.dlgshowlinenumbers" msgid "Show line numbers" msgstr "Mostra els números de línia" #: lazarusidestrconsts.dlgshowmessagesicons msgid "Show Messages Icons" msgstr "" #: lazarusidestrconsts.dlgshownotes #, fuzzy #| msgid "Show Notes" msgid "Show notes" msgstr "Mostra les notes" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" msgstr "Mostra els fitxers escollits" #: lazarusidestrconsts.dlgshowusedfiles msgid "Show used files" msgstr "Mostra els fitxers utilitzats" #: lazarusidestrconsts.dlgshowwarnings #, fuzzy #| msgid "Show Warnings" msgid "Show warnings" msgstr "Mostra els avisos" #: lazarusidestrconsts.dlgsingletaskbarbutton msgid "Show single button in TaskBar" msgstr "" #: lazarusidestrconsts.dlgskipforwardclassdeclarations msgid "Skip forward class declarations" msgstr "" #: lazarusidestrconsts.dlgslashcommenttab msgid "Slash //" msgstr "" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" msgstr "Tabuladors intel·ligents" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Símbol darrera (.pp~)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Comptador (.pp;1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Símbol davant (.~pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Ajusta a les línies de la guia" #: lazarusidestrconsts.dlgsnapguidelineshint msgid "When a control is close to being aligned with another control, it snaps to the aligned position." msgstr "" #: lazarusidestrconsts.dlgsourceedittabmultiline msgid "Multiline tabs" msgstr "" #: lazarusidestrconsts.dlgspacenotcosmos msgctxt "lazarusidestrconsts.dlgspacenotcosmos" msgid "Space" msgstr "Espaiat" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "Suggeriments pels botons ràpids principals (obre, guarda, ...)" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" msgstr "Origen" #: lazarusidestrconsts.dlgstacksize msgid "Stack size" msgstr "" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Atura després del nombre d'errors:" #: lazarusidestrconsts.dlgstringautoappend msgid "Append text to close string" msgstr "" #: lazarusidestrconsts.dlgstringautoprefix msgid "Prefix string on new line" msgstr "" #: lazarusidestrconsts.dlgstringbreakindenttab msgid "String ''" msgstr "" #: lazarusidestrconsts.dlgstringenableautocontinue msgid "Extend strings on linebreak" msgstr "" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" msgstr "" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" msgstr "Opcions de la sintaxi" #: lazarusidestrconsts.dlgtabindent msgid "Tab indents blocks" msgstr "El tabulador sagna blocs" #: lazarusidestrconsts.dlgtabnumbersnotebook msgid "Show tab numbers in notebook" msgstr "" #: lazarusidestrconsts.dlgtabstospaces msgid "Tabs to spaces" msgstr "Tabuladors a espais" #: lazarusidestrconsts.dlgtabwidths msgctxt "lazarusidestrconsts.dlgtabwidths" msgid "Tab widths" msgstr "" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" msgstr "" #: lazarusidestrconsts.dlgtargetos #, fuzzy msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" msgstr "SO de destinació" #: lazarusidestrconsts.dlgtargetplatform msgid "Target platform" msgstr "" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" msgstr "" #: lazarusidestrconsts.dlgtargetspecificoptions msgid "Target-specific options" msgstr "" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" msgstr "Directori per a muntar els projectes de prova" #: lazarusidestrconsts.dlgtextstyle msgid "Text-Style" msgstr "" #: lazarusidestrconsts.dlgtexttofind #, fuzzy #| msgid "&Text to Find" msgctxt "lazarusidestrconsts.dlgtexttofind" msgid "Search s&tring" msgstr "Cerca el &text" #: lazarusidestrconsts.dlgthiselementusescolor msgid "The element uses (and edits) the schemes:" msgstr "" #: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption" msgid "Toggle as debug desktop" msgstr "" #: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint" msgid "Toggle as debug desktop" msgstr "" #: lazarusidestrconsts.dlgtopinfohint msgid "Current Class/Proc Hint" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim spaces style" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" msgstr "" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Suprimeix els espais finals" #: lazarusidestrconsts.dlgundoaftersave msgid "Undo after save" msgstr "Desfés després de desar" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo" msgstr "" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" msgstr "" #: lazarusidestrconsts.dlgunitdeprefresh msgctxt "lazarusidestrconsts.dlgunitdeprefresh" msgid "Refresh" msgstr "Refresca" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" msgstr "" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" msgstr "" #: lazarusidestrconsts.dlgusecodefolding msgid "Code Folding" msgstr "" #: lazarusidestrconsts.dlguseconsolebuffer msgid "Set Columns/Rows" msgstr "" #: lazarusidestrconsts.dlguseconsolepos msgid "Set Left/Top" msgstr "" #: lazarusidestrconsts.dlguseconsolesize msgid "Set Width/Height" msgstr "" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional compiler config file" msgstr "" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider Drawing" msgstr "" #: lazarusidestrconsts.dlgusefpccfg #, fuzzy #| msgid "Use standard Compiler Config File (fpc.cfg)" msgid "Use standard compiler config file (fpc.cfg)" msgstr "Utilitza el fitxer de configuració normalitzat (fpc.cfg)" #: lazarusidestrconsts.dlgusehighlight msgid "Use Highlight" msgstr "" #: lazarusidestrconsts.dlguseiconsincompletionbox msgid "Icons in code completion box" msgstr "" #: lazarusidestrconsts.dlguselaunchingapp msgid "Use launching application" msgstr "Utilitza l'aplicació llançadora" #: lazarusidestrconsts.dlguseminimumime msgid "IME handled by System" msgstr "" #: lazarusidestrconsts.dlguserschemeerror #, object-pascal-format msgid "Failed to load user-scheme file %s" msgstr "" #: lazarusidestrconsts.dlguseschemedefaults msgid "- Scheme globals -" msgstr "" #: lazarusidestrconsts.dlguseschemelocal msgid "selected language" msgstr "" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Utilitza el ressaltat de sintaxi" #: lazarusidestrconsts.dlgusetabshistory msgid "Use tab history when closing tabs" msgstr "" #: lazarusidestrconsts.dlguseunitcaption msgid "Add unit to Uses section" msgstr "" #: lazarusidestrconsts.dlgvaluecolor msgctxt "lazarusidestrconsts.dlgvaluecolor" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" msgstr "Detall durant la compilació:" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" msgstr "Canal visible" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" msgstr "Marge dret visible" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole words only" msgstr "" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" msgstr "Ample" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" msgstr "" #: lazarusidestrconsts.dlgwindow msgctxt "lazarusidestrconsts.dlgwindow" msgid "Window" msgstr "Finestra" #: lazarusidestrconsts.dlgwordexceptions msgid "Exceptions" msgstr "" #: lazarusidestrconsts.dlgwordspolicies msgctxt "lazarusidestrconsts.dlgwordspolicies" msgid "Words" msgstr "Paraules" #: lazarusidestrconsts.dlgwrdpreview msgctxt "lazarusidestrconsts.dlgwrdpreview" msgid "Preview" msgstr "Visualització prèvia" #: lazarusidestrconsts.dlgwritefpclogo #, fuzzy #| msgid "Write an FPC logo" msgid "Write FPC logo" msgstr "Escriu un logotipus FPC" #: lazarusidestrconsts.drsignoringprojectdebuggersettings msgid " (Ignoring project settings below)" msgstr "" #: lazarusidestrconsts.drsstoreconverterconfiginses msgid "Store converter config in session" msgstr "" #: lazarusidestrconsts.drsstoredispformatconfiginses msgid "Store display formats config in session" msgstr "" #: lazarusidestrconsts.drsstoreformatterconfiginses msgid "Store formatter config in session" msgstr "" #: lazarusidestrconsts.drsstoreprojectdebuggerconfi msgid "Store project debugger configs in session" msgstr "" #: lazarusidestrconsts.drsthedebuggerbackendselecti msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI." msgstr "" #: lazarusidestrconsts.drsthisonlyaffectsdispformats msgid "This only affects the display formats below. The settings which formats to use are always stored in the session." msgstr "" #: lazarusidestrconsts.drsthisonlyaffectsthelistofc msgid "This only affects the list of converters below. The settings which list to use are always stored in the session." msgstr "" #: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session." msgstr "" #: lazarusidestrconsts.drsuseideglobaldispformats msgid "Use the IDEs-global display formats" msgstr "" #: lazarusidestrconsts.drsuseprojecfdispformats msgid "Use the projects display formats" msgstr "" #: lazarusidestrconsts.drsusetheidegloballistofconv msgid "Use the IDE-Global list of converters" msgstr "" #: lazarusidestrconsts.drsusetheidegloballistofformatter msgid "Use the IDE-Global list of formatters" msgstr "" #: lazarusidestrconsts.drsusetheprojectlistofconver msgid "Use the project list of converters" msgstr "" #: lazarusidestrconsts.drsusetheprojectlistofformatter msgid "Use the project list of formatters" msgstr "" #: lazarusidestrconsts.drsusingidedefaultdebuggerse msgid "Using IDE default debugger settings" msgstr "" #: lazarusidestrconsts.drsusingselectedidedebuggers msgid "Using selected IDE debugger settings" msgstr "" #: lazarusidestrconsts.fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "Els components multi seleccionats han de ser d'una sola forma" #: lazarusidestrconsts.fdmalignmenu msgid "Align ..." msgstr "" #: lazarusidestrconsts.fdmdeleteselection #, fuzzy #| msgid "Delete selection" msgid "Delete Selection" msgstr "Elimina la selecció" #: lazarusidestrconsts.fdmmirrorhorizontal #, fuzzy #| msgid "Mirror horizontal" msgid "Mirror Horizontal" msgstr "Mirall horitzontal" #: lazarusidestrconsts.fdmmirrorvertical #, fuzzy #| msgid "Mirror vertical" msgid "Mirror Vertical" msgstr "Mirall vertical" #: lazarusidestrconsts.fdmorderbackone #, fuzzy #| msgid "Back one" msgid "Back One" msgstr "Enrere u" #: lazarusidestrconsts.fdmorderforwardone #, fuzzy #| msgid "Forward one" msgid "Forward One" msgstr "Endavant u" #: lazarusidestrconsts.fdmordermovetoback #, fuzzy #| msgid "Move to back" msgid "Move to Back" msgstr "Mou al fons" #: lazarusidestrconsts.fdmordermovetofront #, fuzzy #| msgid "Move to front" msgid "Move to Front" msgstr "Mou al front" #: lazarusidestrconsts.fdmresetmenu msgid "Reset ..." msgstr "" #: lazarusidestrconsts.fdmsaveformasxml #, fuzzy #| msgid "Save form as XML" msgid "Save Form as XML" msgstr "Desa forma com xml" #: lazarusidestrconsts.fdmscalemenu msgid "Scale ..." msgstr "" #: lazarusidestrconsts.fdmscaleword msgid "Scale" msgstr "Escala" #: lazarusidestrconsts.fdmselectall msgctxt "lazarusidestrconsts.fdmselectall" msgid "Select All" msgstr "Selecciona-ho tot" #: lazarusidestrconsts.fdmsizemenu msgid "Size ..." msgstr "" #: lazarusidestrconsts.fdmsizeword msgid "Size" msgstr "Tamany" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "Opció: Desplaça a graella" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "Opció: Desplaça a línies de la guia" #: lazarusidestrconsts.fdmzorder msgid "Z-order" msgstr "" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" msgstr "" #: lazarusidestrconsts.initdlgdebugchangepath msgid "Change path" msgstr "" #: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured msgid "Error: The backend is not configured." msgstr "" #: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage msgid "(The configured backend's package is not installed.)" msgstr "" #: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported msgid "Error: Your current config uses a backend that is not supported on your OS/Arch." msgstr "" #: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended msgid "Hint: The backend type is OK, but not the recommended type." msgstr "" #: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback msgid "Create a new recommended backend" msgstr "" #: lazarusidestrconsts.initdlgdebugcurrent msgctxt "lazarusidestrconsts.initdlgdebugcurrent" msgid "Current" msgstr "" #: lazarusidestrconsts.initdlgdebugexternalexepathdisplay msgid "The selected backend uses the external executable:" msgstr "" #: lazarusidestrconsts.initdlgdebugexternalexepathprompt #, object-pascal-format msgid "The selected backend requires an external executable: \"%s\"" msgstr "" #: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss #, object-pascal-format msgid "Default for your OS/Arch is: \"%s\"." msgstr "" #: lazarusidestrconsts.initdlgdebugignore msgctxt "lazarusidestrconsts.initdlgdebugignore" msgid "Ignore" msgstr "" #: lazarusidestrconsts.initdlgdebugkeepbackend msgid "Keep backend" msgstr "" #: lazarusidestrconsts.initdlgdebugnew #, fuzzy msgctxt "lazarusidestrconsts.initdlgdebugnew" msgid "New" msgstr "Nou" #: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory msgid "Error: External executable is a directory, not a file." msgstr "" #: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound msgid "Error: External executable not found." msgstr "" #: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable msgid "Error: External file is not executable." msgstr "" #: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound msgid "Error: No default for external executable found." msgstr "" #: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified msgid "Error: No external executable specified." msgstr "" #: lazarusidestrconsts.initdlgdebugpopupinformation #, object-pascal-format msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"." msgstr "" #: lazarusidestrconsts.initdlgdebugselectanexistingbackend msgid "Select an existing backend" msgstr "" #: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options." msgstr "" #: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild #, object-pascal-format msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options." msgstr "" #: lazarusidestrconsts.initdlgdebugstatemissingpackages msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup." msgstr "" #: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend." msgstr "" #: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend." msgstr "" #: lazarusidestrconsts.initdlgdebugstatesetupok msgid "Setup is OK." msgstr "" #: lazarusidestrconsts.initdlgdebugstateupdatebackend msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend." msgstr "" #: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." msgstr "" #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" msgstr "Afegeix els fitxers" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "" #: lazarusidestrconsts.lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Nom de classe ambigu" #: lazarusidestrconsts.lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Nom d'unitat ambigu" #: lazarusidestrconsts.lisa2pancestortype #, fuzzy #| msgid "Ancestor Type" msgid "Ancestor type" msgstr "Tipus d'avantpassat" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Dependències Interrompudes" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "Ja existeix el nom de la classe" #: lazarusidestrconsts.lisa2pcreatenewcomp msgid "Create New Component" msgstr "" #: lazarusidestrconsts.lisa2pdependency msgid "Dependency" msgstr "Dependència" #: lazarusidestrconsts.lisa2pdirectoryforunitfile msgid "Directory for unit file:" msgstr "" #: lazarusidestrconsts.lisa2pexistingfile2 #, object-pascal-format msgid "Existing file: \"%s\"" msgstr "" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "Ja existeix el fitxer" #: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage #, object-pascal-format msgid "File \"%s\" already exists in the package." msgstr "" #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" msgstr "El fitxer està essent utilitzat" #: lazarusidestrconsts.lisa2pfilename2 #, fuzzy #| msgid "Filename" msgid "Filename/URL" msgstr "Nom del fitxer" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" msgstr "El fitxer no és una unitat" #: lazarusidestrconsts.lisa2picon24x24 msgid "Icon 24x24:" msgstr "" #: lazarusidestrconsts.lisa2picon36x36 msgid "Icon 36x36:" msgstr "" #: lazarusidestrconsts.lisa2picon48x48 msgid "Icon 48x48:" msgstr "" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "El tipus d'avantpassat no és vàlid" #: lazarusidestrconsts.lisa2pinvalidcirculardependency msgid "Invalid Circular Dependency" msgstr "" #: lazarusidestrconsts.lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "El nom de la classe no és vàlid" #: lazarusidestrconsts.lisa2pinvalidfile msgid "Invalid file" msgstr "El fitxer no és vàlid" #: lazarusidestrconsts.lisa2pinvalidfilename msgid "Invalid filename" msgstr "El nom del fitxer no és vàlid" #: lazarusidestrconsts.lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "El nom de la unitat no és vàlid" #: lazarusidestrconsts.lisa2pisnotavalidunitname #, object-pascal-format, fuzzy, badformat #| msgid "%s%s%s is not a valid unit name." msgid "\"%s\" is not a valid unit name." msgstr "%s%s%s no és un nom d'unitat vàlid" #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" msgstr "Nou nom de classe:" #: lazarusidestrconsts.lisa2pnewfile msgid "New File" msgstr "Nou Arxiu" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting #, object-pascal-format, fuzzy, badformat #| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgid "No package found for dependency \"%s\".%sPlease choose an existing package." msgstr "No s'ha trobat cap paquet per la dependència %s%s%s.%sSi us plau, escolliu un paquet existent." #: lazarusidestrconsts.lisa2ppackageorproject msgid "Package/Project" msgstr "" #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" msgstr "El nom del paquet és massa llarg" #: lazarusidestrconsts.lisa2ppalettepage #, fuzzy #| msgid "Palette Page:" msgid "Palette page:" msgstr "Pàgina de paleta:" #: lazarusidestrconsts.lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Acurta o allarga nom d'arxiu" #: lazarusidestrconsts.lisa2pshowall msgctxt "lazarusidestrconsts.lisa2pshowall" msgid "Show all" msgstr "Mostra-ho tot" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit #, object-pascal-format, fuzzy, badformat #| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." msgstr "El tipus avantpassat %s%s%s té el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier #, object-pascal-format, fuzzy, badformat #| msgid "The ancestor type %s%s%s is not a valid Pascal identifier." msgid "The ancestor type \"%s\" is not a valid Pascal identifier." msgstr "El tipus avantpassat %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame #, object-pascal-format, fuzzy, badformat #| msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgid "The class name \"%s\" and ancestor type \"%s\" are the same." msgstr "El nom de classe %s%s%s i tipus avantpassat %s%s%s son el mateix." #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile #, object-pascal-format, fuzzy, badformat #| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" msgstr "El nom de classe %s%s%s ja existeix en%s el paquet %s%sFitxer: %s%s%s" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit #, object-pascal-format, fuzzy, badformat #| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." msgstr "El nom de classe %s%s%s té el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier #, object-pascal-format, fuzzy, badformat #| msgid "The class name %s%s%s is not a valid Pascal identifier." msgid "The class name \"%s\" is not a valid Pascal identifier." msgstr "El nom de classe %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "El fitxer %s%s%s és part del projecte actual.%sÉs una mala idea compartir fitxers entre projectes i paquets." #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename #, object-pascal-format msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion #, fuzzy msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "La versió màxima és menor que la versió mínima" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe #, object-pascal-format, fuzzy, badformat #| msgid "The package already has a dependency on the package %s%s%s." msgid "The package already has a dependency on the package \"%s\"." msgstr "El paquet ja té una dependència pel paquet %s%s%s." #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars #, object-pascal-format, fuzzy, badformat #| msgid "The page name %s%s%s is too long (max 100 chars)." msgid "The page name \"%s\" is too long (max 100 chars)." msgstr "El nom de pàgina %s%s%s és massa llarg (max 100 car.)" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage #, object-pascal-format, fuzzy, badformat #| msgid "The unitname %s%s%s already exists in the package:%s%s" msgid "The unitname \"%s\" already exists in the package:%s%s" msgstr "El nom d'unitat %s%s%s ja existeix en el paquet:%s%s" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage #, object-pascal-format, fuzzy, badformat #| msgid "The unitname %s%s%s already exists in this package." msgid "The unitname \"%s\" already exists in this package." msgstr "El nom d'unitat %s%s%s ja existeix en aquest paquet." #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer #, object-pascal-format msgid "The unit name \"%s\"%sand filename \"%s\" differ." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent #, object-pascal-format, fuzzy, badformat #| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages." msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." msgstr "El nom d'unitat %s%s%s és el mateix que el d'un component registrat.%sUtilitzar-lo pot causar missatges d'error estranys." #: lazarusidestrconsts.lisa2punitname #, fuzzy #| msgid "Unit Name:" msgid "Unit name:" msgstr "Nom de la unitat:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" msgstr "" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" msgstr "Avorta totes les càrregues" #: lazarusidestrconsts.lisaborted msgid "Aborted" msgstr "" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" msgstr "Avorta carrega del projecte" #: lazarusidestrconsts.lisabout #, fuzzy msgctxt "lazarusidestrconsts.lisabout" msgid "About" msgstr "Quant a" #: lazarusidestrconsts.lisabout2 #, object-pascal-format msgid "About %s" msgstr "" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" msgstr "" #: lazarusidestrconsts.lisaboutide msgid "About IDE" msgstr "" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" msgstr "Quant al Lazarus" #: lazarusidestrconsts.lisaboutlazarusmsg #, object-pascal-format msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers." msgstr "" #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." msgstr "" #: lazarusidestrconsts.lisaboutofficial msgid "Official:" msgstr "" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen #, object-pascal-format, fuzzy #| msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it." msgstr "Un %s no pot manegar TControls. %sNomés hi podeu posar components no visuals." #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" msgstr "" #: lazarusidestrconsts.lisaction msgid "Action:" msgstr "" #: lazarusidestrconsts.lisactivate msgid "Activate" msgstr "" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Activa sintaxi d'expressións regulars pel texte i reemplaçament (més similar a perl)" #: lazarusidestrconsts.lisactivateselected msgid "Activate Selected" msgstr "" #: lazarusidestrconsts.lisactive msgid "Active" msgstr "" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" msgstr "" #: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem msgid "Add a new separator above selected item" msgstr "" #: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem msgid "Add a new separator below selected item" msgstr "" #: lazarusidestrconsts.lisadddelphidefine msgid "Add defines simulating Delphi7" msgstr "" #: lazarusidestrconsts.lisadddelphidefinehint msgid "Useful when the code has checks for supported compiler versions" msgstr "" #: lazarusidestrconsts.lisaddedmissingobjectstopascalsource #, object-pascal-format msgid "Added missing object \"%s\" to pascal source." msgstr "" #: lazarusidestrconsts.lisaddedpropertysfors #, object-pascal-format msgid "Added property \"%s\" for %s." msgstr "" #: lazarusidestrconsts.lisaddfcutf8 msgid "Add -FcUTF8" msgstr "" #: lazarusidestrconsts.lisaddfcutf8hint msgid "May be needed if source files have non-ansistring literals." msgstr "" #: lazarusidestrconsts.lisaddfilter msgid "Add Filter ..." msgstr "" #: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage msgid "Addition does not fit the current message" msgstr "" #: lazarusidestrconsts.lisadditionfitsthecurrentmessage msgid "Addition fits the current message" msgstr "" #: lazarusidestrconsts.lisadditions msgid "Additions" msgstr "" #: lazarusidestrconsts.lisaddkeyworddo msgid "Add keyword \"do\"" msgstr "" #: lazarusidestrconsts.lisaddmodifieroverload msgid "Add modifier \"overload\"" msgstr "" #: lazarusidestrconsts.lisaddmodifieroverride msgid "Add modifier \"override\"" msgstr "" #: lazarusidestrconsts.lisaddmodifierreintroduce msgid "Add modifier \"reintroduce\"" msgstr "" #: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom #, object-pascal-format msgid "Add new build mode, copying settings from \"%s\"" msgstr "" #: lazarusidestrconsts.lisaddnewdiskfiles msgid "Add new disk files?" msgstr "" #: lazarusidestrconsts.lisaddnewfilesfromfilesystem msgid "Add New Files from File System" msgstr "" #: lazarusidestrconsts.lisaddnewmacro msgid "Add new macro" msgstr "" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" msgstr "" #: lazarusidestrconsts.lisaddpackagerequirement msgid "Add package requirement?" msgstr "" #: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)." msgstr "" #: lazarusidestrconsts.lisaddpackagetoproject2 msgid "Add package to project" msgstr "" #: lazarusidestrconsts.lisaddparameterbrackets msgid "Add parameter brackets" msgstr "" #: lazarusidestrconsts.lisaddthefollowingfiles msgid "Add the following files:" msgstr "" #: lazarusidestrconsts.lisaddtoincludesearchpath msgid "Add to include search path?" msgstr "" #: lazarusidestrconsts.lisaddtoproject #, object-pascal-format msgid "Add %s to project?" msgstr "Voleu afegir %s al projecte?" #: lazarusidestrconsts.lisaddtostartupcomponents msgid "Add to startup components?" msgstr "" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "" #: lazarusidestrconsts.lisaddunitinterfaces msgid "Add unit interfaces" msgstr "" #: lazarusidestrconsts.lisaddunitnotrecommended msgid "Add unit (not recommended)" msgstr "" #: lazarusidestrconsts.lisaddvaluetomacro #, object-pascal-format msgid "Add value to macro %s" msgstr "" #: lazarusidestrconsts.lisaf2paddfiletoapackage #, fuzzy #| msgid "Add file to a package" msgid "Add File to Package" msgstr "Afegeix el fitxer a un paquet" #: lazarusidestrconsts.lisaf2pdestinationpackage #, fuzzy #| msgid "Destination Package" msgid "Destination package" msgstr "Paquet de destinació" #: lazarusidestrconsts.lisaf2pfiletype #, fuzzy #| msgid "File Type" msgid "File type" msgstr "Tipus de fitxer" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" msgstr "El paquet no és vàlid" #: lazarusidestrconsts.lisaf2pinvalidpackageid #, object-pascal-format, fuzzy, badformat #| msgid "Invalid package ID: %s%s%s" msgid "Invalid package ID: \"%s\"" msgstr "L'ID del paquet no és vàlida: %s%s%s" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "El paquet només és de lectura" #: lazarusidestrconsts.lisaf2ppackagenotfound #, object-pascal-format, fuzzy, badformat #| msgid "Package %s%s%s not found." msgid "Package \"%s\" not found." msgstr "No s'ha trobat el paquet %s%s%s." #: lazarusidestrconsts.lisaf2pshowall #, fuzzy #| msgid "Show All" msgctxt "lazarusidestrconsts.lisaf2pshowall" msgid "Show all" msgstr "Mostra-ho tot" #: lazarusidestrconsts.lisaf2pthepackageisreadonly #, object-pascal-format msgid "The package %s is read only." msgstr "El paquet %s és de només lectura." #: lazarusidestrconsts.lisafilterwiththenamealreadyexists #, object-pascal-format msgid "A filter with the name \"%s\" already exists." msgstr "" #: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean msgid "After cleaning up (clean all or clean common files), switch to clean automatically" msgstr "" #: lazarusidestrconsts.lisalignment msgid "Alignment" msgstr "Alineació" #: lazarusidestrconsts.lisallblockslooksok #, fuzzy #| msgid "All blocks looks ok." msgid "All blocks look ok." msgstr "Tots els blocs semblen correctes." #: lazarusidestrconsts.lisallbuildmodes msgid "" msgstr "" #: lazarusidestrconsts.lisallinheritedoptions msgid "All inherited options" msgstr "" #: lazarusidestrconsts.lisalloptions #, object-pascal-format msgid "All options of FPC%s (\"%s\")" msgstr "" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Permet la recerca per múltiples línies" #: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall msgid "All parameters of this function are already set at this call. Nothing to add." msgstr "" #: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package." msgstr "" #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened #, object-pascal-format msgid "All your modifications to \"%s\"%swill be lost and the file reopened." msgstr "" #: lazarusidestrconsts.lisalpha msgid "Alpha" msgstr "" #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" msgstr "" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase msgid "Always convert suggested default file name to lowercase" msgstr "" #: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused msgid "Always draw selected items focused" msgstr "" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" msgstr "" #: lazarusidestrconsts.lisamacrowiththisnamealreadyexists msgid "A macro with this name already exists." msgstr "" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" msgstr "" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete #, object-pascal-format msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" msgstr "" #: lazarusidestrconsts.lisanchorbottomtobottomside msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "" #: lazarusidestrconsts.lisanchorbottomtotopside msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "" #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "" #: lazarusidestrconsts.lisanchorenabledhint #, object-pascal-format msgid "Enabled = Include %s in Anchors" msgstr "" #: lazarusidestrconsts.lisanchorlefttoleftside msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "" #: lazarusidestrconsts.lisanchorlefttorightside msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "" #: lazarusidestrconsts.lisanchorrighttoleftside msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "" #: lazarusidestrconsts.lisanchorrighttorightside msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "" #: lazarusidestrconsts.lisanchorsof #, object-pascal-format msgid "Anchors of %s" msgstr "" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "" #: lazarusidestrconsts.lisanchortoptobottomside msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "" #: lazarusidestrconsts.lisanchortoptotopside msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "" #: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro #, object-pascal-format, fuzzy, badformat #| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgid "An error occurred at last startup while loading %s!%sLoad this project again?" msgstr "Va ocorrer un error durant l'ultima execució mentre s'hi carregava %s!%s%sCarregar aquest projecte de nou?" #: lazarusidestrconsts.lisappearance msgid "Appearance" msgstr "" #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" msgstr "" #: lazarusidestrconsts.lisapplicationprogramdescriptor msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI." msgstr "" #: lazarusidestrconsts.lisapply msgctxt "lazarusidestrconsts.lisapply" msgid "Apply" msgstr "Aplica" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "Apply build flags (-B) to dependencies too." msgstr "" #: lazarusidestrconsts.lisapplyconventions msgid "Apply conventions" msgstr "" #: lazarusidestrconsts.lisapplyconventionshint msgid "Adjust name extension and character case for platform and file type." msgstr "" #: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects msgid "A project unit can not be used by other packages/projects" msgstr "" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "" #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Demana abans de reemplaçar cada text trobat" #: lazarusidestrconsts.lisaskbeforesavingprojectssession msgid "Ask before saving project's session" msgstr "" #: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform msgid "Ask for component name after putting it on a designer form." msgstr "" #: lazarusidestrconsts.lisaskforfilenameonnewfile msgid "Ask for file name on new file" msgstr "" #: lazarusidestrconsts.lisasknameoncreate msgid "Ask name on create" msgstr "" #: lazarusidestrconsts.lisautoadjustideheight msgid "Automatically adjust IDE main window height" msgstr "" #: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette msgid "Show complete component palette" msgstr "" #: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint msgid "If component palette spans over more lines, show them all and not only one." msgstr "" #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" msgstr "" #: lazarusidestrconsts.lisautocompletionon msgid "Auto completion: on" msgstr "" #: lazarusidestrconsts.lisautomarkup msgid "Markup and Matches" msgstr "" #: lazarusidestrconsts.lisautomatic msgctxt "lazarusidestrconsts.lisautomatic" msgid "Automatic" msgstr "" #: lazarusidestrconsts.lisautomatically msgid "Automatically" msgstr "" #: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs msgid "Automatically convert .lfm files to .lrs resource files" msgstr "" #: lazarusidestrconsts.lisautomaticallyignoreforselection msgid "do not complete selection" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeontype msgid "Automatically invoke on typing" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength msgid "Only complete if word is longer or equal" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend msgid "Only complete when at end of word" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer msgid "Use completion box delay" msgstr "" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" msgstr "" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" msgstr "" #: lazarusidestrconsts.lisautomaticallyontab msgid "tab" msgstr "" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" msgstr "" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" msgstr "" #: lazarusidestrconsts.lisautomaticallyusesinglepossibleident msgid "Automatically use single possible identifier" msgstr "" #: lazarusidestrconsts.lisautomaticfeatures msgid "Completion and Hints" msgstr "" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" msgstr "" #: lazarusidestrconsts.lisavailableforinstallation msgid "Available for installation" msgstr "" #: lazarusidestrconsts.lisavailableprojectbuildmodes msgid "Available project build modes" msgstr "" #: lazarusidestrconsts.lisbackupchangedfiles msgid "Make backup of changed files" msgstr "" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" msgstr "Ha fallat la còpia de seguretat" #: lazarusidestrconsts.lisbackuphint msgid "Creates a Backup directory under project directory" msgstr "" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies #, object-pascal-format msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Canviar el nom del paquet o versió, trenca les dependències. Voleu canviar aquestes dependències també?%sSeleccioneu Si per canviar totes les dependències llistades.%sSeleccioneu - Ignora - per trencar les dependències i continuar." #: lazarusidestrconsts.lisbegins msgid "begins" msgstr "" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" msgstr "" #: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes msgid "Be less verbose. Can be given multiple times." msgstr "" #: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes msgid "Be more verbose. Can be given multiple times." msgstr "" #: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" msgstr "" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always build before run" msgstr "" #: lazarusidestrconsts.lisbfbuildcommand msgid "Build Command" msgstr "" #: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts.lisbfruncommand msgid "Run Command" msgstr "" #: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor" msgstr "" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (leave empty for file path)" msgstr "" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" msgstr "" #: lazarusidestrconsts.lisborderspace msgid "Border space" msgstr "" #: lazarusidestrconsts.lisbottom msgctxt "lazarusidestrconsts.lisbottom" msgid "Bottom" msgstr "" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "" #: lazarusidestrconsts.lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" msgstr "Inferiors" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "" #: lazarusidestrconsts.lisbottomspaceequally msgid "Bottom space equally" msgstr "Iguala els espais inferiors" #: lazarusidestrconsts.lisbrowseandselectacompiler msgid "Browse and select a compiler (e.g. ppcx64" msgstr "" #: lazarusidestrconsts.lisbtnapply msgid "&Apply" msgstr "" #: lazarusidestrconsts.lisbtnclose msgctxt "lazarusidestrconsts.lisbtnclose" msgid "&Close" msgstr "Tan&ca" #: lazarusidestrconsts.lisbtndlgreplace msgctxt "lazarusidestrconsts.lisbtndlgreplace" msgid "&Replace ..." msgstr "" #: lazarusidestrconsts.lisbtnfind msgid "&Find" msgstr "" #: lazarusidestrconsts.lisbtnquit #, fuzzy #| msgid "Quit" msgctxt "lazarusidestrconsts.lisbtnquit" msgid "&Quit" msgstr "Surt" #: lazarusidestrconsts.lisbtnremove msgctxt "lazarusidestrconsts.lisbtnremove" msgid "&Remove" msgstr "" #: lazarusidestrconsts.lisbtnrename msgid "&Rename" msgstr "" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" msgstr "" #: lazarusidestrconsts.lisbuild msgctxt "lazarusidestrconsts.lisbuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "Build all files of project/package/IDE." msgstr "" #: lazarusidestrconsts.lisbuildcaption msgctxt "lazarusidestrconsts.lisbuildcaption" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lisbuilddate msgid "Build Date" msgstr "" #: lazarusidestrconsts.lisbuildide msgid "Build IDE" msgstr "" #: lazarusidestrconsts.lisbuildidewithpackages msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option." msgstr "" #: lazarusidestrconsts.lisbuilding msgid "Building" msgstr "" #: lazarusidestrconsts.lisbuildinglazarusfailed msgid "Building Lazarus failed" msgstr "" #: lazarusidestrconsts.lisbuildmode #, object-pascal-format msgid "Build Mode: %s" msgstr "" #: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes msgid "Differences between build modes" msgstr "" #: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes msgid "Differences from other build modes" msgstr "" #: lazarusidestrconsts.lisbuildmodediffmode msgid "Mode:" msgstr "" #: lazarusidestrconsts.lisbuildmodes msgid "Build mode" msgstr "" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" msgstr "Munta un projecte nou" #: lazarusidestrconsts.lisbuildnumber #, fuzzy #| msgid "Build Number" msgid "Build number" msgstr "Munta el número" #: lazarusidestrconsts.lisbuildstage msgctxt "lazarusidestrconsts.lisbuildstage" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lisbusy msgid "Busy" msgstr "" #: lazarusidestrconsts.lisbyte #, object-pascal-format msgid "%s byte" msgstr "" #: lazarusidestrconsts.liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "" #: lazarusidestrconsts.liscancelloadingunit msgid "Cancel loading unit" msgstr "Cancel·lar carrega de l'unitat" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" msgstr "Cancel·la canvi de nom" #: lazarusidestrconsts.liscannotcompileproject msgid "Cannot compile project" msgstr "" #: lazarusidestrconsts.liscannotcopytoplevelcomponent #, fuzzy #| msgid "Can not copy top level component." msgid "Cannot copy top level component." msgstr "No es pot copiar el component de nivell superior." #: lazarusidestrconsts.liscannotcreatefile #, object-pascal-format, fuzzy, badformat #| msgid "Cannot create file %s%s%s" msgid "Cannot create file \"%s\"" msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts.liscannotdeletelastmode msgid "Cannot delete last mode." msgstr "" #: lazarusidestrconsts.liscannotexecute #, object-pascal-format msgid "cannot execute \"%s\"" msgstr "" #: lazarusidestrconsts.liscannotfind #, object-pascal-format msgid "Cannot find %s" msgstr "" #: lazarusidestrconsts.liscannotfindexecutable #, object-pascal-format msgid "cannot find executable \"%s\"" msgstr "" #: lazarusidestrconsts.liscannotfindlazarusstarter #, object-pascal-format, fuzzy #| msgid "Cannot find lazarus starter:%s%s" msgid "Cannot find Lazarus starter:%s%s" msgstr "No es pot trobar l'iniciador del Lazarus:%s%s" #: lazarusidestrconsts.liscannotopenform #, object-pascal-format msgid "Cannot open form \"%s\"." msgstr "" #: lazarusidestrconsts.liscannotsaveform #, object-pascal-format msgid "Cannot save form \"%s\"." msgstr "" #: lazarusidestrconsts.liscannotsubstitutemacros #, object-pascal-format msgid "Cannot substitute macro \"%s\"." msgstr "" #: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling msgid "Cannot test the compiler while debugging or compiling." msgstr "" #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "" #: lazarusidestrconsts.liscantfindavalidppu #, object-pascal-format msgid "Can't find a valid %s.ppu" msgstr "" #: lazarusidestrconsts.liscaptioncomparefiles msgid "Compare files (not for creating patches)" msgstr "" #: lazarusidestrconsts.liscaptionofactivebuildmode msgid "Caption of active build mode" msgstr "" #: lazarusidestrconsts.liscbpfiles #, object-pascal-format msgid "%s (%s files)" msgstr "" #: lazarusidestrconsts.liscbpreallydeletesourcefiles #, object-pascal-format msgid "Really delete %s source files%s%s" msgstr "" #: lazarusidestrconsts.lisccdchangeclassof #, object-pascal-format msgid "Change Class of %s" msgstr "" #: lazarusidestrconsts.lisccdnoclass msgid "no class" msgstr "" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "" #: lazarusidestrconsts.lisccochecktestdir #, object-pascal-format msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" msgstr "" #: lazarusidestrconsts.lisccocompilernotanexe #, object-pascal-format msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "" #: lazarusidestrconsts.lisccocontains msgid "contains " msgstr "" #: lazarusidestrconsts.lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "" #: lazarusidestrconsts.lisccodatesdiffer #, object-pascal-format msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " msgstr "" #: lazarusidestrconsts.lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "" #: lazarusidestrconsts.lisccohasnewline msgid "new line symbols" msgstr "" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " msgstr "" #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" msgstr "" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" msgstr "" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" msgstr "" #: lazarusidestrconsts.lisccomsgrtlunitnotfound #, object-pascal-format msgid "RTL unit not found: %s" msgstr "" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" msgstr "" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" msgstr "" #: lazarusidestrconsts.lisccoppuexiststwice #, object-pascal-format msgid "ppu exists twice: %s, %s" msgstr "" #: lazarusidestrconsts.lisccoppuolderthancompiler #, object-pascal-format msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "" #: lazarusidestrconsts.lisccortlunitnotfounddetailed #, object-pascal-format msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken." msgstr "" #: lazarusidestrconsts.lisccoseveralcompilers #, object-pascal-format msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "" #: lazarusidestrconsts.lisccoskip msgctxt "lazarusidestrconsts.lisccoskip" msgid "Skip" msgstr "" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" msgstr "" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." msgstr "" #: lazarusidestrconsts.lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "" #: lazarusidestrconsts.lisccounabletocreatetestpascalfile #, object-pascal-format msgid "Unable to create Test Pascal file \"%s\"." msgstr "" #: lazarusidestrconsts.lisccounusualchars msgid "unusual characters" msgstr "" #: lazarusidestrconsts.lisccowarningcaption msgctxt "lazarusidestrconsts.lisccowarningcaption" msgid "Warning" msgstr "" #: lazarusidestrconsts.lisccowarningmsg msgid "WARNING: " msgstr "" #: lazarusidestrconsts.lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "" #: lazarusidestrconsts.liscecategories msgid "Categories" msgstr "" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" msgstr "" #: lazarusidestrconsts.lisceconstants msgid "Constants" msgstr "" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" msgstr "" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" msgstr "" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" msgstr "" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" msgstr "" #: lazarusidestrconsts.liscefilter #, fuzzy #| msgid "(Filter)" msgid "(filter)" msgstr "(Filtre)" #: lazarusidestrconsts.liscefollowcursor msgid "Follow cursor" msgstr "" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" msgstr "" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treated as \"many\"" msgstr "" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" msgstr "" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" msgstr "" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" msgstr "" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" msgstr "" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" msgstr "" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treated as \"many\"" msgstr "" #: lazarusidestrconsts.liscenteralostwindow msgid "Center a lost window" msgstr "" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored." msgstr "" #: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored." msgstr "" #: lazarusidestrconsts.liscenterform msgid "Center Form" msgstr "" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" msgstr "Centra a la finestra" #: lazarusidestrconsts.liscenters msgid "Centers" msgstr "Centres" #: lazarusidestrconsts.lisceomode msgid "Preferred exhibition mode" msgstr "" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" msgstr "" #: lazarusidestrconsts.lisceomodesource msgctxt "lazarusidestrconsts.lisceomodesource" msgid "Source" msgstr "" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" msgstr "Mai, sols manualment" #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "" #: lazarusidestrconsts.lisceoonidle msgid "On idle" msgstr "" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" msgstr "Actualitza automàticament" #: lazarusidestrconsts.lisceothergroup msgctxt "lazarusidestrconsts.lisceothergroup" msgid "Other" msgstr "Altres" #: lazarusidestrconsts.lisceoupdate msgid "Update" msgstr "" #: lazarusidestrconsts.lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "" #: lazarusidestrconsts.lisceprocedures msgid "Procedures" msgstr "" #: lazarusidestrconsts.lisceproperties msgctxt "lazarusidestrconsts.lisceproperties" msgid "Properties" msgstr "" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" msgstr "" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observations about" msgstr "" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" msgstr "" #: lazarusidestrconsts.liscesurrounding msgid "Surrounding" msgstr "" #: lazarusidestrconsts.liscetodos msgid "ToDos" msgstr "" #: lazarusidestrconsts.liscetypes msgid "Types" msgstr "" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" msgstr "" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" msgstr "" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" msgstr "" #: lazarusidestrconsts.lisceuses msgctxt "lazarusidestrconsts.lisceuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.liscevariables msgid "Variables" msgstr "" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" msgstr "" #: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof #, object-pascal-format msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection msgid "Do not know how to copy this form editing selection" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection msgid "Do not know how to cut this form editing selection" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection msgid "Do not know how to delete this form editing selection" msgstr "" #: lazarusidestrconsts.liscfeerrorcreatingcomponent msgid "Error creating component" msgstr "" #: lazarusidestrconsts.liscfeerrorcreatingcomponent2 #, object-pascal-format msgid "Error creating component: %s%s%s" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingcomponent msgid "Error destroying component" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit #, object-pascal-format msgid "Error destroying component of type %s of unit %s:%s%s" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingmediator msgid "Error destroying mediator" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit #, object-pascal-format msgid "Error destroying mediator %s of unit %s:%s%s" msgstr "" #: lazarusidestrconsts.liscfeinfile #, object-pascal-format msgid "In file %s" msgstr "" #: lazarusidestrconsts.liscfeinvalidcomponentowner msgid "Invalid component owner" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists msgid "TCustomFormEditor.CreateNonFormForm already exists" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype #, object-pascal-format msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn #, object-pascal-format msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre #, object-pascal-format msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" msgstr "" #: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror #, object-pascal-format msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" msgstr "" #: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto #, object-pascal-format msgid "The component of type %s failed to set its owner to %s:%s" msgstr "" #: lazarusidestrconsts.liscfeunabletocleartheformeditingselection #, object-pascal-format msgid "Unable to clear the form editing selection%s%s" msgstr "" #: lazarusidestrconsts.lischange msgctxt "lazarusidestrconsts.lischange" msgid "Change" msgstr "Canvia" #: lazarusidestrconsts.lischangebuildmode msgid "Change build mode" msgstr "" #: lazarusidestrconsts.lischangeclass msgid "Change Class" msgstr "Canvia la Classe" #: lazarusidestrconsts.lischangedscoordofsfromdtodinsides #, object-pascal-format msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." msgstr "" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" msgstr "" #: lazarusidestrconsts.lischangefile msgid "Change file" msgstr "" #: lazarusidestrconsts.lischangeparent msgid "Change Parent" msgstr "" #: lazarusidestrconsts.lischangeswerenotsaved msgid "Changes were not saved" msgstr "" #: lazarusidestrconsts.lischangetounix msgid "Change to Unix /" msgstr "" #: lazarusidestrconsts.lischangetowindows msgid "Change to Windows \\" msgstr "" #: lazarusidestrconsts.lischeckall msgid "Check All" msgstr "" #: lazarusidestrconsts.lischeckcompilerpath msgid "Please make sure that the path to the compiler in the IDE options is correct." msgstr "" #: lazarusidestrconsts.lischeckfordiskfilechangesviacontent msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent" msgid "Check for disk file changes via content rather than timestamp" msgstr "" #: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil #, object-pascal-format msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source." msgstr "" #: lazarusidestrconsts.lischeckifpackageisinthedependencies #, object-pascal-format msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies" msgid ". Check if package %s is in the dependencies" msgstr "" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"." msgstr "" #: lazarusidestrconsts.lischeckoptions msgid "Check options" msgstr "" #: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme #, object-pascal-format msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme" msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections." msgstr "" #: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded msgid "Check the next token in source and add a semicolon if needed." msgstr "" #: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco #, object-pascal-format msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." msgstr "" #: lazarusidestrconsts.lischeckuncheckall msgid "Check/uncheck all" msgstr "" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" msgstr "Tria un nom diferent" #: lazarusidestrconsts.lischooseafilewithcodetoolstemplates msgid "Choose a file with CodeTools templates" msgstr "" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." msgstr "" #: lazarusidestrconsts.lischooseanameforthecomponent msgid "Choose a name for the component" msgstr "" #: lazarusidestrconsts.lischooseanexamplefile msgid "Choose an example file" msgstr "" #: lazarusidestrconsts.lischooseanfpcmessagefile msgid "Choose an FPC message file" msgstr "" #: lazarusidestrconsts.lischooseapascalfileforindentationexamples msgid "Choose a Pascal file for indentation examples" msgstr "" #: lazarusidestrconsts.lischoosecompilerexecutable #, object-pascal-format msgid "Choose compiler executable (%s)" msgstr "" #: lazarusidestrconsts.lischoosecompilermessages msgid "Choose compiler messages file" msgstr "" #: lazarusidestrconsts.lischoosedebuggerexecutable msgid "Choose debugger executable" msgstr "" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Tria una unitat Delphi (*.pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" msgstr "Tria el directori" #: lazarusidestrconsts.lischooseexecutable msgid "Choose an executable" msgstr "" #: lazarusidestrconsts.lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "Tria un directori del codi font del FPC" #: lazarusidestrconsts.lischoosefppkgconfigurationfile msgid "Choose the fppkg configuration file" msgstr "" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "Tria un directori del Lazarus" #: lazarusidestrconsts.lischoosemakeexecutable msgid "Choose \"make\" executable" msgstr "" #: lazarusidestrconsts.lischoosenameandtext msgid "Choose name and text" msgstr "" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "Tria un dels següents elements per crear un nou Arxiu" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "Tria un dels següents elements per crear un nou Paquet" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "Tra un dels següents elements per crear un nou Projecte" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Tria el codi font del programa (*.pp, *.pas, *.lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Tria l'estructura per a contenir la selecció" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "" #: lazarusidestrconsts.liscirculardependencydetected msgid "Circular dependency detected" msgstr "" #: lazarusidestrconsts.lisclass msgid "&Class" msgstr "" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" msgstr "" #: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked msgid "Classes and properties exist. Values were not checked." msgstr "" #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste #, object-pascal-format, fuzzy, badformat #| msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgid "Class \"%s\" is not a registered component class.%sUnable to paste." msgstr "La classe %s%s%s no està registrada com a component de classe. %sNo es pot enganxar" #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" msgstr "No s'ha trobat la classe" #: lazarusidestrconsts.lisclassnotfoundat #, object-pascal-format msgid "Class %s not found at %s(%s,%s)" msgstr "" #: lazarusidestrconsts.lisclassofmethodnotfound #, object-pascal-format msgid "Class \"%s\" of method \"%s\" not found." msgstr "" #: lazarusidestrconsts.liscldirclean msgid "Clean" msgstr "" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" msgstr "Neteja el directori" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" msgstr "Neteja els subdirectoris" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Manté tots els fitxers de text" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "Manté els fitxers que coincideixin amb el filtre" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "Elimina els fitxers que concordin amb el filtre" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Sintaxi simple (p.ex. * en lloc de .*)" #: lazarusidestrconsts.liscleanall msgid "Clean all" msgstr "" #: lazarusidestrconsts.liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Neteja el codi del Lazarus" #: lazarusidestrconsts.liscleanonlyonce msgid "Switch after building to automatically" msgstr "" #: lazarusidestrconsts.liscleanup msgid "Clean up" msgstr "" #: lazarusidestrconsts.liscleanupandbuild msgctxt "lazarusidestrconsts.liscleanupandbuild" msgid "Clean up and build" msgstr "" #: lazarusidestrconsts.liscleanupandbuildproject msgid "Clean up and build project" msgstr "" #: lazarusidestrconsts.liscleanuplazbuild msgid "Clean up + lazbuild" msgstr "" #: lazarusidestrconsts.liscleanuppackage #, object-pascal-format msgid "Clean up package \"%s\"." msgstr "" #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" msgstr "" #: lazarusidestrconsts.lisclear msgctxt "lazarusidestrconsts.lisclear" msgid "Clear" msgstr "Neteja" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" msgstr "" #: lazarusidestrconsts.lisclearfilter msgid "Clear filter" msgstr "" #: lazarusidestrconsts.lisclearthefilterforoptions msgid "Clear the filter for options" msgstr "" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "" #: lazarusidestrconsts.lisclicktoseethechoices msgid "Click to see the choices" msgstr "" #: lazarusidestrconsts.lisclicktoselectpalettepage msgid "Click to Select Palette Page" msgstr "" #: lazarusidestrconsts.lisclone msgid "Clone" msgstr "" #: lazarusidestrconsts.lisclose #, fuzzy #| msgid "&Close" msgctxt "lazarusidestrconsts.lisclose" msgid "Close" msgstr "Tan&ca" #: lazarusidestrconsts.liscloseallchecked msgid "Close All Checked" msgstr "" #: lazarusidestrconsts.lisclosealltabsclose msgid "Close files" msgstr "" #: lazarusidestrconsts.lisclosealltabshide msgctxt "lazarusidestrconsts.lisclosealltabshide" msgid "Hide window" msgstr "" #: lazarusidestrconsts.lisclosealltabsquestion msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" msgstr "" #: lazarusidestrconsts.lisclosealltabstitle msgid "Close Source Editor Window" msgstr "" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "Opcions específiques de l'interfície LCL" #: lazarusidestrconsts.liscmparameter msgid "Parameter" msgstr "Paràmetre" #: lazarusidestrconsts.liscmplstcomponents msgctxt "lazarusidestrconsts.liscmplstcomponents" msgid "Components" msgstr "" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" msgstr "" #: lazarusidestrconsts.liscmplstlist msgid "List" msgstr "" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" msgstr "" #: lazarusidestrconsts.liscmppages msgid "Pages" msgstr "" #: lazarusidestrconsts.liscmppalettevisible msgid "Palette is &visible" msgstr "" #: lazarusidestrconsts.liscmprestoredefaults msgid "&Restore defaults" msgstr "" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "" #: lazarusidestrconsts.liscocallon msgid "Call on:" msgstr "Marqueu:" #: lazarusidestrconsts.liscoclickokifaresuretodothat #, object-pascal-format, fuzzy #| msgid "%s%sClick OK if you are sure to do that." msgid "%s%sClick OK if you definitely want to do that." msgstr "%s%sClica D'Acord si estàs segur de fer-ho." #: lazarusidestrconsts.liscocommand msgctxt "lazarusidestrconsts.liscocommand" msgid "Command:" msgstr "Ordre:" #: lazarusidestrconsts.liscode msgid "Code" msgstr "" #: lazarusidestrconsts.liscodebrowser msgctxt "lazarusidestrconsts.liscodebrowser" msgid "Code Browser" msgstr "" #: lazarusidestrconsts.liscodecreationdialogcaption msgid "Code creation options" msgstr "" #: lazarusidestrconsts.liscodecreationdialogclasssection msgid "Class section" msgstr "" #: lazarusidestrconsts.liscodecreationdialoglocation msgctxt "lazarusidestrconsts.liscodecreationdialoglocation" msgid "Location" msgstr "" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" msgstr "" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" msgstr "Afegeix trajectòria" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton #, fuzzy msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" msgstr "Navega" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" msgstr "" #: lazarusidestrconsts.liscodehelpcreatebutton msgid "Create help item" msgstr "" #: lazarusidestrconsts.liscodehelpdeletepathbutton msgid "Remove path" msgstr "" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" msgstr "" #: lazarusidestrconsts.liscodehelperrorstag #, fuzzy msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" msgstr "Errors" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" msgstr "Ejemple" #: lazarusidestrconsts.liscodehelpgroupbox msgid "FPDoc settings" msgstr "" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "Insereix marca de formateig en cursiva" #: lazarusidestrconsts.liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintvartag msgid "Insert var formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpinherited msgctxt "lazarusidestrconsts.liscodehelpinherited" msgid "Inherited" msgstr "Heretat" #: lazarusidestrconsts.liscodehelpinsertalink msgid "Insert a link ..." msgstr "" #: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpmainformcaption msgctxt "lazarusidestrconsts.liscodehelpmainformcaption" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" msgstr "" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" msgstr "Vore tambè" #: lazarusidestrconsts.liscodehelpshortdescriptionof msgid "Short description of" msgstr "" #: lazarusidestrconsts.liscodehelpshorttag msgid "Short" msgstr "" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" msgstr "" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" msgstr "" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" msgstr "" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" msgstr "" #: lazarusidestrconsts.liscodetempladd #, fuzzy #| msgid "Add" msgctxt "lazarusidestrconsts.liscodetempladd" msgid "Add template" msgstr "Afegeix" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" msgstr "Afegeix la plantilla del codi" #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on" msgstr "" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" msgstr "Comentari:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" msgstr "Edita la plantilla del codi" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.liscodetemplerroralreadyexists msgid "A token already exists." msgstr "" #: lazarusidestrconsts.liscodetemplerroremptyname msgid "The token cannot be empty." msgstr "" #: lazarusidestrconsts.liscodetemplerrorinvalidname msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number." msgstr "" #: lazarusidestrconsts.liscodetempltoken msgid "Token:" msgstr "Testimoni" #: lazarusidestrconsts.liscodetoolsdefsaction #, object-pascal-format msgid "Action: %s" msgstr "Acció: %s" #: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly #, object-pascal-format, fuzzy #| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes." msgstr "Els nodes generats automàticament ni es poden editar, %sni poden tenir nodes fills" #: lazarusidestrconsts.liscodetoolsdefsautogenerated #, object-pascal-format msgid "%s, auto generated" msgstr "%s, generat automàticament" #: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited #, fuzzy #| msgid "Auto generated nodes can not be edited." msgid "Auto generated nodes cannot be edited." msgstr "Els nodes generats automàticament no poden ser editats" #: lazarusidestrconsts.liscodetoolsdefsblock msgid "Block" msgstr "Bloc" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "Editor de les definicions de les eines del codi" #: lazarusidestrconsts.liscodetoolsdefscompilerpath #, fuzzy #| msgid "compiler path" msgid "Compiler path" msgstr "trajectòria del compilador" #: lazarusidestrconsts.liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Converteix el node" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory #, object-pascal-format msgid "Create Defines for %s Directory" msgstr "Crea les definicions pel directori %s" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "Crea les definicions pel compilador Free Pascal" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal Git Sources" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject #, object-pascal-format msgid "Create Defines for %s Project" msgstr "Crea les definicions pel projecte %s" #: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "Crea les macroinstruccions FPC i les trajectòries per un directori de projecte FPC" #: lazarusidestrconsts.liscodetoolsdefsdefine msgid "Define" msgstr "Defineix" #: lazarusidestrconsts.liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "Defineix el recurs" #: lazarusidestrconsts.liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Elimina el node" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc #, object-pascal-format, fuzzy, badformat msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "El %s directori principal, %s on Borland a instal·lat totes les fonts %s. Per exemple: C:/Programme/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject #, object-pascal-format, fuzzy, badformat msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "El directori principal %s, on Borland ha instal·lat totes les fonts %s i que son utilitzades per aquest projecte.%s Per exemple: C:/Programme/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdescription msgid "Description:" msgstr "Descripció" #: lazarusidestrconsts.liscodetoolsdefsdirectory #, object-pascal-format msgid "%s directory" msgstr "%s directori" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" msgstr "Else" #: lazarusidestrconsts.liscodetoolsdefselseif msgid "ElseIf" msgstr "ElseIf" #: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC Git source directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsif msgid "If" msgstr "If" #: lazarusidestrconsts.liscodetoolsdefsifdef msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef" msgid "IfDef" msgstr "IfDef" #: lazarusidestrconsts.liscodetoolsdefsifndef msgid "IfNDef" msgstr "IfNDef" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Directori" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "Insereix plantilla del directori del Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "Insereix plantilla de projecte Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "Insereix plantilla del directori del Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "Insereix plantilla del projecte Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "Insereix plantilla de projecte Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "Insereix plantilla del compilador Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "Insereix plantilla del projecte Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal Git Source Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "Insereix plantilla del compilador Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "Insereix plantilla del directori Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "Insereix plantilla de projecte Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "Insereix el node com a fill" #: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "Insereix el node avall" #: lazarusidestrconsts.liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "Insereix la plantilla" #: lazarusidestrconsts.liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "El pare no és vàlid" #: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "El node pare no és vàlid" #: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "El node anterior no és vàlid" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s,%si que son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "Mou el node avall" #: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "Mou el node un nivell avall" #: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "Mou el node un nivell amunt" #: lazarusidestrconsts.liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "Mou el node amunt" #: lazarusidestrconsts.liscodetoolsdefsname msgctxt "lazarusidestrconsts.liscodetoolsdefsname" msgid "Name:" msgstr "Nom:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" msgstr "Nou node" #: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "El node és només de lectura" #: lazarusidestrconsts.liscodetoolsdefsnoneselected msgid "none selected" msgstr "cap de seleccionat" #: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch #, fuzzy #| msgid "Parent node can not contain child nodes." msgid "Parent node cannot contain child nodes." msgstr "El node pare no pot contenir nodes fills" #: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "El node anterior no pot contenir nodes fill" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory #, fuzzy msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" msgstr "Directori del projecte" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 #, object-pascal-format msgid "%s project directory" msgstr "directori del projecte %s" #: lazarusidestrconsts.liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Node seleccionat" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "El directori del projecte Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal Git source directory." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample #, object-pascal-format, fuzzy #| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "La trajectòria al compilador Free Pascal.%s Per exemple %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etcfpc.cfg%s." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa #, object-pascal-format msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory #, object-pascal-format msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "El directori del projecte %s, %s el qual conté el fitxer .dpr, dpk" #: lazarusidestrconsts.liscodetoolsdefsundefine msgid "Undefine" msgstr "Indefineix" #: lazarusidestrconsts.liscodetoolsdefsundefineall msgid "Undefine All" msgstr "Indefineix-ho tot" #: lazarusidestrconsts.liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "Indefineix el recurs" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Valor com a text" #: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid #, object-pascal-format msgid "%s:%svalue \"%s\" is invalid." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" msgstr "variable:" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" msgstr "A" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" msgstr "" #: lazarusidestrconsts.liscodetoolsoptscaret msgid "Caret (^)" msgstr "" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" msgstr "Dos punts" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" msgstr "Coma" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" msgid "Identifier" msgstr "Identificador" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" msgstr "Paraula clau" #: lazarusidestrconsts.liscodetoolsoptsnewline msgid "Newline" msgstr "Nova línia" #: lazarusidestrconsts.liscodetoolsoptsnone msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" msgstr "Número" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" msgstr "Punt" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Punt i coma" #: lazarusidestrconsts.liscodetoolsoptsspace msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" msgid "Space" msgstr "Espaiat" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" msgstr "Constant alfanumèrica" #: lazarusidestrconsts.liscodetoolsoptssymbol msgid "Symbol" msgstr "Símbol" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" msgstr "Executa després de" #: lazarusidestrconsts.liscoexecutebefore msgid "Execute before" msgstr "Executa abans de" #: lazarusidestrconsts.liscollapse msgid "Collapse" msgstr "" #: lazarusidestrconsts.liscollapseall msgid "Collapse All [Ctrl+Minus]" msgstr "" #: lazarusidestrconsts.liscollapseall2 msgid "Collapse All" msgstr "" #: lazarusidestrconsts.liscollapseallclasses msgid "Collapse all classes" msgstr "" #: lazarusidestrconsts.liscollapseallpackages msgid "Collapse all packages" msgstr "" #: lazarusidestrconsts.liscollapseallunits msgid "Collapse all units" msgstr "" #: lazarusidestrconsts.liscomboboxes msgid "Combo Boxes" msgstr "" #: lazarusidestrconsts.liscommandlineparameters msgctxt "lazarusidestrconsts.liscommandlineparameters" msgid "Command line parameters" msgstr "" #: lazarusidestrconsts.liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Paràmetres de la línia d'ordres del programa" #: lazarusidestrconsts.liscompile msgctxt "lazarusidestrconsts.liscompile" msgid "Compile" msgstr "Compila" #: lazarusidestrconsts.liscompileanddonotaskagain msgid "Compile and do not ask again" msgstr "" #: lazarusidestrconsts.liscompilefollowingmodes msgid "Compile the following modes" msgstr "" #: lazarusidestrconsts.liscompilenormally msgid "Compile normally" msgstr "" #: lazarusidestrconsts.liscompileproject msgid "Compile Project" msgstr "" #: lazarusidestrconsts.liscompiler msgid "Compiler" msgstr "Compilador" #: lazarusidestrconsts.liscompilercfgismissing #, object-pascal-format msgid "%s is missing." msgstr "" #: lazarusidestrconsts.liscompilerdoesnotsupporttarget #, object-pascal-format msgid "Compiler \"%s\" does not support target %s-%s" msgstr "" #: lazarusidestrconsts.liscompilererrorinvalidcompiler #, object-pascal-format msgid "Error: invalid compiler: %s" msgstr "S'ha produït un error: el compilador %s no és vàlid." #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" msgstr "Nom del fitxer del compilador" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath #, fuzzy #| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" msgstr "Suggeriment: podeu triar la trajectòria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectòria del compilador" #: lazarusidestrconsts.liscompilermessagesfilenotfound #, object-pascal-format msgid "Compiler messages file not found:%s%s" msgstr "" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "Nota: No s'ha trobat el fitxer de configuració de les eines del codi, s'utilitzen els valors predeterminats" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "Nota: S'està carregant el fitxer de les opcions de les eines del codi antic: " #: lazarusidestrconsts.liscompilestage msgctxt "lazarusidestrconsts.liscompilestage" msgid "Compile" msgstr "Compila" #: lazarusidestrconsts.liscompilewithprojectsettings msgid "Compile with project settings" msgstr "" #: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates msgid "Compile with -vd for more details. Check for duplicates." msgstr "" #: lazarusidestrconsts.liscompiling #, object-pascal-format msgid "%s (compiling ...)" msgstr "%s (s'està compilant ...)" #: lazarusidestrconsts.liscompletionlonglinehinttype msgid "Show long line hints" msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttypefullleft msgid "Extend far left" msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft msgid "Extend some left" msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttypenone msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" msgid "Never" msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttyperightonly msgid "Extend right only" msgstr "" #: lazarusidestrconsts.liscomponentnameiskeyword #, object-pascal-format, fuzzy, badformat #| msgid "Component name %s%s%s is keyword" msgid "Component name \"%s\" is keyword" msgstr "El nom de component %s%s%s és paraula clau" #: lazarusidestrconsts.liscomppalcomponentlist msgid "View All" msgstr "" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" msgstr "Obre el paquet" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" msgstr "Obre la unitat" #: lazarusidestrconsts.liscompress msgid "Compress" msgstr "" #: lazarusidestrconsts.liscompresshint msgid "The resulting directory will be compressed into a ZIP file." msgstr "" #: lazarusidestrconsts.liscomptest #, fuzzy #| msgid "Test" msgctxt "lazarusidestrconsts.liscomptest" msgid "&Test" msgstr "Prova" #: lazarusidestrconsts.liscondition msgid "Condition" msgstr "" #: lazarusidestrconsts.lisconditionals msgctxt "lazarusidestrconsts.lisconditionals" msgid "Conditionals" msgstr "" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" msgstr "Directori de configuració del Lazarus" #: lazarusidestrconsts.lisconfigfileofadditions msgid "Config file of additions:" msgstr "" #: lazarusidestrconsts.lisconfigurebuild #, object-pascal-format msgid "Configure Build %s" msgstr "" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" msgstr "" #: lazarusidestrconsts.lisconfigureeditortoolbar msgid "Configure Toolbar" msgstr "" #: lazarusidestrconsts.lisconfigurelazaruside msgid "Configure Lazarus IDE" msgstr "" #: lazarusidestrconsts.lisconfirm msgid "Confirm" msgstr "" #: lazarusidestrconsts.lisconfirmation msgid "Confirmation" msgstr "" #: lazarusidestrconsts.lisconfirmbuildallprofiles #, object-pascal-format msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" msgstr "" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" msgstr "Confirma els canvis" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" msgstr "" #: lazarusidestrconsts.lisconfirmlazarusrebuild #, object-pascal-format, fuzzy, badformat #| msgid "Do you want to rebuild Lazarus with profile: %s ?" msgid "Do you want to rebuild Lazarus with profile: %s?" msgstr "Vols reconstruïr Lazarus?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "" #: lazarusidestrconsts.lisconfirmpackageaction msgctxt "lazarusidestrconsts.lisconfirmpackageaction" msgid "Action" msgstr "" #: lazarusidestrconsts.lisconfirmpackagenewpackageset msgid "New package set" msgstr "" #: lazarusidestrconsts.lisconfirmpackageoldpackageset msgid "Old package set" msgstr "" #: lazarusidestrconsts.lisconflict msgid "Conflict" msgstr "" #: lazarusidestrconsts.lisconflictdetected msgid "Conflict detected" msgstr "" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" msgstr "" #: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc." msgstr "" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" msgstr "" #: lazarusidestrconsts.liscontains msgid "contains" msgstr "" #: lazarusidestrconsts.liscontents #, fuzzy msgctxt "lazarusidestrconsts.liscontents" msgid "Contents" msgstr "Contingut" #: lazarusidestrconsts.liscontextsensitive msgid "Context sensitive" msgstr "" #: lazarusidestrconsts.liscontinueanddonotaskagain msgid "Continue and do not ask again" msgstr "" #: lazarusidestrconsts.liscontinuebuilding msgid "Continue building" msgstr "" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Continua sense carregar la forma" #: lazarusidestrconsts.liscontributors msgid "Contributors" msgstr "" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" msgstr "El control necessita pare" #: lazarusidestrconsts.lisconvaddcommentafterreplacement msgid "Add comment after replacement" msgstr "" #: lazarusidestrconsts.lisconvaddedmodedelphimodifier msgid "Added MODE Delphi syntax modifier after unit name." msgstr "" #: lazarusidestrconsts.lisconvaddingflagforregister #, object-pascal-format msgid "Adding flag for \"Register\" procedure in unit %s." msgstr "" #: lazarusidestrconsts.lisconvbracketmissingfromreplfunc #, object-pascal-format msgid "\")\" is missing from replacement function: %s" msgstr "" #: lazarusidestrconsts.lisconvbracketnotfound msgid "Bracket not found" msgstr "" #: lazarusidestrconsts.lisconvconvertedfrom #, object-pascal-format msgid " { *Converted from %s* }" msgstr "" #: lazarusidestrconsts.lisconvcoordhint msgid "An offset is added to Top coordinate of controls inside visual containers" msgstr "" #: lazarusidestrconsts.lisconvcoordoffs msgid "Coordinate offsets" msgstr "" #: lazarusidestrconsts.lisconvdeletedfile #, object-pascal-format msgid "Deleted file %s" msgstr "" #: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines #, object-pascal-format msgid "Added defines %s in custom options" msgstr "" #: lazarusidestrconsts.lisconvdelphiaddedpackagedependency #, object-pascal-format msgid "Added Package %s as a dependency." msgstr "" #: lazarusidestrconsts.lisconvdelphiaddedunittousessection #, object-pascal-format msgid "Added unit \"%s\" to uses section." msgstr "" #: lazarusidestrconsts.lisconvdelphiallsubdirsscanned msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" msgid "All sub-directories will be scanned for unit files" msgstr "" #: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed msgid "BeginCodeTools failed!" msgstr "" #: lazarusidestrconsts.lisconvdelphicategories msgid "Categories:" msgstr "" #: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 #, object-pascal-format msgid "Changed encoding from %s to UTF-8" msgstr "" #: lazarusidestrconsts.lisconvdelphiconversionaborted msgid "Conversion Aborted." msgstr "" #: lazarusidestrconsts.lisconvdelphiconversionready msgid "Conversion Ready." msgstr "" #: lazarusidestrconsts.lisconvdelphiconversiontook #, object-pascal-format msgid "Conversion took: %s" msgstr "" #: lazarusidestrconsts.lisconvdelphiconvertdelphipackage msgid "Convert Delphi package" msgstr "" #: lazarusidestrconsts.lisconvdelphiconvertdelphiproject msgid "Convert Delphi project" msgstr "" #: lazarusidestrconsts.lisconvdelphiconvertdelphiunit msgid "Convert Delphi unit" msgstr "" #: lazarusidestrconsts.lisconvdelphiconvertingfoundunits msgid "*** Converting unit files found during conversion ***" msgstr "" #: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits msgid "*** Converting unit files belonging to project/package ***" msgstr "" #: lazarusidestrconsts.lisconvdelphierror #, object-pascal-format msgid "Error=\"%s\"" msgstr "" #: lazarusidestrconsts.lisconvdelphiexceptionduringconversion msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." msgstr "" #: lazarusidestrconsts.lisconvdelphifailedconvertingunit msgid "Failed converting unit" msgstr "" #: lazarusidestrconsts.lisconvdelphifailedtoconvertunit #, object-pascal-format msgid "Failed to convert unit \"%s\"" msgstr "" #: lazarusidestrconsts.lisconvdelphifixedunitcase #, object-pascal-format msgid "Fixed character case of unit \"%s\" to \"%s\"." msgstr "" #: lazarusidestrconsts.lisconvdelphifoundallunitfiles msgid "Found all unit files" msgstr "" #: lazarusidestrconsts.lisconvdelphifunc msgid "Delphi Function" msgstr "" #: lazarusidestrconsts.lisconvdelphimissingincludefile #, object-pascal-format msgid "%s(%s,%s) missing include file" msgstr "" #: lazarusidestrconsts.lisconvdelphiname msgid "Delphi Name" msgstr "" #: lazarusidestrconsts.lisconvdelphipackagenameexists msgid "Package name exists" msgstr "" #: lazarusidestrconsts.lisconvdelphipackagerequired #, object-pascal-format msgid "Package %s is required but not installed in Lazarus! Install it later." msgstr "" #: lazarusidestrconsts.lisconvdelphiprojomittedunit #, object-pascal-format msgid "Omitted unit %s from project" msgstr "" #: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection #, object-pascal-format msgid "Removed unit \"%s\" from uses section." msgstr "" #: lazarusidestrconsts.lisconvdelphirepairingformfiles msgid "*** Fixing used units and Repairing form files ***" msgstr "" #: lazarusidestrconsts.lisconvdelphireplacedunitinusessection #, object-pascal-format msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" msgid "Replaced unit \"%s\" with \"%s\" in uses section." msgstr "" #: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa #, object-pascal-format msgid "There is already a package with the name \"%s\"%sPlease close this package first." msgstr "" #: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl msgid "Unitname exists in LCL" msgstr "" #: lazarusidestrconsts.lisconvdelphiunitstoreplacein #, object-pascal-format msgid "Units to replace in %s" msgstr "" #: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl #, object-pascal-format msgid "LCL already has a unit with name %s. Delete local file %s?" msgstr "" #: lazarusidestrconsts.lisconvdprojfilenotsupportedyet msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages." msgstr "" #: lazarusidestrconsts.lisconversionerror msgid "Conversion error" msgstr "S'ha produït un error de conversió" #: lazarusidestrconsts.lisconvert msgid "Convert" msgstr "" #: lazarusidestrconsts.lisconvertencoding msgid "Convert Encoding" msgstr "" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" msgstr "" #: lazarusidestrconsts.lisconvertotherhint msgid "Other options affecting the conversion" msgstr "" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" msgstr "" #: lazarusidestrconsts.lisconverttarget msgid "Target" msgstr "" #: lazarusidestrconsts.lisconverttargetcrossplatform msgid "Cross-platform" msgstr "" #: lazarusidestrconsts.lisconverttargetcrossplatformhint msgid "Cross-platform versus Windows-only" msgstr "" #: lazarusidestrconsts.lisconverttargethint msgid "Converter adds conditional compilation to support different targets" msgstr "" #: lazarusidestrconsts.lisconverttargetsamedfmfile msgid "Use the same DFM form file" msgstr "" #: lazarusidestrconsts.lisconverttargetsamedfmfilehint msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" msgstr "" #: lazarusidestrconsts.lisconverttargetsupportdelphi msgid "Support Delphi" msgstr "" #: lazarusidestrconsts.lisconverttargetsupportdelphihint msgid "Use conditional compilation to support Delphi" msgstr "" #: lazarusidestrconsts.lisconvfixedunitname #, object-pascal-format msgid "Fixed unit name from %s to %s." msgstr "" #: lazarusidestrconsts.lisconvfuncreplacements msgid "Function Replacements" msgstr "" #: lazarusidestrconsts.lisconvfuncreplhint msgctxt "lazarusidestrconsts.lisconvfuncreplhint" msgid "Some Delphi functions can be replaced with LCL function" msgstr "" #: lazarusidestrconsts.lisconvfuncstoreplace msgid "Functions / procedures to replace" msgstr "" #: lazarusidestrconsts.lisconvleftoff msgid "Left offset" msgstr "" #: lazarusidestrconsts.lisconvnewname msgid "New Name" msgstr "" #: lazarusidestrconsts.lisconvparentcontainer msgid "Parent Container" msgstr "" #: lazarusidestrconsts.lisconvproblemsfindingallunits #, object-pascal-format msgid "Problems when trying to find all units from project file %s" msgstr "" #: lazarusidestrconsts.lisconvproblemsfixingincludefile #, object-pascal-format msgid "Problems when fixing include files in file %s" msgstr "" #: lazarusidestrconsts.lisconvproblemsrepairingformfile #, object-pascal-format msgid "Problems when repairing form file %s" msgstr "" #: lazarusidestrconsts.lisconvrepairingincludefiles msgid "Repairing include files : " msgstr "" #: lazarusidestrconsts.lisconvreplacedcall #, object-pascal-format msgid "Replaced call %s with %s" msgstr "" #: lazarusidestrconsts.lisconvreplfuncparameternum #, object-pascal-format msgid "Replacement function parameter number should be >= 1: %s" msgstr "" #: lazarusidestrconsts.lisconvshouldbefollowedbynumber #, object-pascal-format msgid "\"$\" should be followed by a number: %s" msgstr "" #: lazarusidestrconsts.lisconvstoppedbecausethereispackage msgid "Stopped because there already is a package with the same name" msgstr "" #: lazarusidestrconsts.lisconvthislogwassaved #, object-pascal-format msgid "This log was saved to %s" msgstr "" #: lazarusidestrconsts.lisconvtopoff msgid "Top offset" msgstr "" #: lazarusidestrconsts.lisconvtypereplacements msgid "Type Replacements" msgstr "" #: lazarusidestrconsts.lisconvtypereplhint msgid "Unknown types in form file (DFM/LFM)" msgstr "" #: lazarusidestrconsts.lisconvtypestoreplace msgid "Types to replace" msgstr "" #: lazarusidestrconsts.lisconvunitreplacements msgid "Unit Replacements" msgstr "" #: lazarusidestrconsts.lisconvunitreplhint msgid "Unit names in uses section of a source unit" msgstr "" #: lazarusidestrconsts.lisconvunitstoreplace msgid "Units to replace" msgstr "" #: lazarusidestrconsts.lisconvunknownprops msgid "Unknown properties" msgstr "" #: lazarusidestrconsts.lisconvuserselectedtoendconversion #, object-pascal-format msgid "User selected to end conversion with file %s" msgstr "" #: lazarusidestrconsts.liscoolbaraddconfigdelete msgid "Add/Config/Delete Toolbar(s)" msgstr "" #: lazarusidestrconsts.liscoolbaradddivider msgid "Add Divider" msgstr "" #: lazarusidestrconsts.liscoolbaraddselected msgid "Add selected item to toolbar" msgstr "" #: lazarusidestrconsts.liscoolbaravailablecommands msgid "Available commands" msgstr "" #: lazarusidestrconsts.liscoolbarborderstyle msgid "Toolbars border style" msgstr "" #: lazarusidestrconsts.liscoolbarborderstyleitem0 #, fuzzy msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0" msgid "None" msgstr "Cap" #: lazarusidestrconsts.liscoolbarborderstyleitem1 msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1" msgid "Single" msgstr "" #: lazarusidestrconsts.liscoolbarcodeexplorer #, fuzzy msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer" msgid "Code Explorer" msgstr "Explorador del codi" #: lazarusidestrconsts.liscoolbarcodetemplates #, fuzzy #| msgid "Code templates" msgctxt "lazarusidestrconsts.liscoolbarcodetemplates" msgid "Code Templates" msgstr "Plantilles del codi" #: lazarusidestrconsts.liscoolbarconfigure msgid "&Configure" msgstr "" #: lazarusidestrconsts.liscoolbardeletetoolbar msgid "Are you sure you want to delete the selected toolbar?" msgstr "" #: lazarusidestrconsts.liscoolbardeletewarning msgid "There must be at least one toolbar!" msgstr "" #: lazarusidestrconsts.liscoolbardesigner msgid "Designer" msgstr "" #: lazarusidestrconsts.liscoolbargeneralsettings msgid "General Coolbar Settings" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyle msgid "Toolbars grab style" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem0 msgid "Simple" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem1 msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1" msgid "Double" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem2 msgid "HorLines" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem3 msgid "VerLines" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem4 msgid "Gripper" msgstr "" #: lazarusidestrconsts.liscoolbargrabstyleitem5 msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5" msgid "Button" msgstr "" #: lazarusidestrconsts.liscoolbargrabwidth msgid "Grab width" msgstr "" #: lazarusidestrconsts.liscoolbaridemainmenu msgid "IDE Main Menu" msgstr "" #: lazarusidestrconsts.liscoolbarmessages #, fuzzy msgctxt "lazarusidestrconsts.liscoolbarmessages" msgid "Messages" msgstr "Missatges" #: lazarusidestrconsts.liscoolbarmoveselecteddown msgid "Move selected toolbar item down" msgstr "" #: lazarusidestrconsts.liscoolbarmoveselectedup msgid "Move selected toolbar item up" msgstr "" #: lazarusidestrconsts.liscoolbaroptions msgid "IDE CoolBar" msgstr "" #: lazarusidestrconsts.liscoolbarpackageeditor msgid "Package Editor" msgstr "" #: lazarusidestrconsts.liscoolbarpackageeditorfiles msgid "Package Editor Files" msgstr "" #: lazarusidestrconsts.liscoolbarremoveselected msgid "Remove selected item from toolbar" msgstr "" #: lazarusidestrconsts.liscoolbarrestoredefaults msgid "Restore defaults" msgstr "" #: lazarusidestrconsts.liscoolbarselecttoolbar msgid "Please select a toolbar first!" msgstr "" #: lazarusidestrconsts.liscoolbarsourceeditor #, fuzzy msgctxt "lazarusidestrconsts.liscoolbarsourceeditor" msgid "Source Editor" msgstr "Editor del codi font" #: lazarusidestrconsts.liscoolbarsourcetab msgid "Source Tab" msgstr "" #: lazarusidestrconsts.liscoolbartoolbarcommands msgid "Toolbar commands" msgstr "" #: lazarusidestrconsts.liscoolbarvisible msgid "Coolbar is &visible" msgstr "" #: lazarusidestrconsts.liscoolbarwidth msgid "Coolbar width" msgstr "" #: lazarusidestrconsts.liscopyallitemstoclipboard msgid "Copy All Items to Clipboard" msgstr "" #: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard msgid "Copy All/Original Messages to Clipboard" msgstr "" #: lazarusidestrconsts.liscopyallshownmessagestoclipboard msgid "Copy All Shown Messages to Clipboard" msgstr "" #: lazarusidestrconsts.liscopydescription msgid "Copy description to clipboard" msgstr "" #: lazarusidestrconsts.liscopyerror2 msgid "Copy error" msgstr "S'ha produït un error de còpia" #: lazarusidestrconsts.liscopyfilename #, object-pascal-format msgid "Copy Filename %s" msgstr "" #: lazarusidestrconsts.liscopyfilenametoclipboard msgid "Copy File Name to Clipboard" msgstr "" #: lazarusidestrconsts.liscopyfilesfailed msgid "Copying files failed." msgstr "" #: lazarusidestrconsts.liscopyidentifier #, object-pascal-format msgid "Copy \"%s\" to clipboard" msgstr "" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "Copiar una forma sencera no està implementat." #: lazarusidestrconsts.liscopyitemtoclipboard msgid "Copy Item to Clipboard" msgstr "" #: lazarusidestrconsts.liscopymovefiletodirectory msgid "Copy/Move File to Directory" msgstr "" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy Selected Items to Clipboard" msgstr "" #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy Selected Messages to Clipboard" msgstr "" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "Explora els missatges del FPC" #: lazarusidestrconsts.liscoscanformakemessages msgid "Scan for Make messages" msgstr "Explora els missatges de Make" #: lazarusidestrconsts.liscoskipcallingcompiler #, fuzzy #| msgid "Skip calling Compiler" msgid "Skip calling compiler" msgstr "No cridis el compilador" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena #, fuzzy #| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Avís: El fitxer de configuració addicional del compilador té el mateix nom que un dels fitxers normalitzats de configuració que utilitza el FreePascal. Això pot comportar que NOMÉS s'analitzi el fitxer addicional i es salti el normalitzat." #: lazarusidestrconsts.liscpopenpackage #, object-pascal-format msgid "Open Package %s" msgstr "Obre Paquet %s" #: lazarusidestrconsts.liscpopenunit #, object-pascal-format msgid "Open Unit %s" msgstr "Obre Unitat %s" #: lazarusidestrconsts.liscpu #, object-pascal-format msgid ", CPU: %s" msgstr "" #: lazarusidestrconsts.liscreateandedit msgid "Create and edit" msgstr "" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" msgstr "Creeu primer un projecte!" #: lazarusidestrconsts.liscreatedebugandreleasemodes msgid "Create Debug and Release modes" msgstr "" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" msgstr "" #: lazarusidestrconsts.liscreatefilter msgid "Create Filter" msgstr "" #: lazarusidestrconsts.liscreatefppkgconfig msgid "Restore Fppkg configuration" msgstr "" #: lazarusidestrconsts.liscreatefunction msgid "Create function" msgstr "" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" msgstr "" #: lazarusidestrconsts.liscreateit msgid "Create it" msgstr "" #: lazarusidestrconsts.liscreatelocalvariable #, object-pascal-format msgid "Create local variable \"%s\"" msgstr "" #: lazarusidestrconsts.liscreatenewaddition msgid "Create new addition" msgstr "" #: lazarusidestrconsts.liscreatenewpackage msgid "(Create new package)" msgstr "" #: lazarusidestrconsts.liscreatenewpackagecomponent msgid "Create new package component" msgstr "" #: lazarusidestrconsts.liscreateproject msgid "Create project" msgstr "" #: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile msgid "Create/update .po file when saving a lfm file" msgstr "" #: lazarusidestrconsts.liscreatingfileindexoffpcsources #, object-pascal-format msgid "Creating file index of FPC sources %s ..." msgstr "" #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" msgstr "Tria un directori" #: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "Valors del directori de les eines del codi" #: lazarusidestrconsts.lisctdefdefinetemplates msgid "Define templates" msgstr "Defineix plantilles" #: lazarusidestrconsts.lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts.lisctdefsopenpreview msgid "Open Preview" msgstr "Obre la vista prèvia" #: lazarusidestrconsts.lisctdefstools msgid "Tools" msgstr "Eines" #: lazarusidestrconsts.lisctdefvariable #, object-pascal-format msgid "Variable: %s" msgstr "Variable: %s" #: lazarusidestrconsts.lisctdefvariablename msgid "Variable Name" msgstr "Nom de la variable" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" msgstr "Plantilles" #: lazarusidestrconsts.lisctoupdateallmethodsignatures msgid "Update all method signatures" msgstr "" #: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures msgid "Update multiple procedure signatures" msgstr "" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" msgstr "Per favor sel·lecciona una macroinstrucció" #: lazarusidestrconsts.lisctselectcodemacro msgid "Select Code Macro" msgstr "Sel·lecciona Macroinstrucció de Codi" #: lazarusidestrconsts.liscurrentlclwidgetset #, object-pascal-format msgid "Current LCL widgetset: \"%s\"" msgstr "" #: lazarusidestrconsts.liscurrentstate msgid "Current state: " msgstr "" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Columna del cursor en l'editor actual" #: lazarusidestrconsts.liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "La línia del cursor en l'editor actual" #: lazarusidestrconsts.liscustomopthint msgid "These options are passed to the compiler after macros are replaced." msgstr "" #: lazarusidestrconsts.liscustomoptions msgid "custom options" msgstr "opcions personalitzades" #: lazarusidestrconsts.liscustomoptions2 msgid "Custom options" msgstr "Opcions personalitzades" #: lazarusidestrconsts.liscustomoptions3 msgid "Custom Options" msgstr "" #: lazarusidestrconsts.liscustomprogram msgid "Custom Program" msgstr "Programa personalitzat" #: lazarusidestrconsts.liscustomprogramprogramdescriptor msgid "A Custom Free Pascal program." msgstr "" #: lazarusidestrconsts.lisdatamodule msgid "Data Module" msgstr "" #: lazarusidestrconsts.lisdbgenbreakpointevaluation msgid "Breakpoint Evaluation" msgstr "" #: lazarusidestrconsts.lisdbgenbreakpointhit msgid "Breakpoint Hit" msgstr "" #: lazarusidestrconsts.lisdbgenbreakpointmessage msgid "Breakpoint Message" msgstr "" #: lazarusidestrconsts.lisdbgenbreakpointstackdump msgid "Breakpoint Stack Dump" msgstr "" #: lazarusidestrconsts.lisdbgendefaultcolor msgid "Default Color" msgstr "" #: lazarusidestrconsts.lisdbgenexceptionraised msgid "Exception Raised" msgstr "" #: lazarusidestrconsts.lisdbgenmoduleload msgid "Module Load" msgstr "" #: lazarusidestrconsts.lisdbgenmoduleunload msgid "Module Unload" msgstr "" #: lazarusidestrconsts.lisdbgenoutputdebugstring msgid "Output Debug String" msgstr "" #: lazarusidestrconsts.lisdbgenprocessexit msgid "Process Exit" msgstr "" #: lazarusidestrconsts.lisdbgenprocessstart msgid "Process Start" msgstr "" #: lazarusidestrconsts.lisdbgenthreadexit msgid "Thread Exit" msgstr "" #: lazarusidestrconsts.lisdbgenthreadstart msgid "Thread Start" msgstr "" #: lazarusidestrconsts.lisdbgenwindowsmessageposted msgid "Windows Message Posted" msgstr "" #: lazarusidestrconsts.lisdbgenwindowsmessagesent msgid "Windows Message Sent" msgstr "" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "No s'ha especificat cap depurador" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno #, object-pascal-format, fuzzy #| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu." msgstr "No s'hi ha especificat cap depurador.%sEstablir punts de parada no tindrà cap efecte fins que configures un depurador al dialeg d'opcións del depurador en el menú." #: lazarusidestrconsts.lisdebug #, fuzzy msgctxt "lazarusidestrconsts.lisdebug" msgid "Debug" msgstr "Depuració" #: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks msgid "Confirm to delete all Breakpoints" msgstr "" #: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile msgid "Confirm to delete Breakpoints in same file" msgstr "" #: lazarusidestrconsts.lisdebugdialogconfirmdelhistory msgid "Confirm to clear History" msgstr "" #: lazarusidestrconsts.lisdebugdialogconfirmdelwatches msgid "Confirm to delete all Watches" msgstr "" #: lazarusidestrconsts.lisdebugger msgctxt "lazarusidestrconsts.lisdebugger" msgid "Debugger" msgstr "" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate #, object-pascal-format, fuzzy, badformat #| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session." msgstr "S'ha produït un error del depurador%sAtenció!! el depurador a entrat en estat d'error%sDeseu el vostre treball ara mateix!!%sPremeu Atura i espereu el millor ..." #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" msgstr "Depurador invàlid" #: lazarusidestrconsts.lisdebugging #, object-pascal-format msgid "%s (debugging ...)" msgstr "%s (s'està depurant ...)" #: lazarusidestrconsts.lisdebughintautotypecastclass msgid "Automatic typecast for objects" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Trajectòria de cerca addicional" #: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls msgid "BETA: Allow function calls in watches (if supported by backend)" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm msgid "Automatically close the assembler window, after source not found" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass msgid "Automatically set \"use instance class type\" for new watches" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmbackend msgid "Debugger backend" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Punt de parada" #: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Neteja la bitacora al ejecutar" #: lazarusidestrconsts.lisdebugoptionsfrmdebugger msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" msgid "Debugger" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend msgid "Debugger Backend:" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings msgid "Debugger dialogs" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Opcions generals de depuració" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "Opcions específiques del depurador (Depen del tipus de depurador)" #: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront msgid "Always bring debug-windows (watches, locals) to front when adding items" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmeditclass msgid "Change type" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type." msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" msgid "Event Log" msgstr "Bitàcora d'events" #: lazarusidestrconsts.lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "Gestionat per" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "Gestionat pel Depurador" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "Gestionat pel Programa" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "Ignora aquestes excepcions" #: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto msgid "Limit line count to" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmname #, fuzzy msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" msgid "Name:" msgstr "Nom:" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmoutput msgid "Output" msgstr "Eixida" #: lazarusidestrconsts.lisdebugoptionsfrmprocess msgid "Process" msgstr "Procés" #: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun msgid "Reset Debugger after each run" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop msgid "Show message on stop with Error (Exit-code <> 0)" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmsignals msgid "Signals" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmthread msgid "Thread" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke #, object-pascal-format msgid "Unknown Debugger backend \"%s\"" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors msgid "Use event log colors" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger msgid "-- Use IDE default Debugger --" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger msgid "-- Use project Debugger --" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmwindows msgid "Windows" msgstr "" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" msgstr "No es pot carregar el fitxer" #: lazarusidestrconsts.lisdebugunabletoloadfile2 #, object-pascal-format, fuzzy, badformat #| msgid "Unable to load file %s%s%s." msgid "Unable to load file \"%s\"." msgstr "No es pot carregar el fitxer %s%s%s." #: lazarusidestrconsts.lisdefault msgctxt "lazarusidestrconsts.lisdefault" msgid "Default" msgstr "Predeterminat" #: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl msgid "Default class visibility section of new methods. For example code completion on OnShow:=" msgstr "" #: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse msgid "The default is ComboBox with \"True\" and \"False\" selections" msgstr "" #: lazarusidestrconsts.lisdefaultplaceholder msgid "(default)" msgstr "" #: lazarusidestrconsts.lisdefaultsectionofmethods msgid "Default section of methods" msgstr "" #: lazarusidestrconsts.lisdelayforcompletionbox msgid "Delay for completion box" msgstr "" #: lazarusidestrconsts.lisdelayforcompletionlonglinehint msgid "Delay for long line hints in completion box" msgstr "" #: lazarusidestrconsts.lisdelayforhints msgid "Delay for hints" msgstr "" #: lazarusidestrconsts.lisdelete2 msgid "Delete?" msgstr "" #: lazarusidestrconsts.lisdeleteaddition #, object-pascal-format msgid "Delete addition \"%s\"?" msgstr "" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" msgstr "" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Esborrar tots aquestos arxius?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "" #: lazarusidestrconsts.lisdeletemacro #, object-pascal-format msgid "Delete macro \"%s\"?" msgstr "" #: lazarusidestrconsts.lisdeletemode #, object-pascal-format msgid "Delete mode \"%s\"" msgstr "" #: lazarusidestrconsts.lisdeleteoldfile #, object-pascal-format, fuzzy, badformat #| msgid "Delete old file %s%s%s?" msgid "Delete old file \"%s\"?" msgstr "Voleu eliminar el fitxer antic %s%s%s?" #: lazarusidestrconsts.lisdeleteselectedmacro msgid "Delete selected macro?" msgstr "" #: lazarusidestrconsts.lisdeletethisaddition msgid "Delete this addition" msgstr "" #: lazarusidestrconsts.lisdeletevalue #, object-pascal-format msgid "Delete value \"%s\"?" msgstr "" #: lazarusidestrconsts.lisdeletevalue2 #, object-pascal-format msgid "Delete value %s" msgstr "" #: lazarusidestrconsts.lisdelimiterissemicolon msgid "Delimiter is semicolon." msgstr "" #: lazarusidestrconsts.lisdelphicompatibleresources msgid "Delphi compatible resources. Recommended." msgstr "" #: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project." msgstr "" #: lazarusidestrconsts.lisdesktops msgid "Desktops ..." msgstr "" #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" msgstr "Directori de destinació" #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" msgstr "" #: lazarusidestrconsts.lisdfileswererenamedtol #, object-pascal-format msgid "%d files were renamed to lowercase." msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "No distingeixis entre majúscules i minúscules" #: lazarusidestrconsts.lisdiffdlgfile1 msgid "File1" msgstr "" #: lazarusidestrconsts.lisdiffdlgfile2 msgid "File2" msgstr "" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "Ignora si s'han afegit o eliminat línies buides" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "Ignora les diferències al final de la línia (p.ex. #10 = #13#10)" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "Ignora la quantitat d'espais" #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "Ignora els espais (excepte #10, #13#10)" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "Ignora els espais al final de la línia" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "Ignora els espais al començament de la línia" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" msgstr "Selecció única" #: lazarusidestrconsts.lisdiffdlgopendiffineditor #, fuzzy #| msgid "Open Diff in editor" msgid "Open difference in editor" msgstr "Obre les diferències a l'editor" #: lazarusidestrconsts.lisdifferentunitfoundatnewposition #, object-pascal-format msgid "different unit %s found at new position \"%s\"" msgstr "" #: lazarusidestrconsts.lisdirectives msgid "Directives" msgstr "" #: lazarusidestrconsts.lisdirectivesfornewunit msgid "Directives for new unit" msgstr "" #: lazarusidestrconsts.lisdirectories msgid "Directories" msgstr "" #: lazarusidestrconsts.lisdirectory msgid "Directory: " msgstr "" #: lazarusidestrconsts.lisdirectorynotfound #, object-pascal-format msgid "Directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.lisdirectorynotfound2 #, object-pascal-format msgid "directory %s not found" msgstr "" #: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles msgid "Directory where the IDE puts the .po files" msgstr "" #: lazarusidestrconsts.lisdisablei18nforlfm msgid "Disable I18N for LFM" msgstr "" #: lazarusidestrconsts.lisdisableoptionxg msgid "Disable Option -Xg?" msgstr "" #: lazarusidestrconsts.lisdisableoptionxg2 msgid "Disable option -Xg" msgstr "" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" msgstr "Descarta els canvis" #: lazarusidestrconsts.lisdiscardchangesall msgid "Discard all changes" msgstr "" #: lazarusidestrconsts.lisdiscardchangesandopenproject msgid "Discard changes and open project" msgstr "" #: lazarusidestrconsts.lisdiscardchangesandquit msgid "Discard changes and quit" msgstr "" #: lazarusidestrconsts.lisdiscardchangescreatenewproject msgid "Discard changes, create new project" msgstr "" #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Feu un clic en els elements d'amunt per veure'n les diferencies" #: lazarusidestrconsts.lisdiskdifferrorreadingfile #, object-pascal-format msgid "Error reading file: %s" msgstr "S'ha produït un error mentre es llegia el fitxer: %s" #: lazarusidestrconsts.lisdiskdiffignorealldiskchanges msgid "Ignore all disk changes" msgstr "" #: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk msgid "Reload checked files from disk" msgstr "" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "Alguns fitxers han canviat al disc:" #: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges msgid "Some files have local changes. Either local or external changes will be overwritten." msgstr "" #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Distingeix entre lletres grans i petites p.ex. A i a" #: lazarusidestrconsts.lisdlgalloptions msgid "All options ..." msgstr "" #: lazarusidestrconsts.lisdlgchangeclass msgid "Change Class ..." msgstr "" #: lazarusidestrconsts.lisdlgdefines msgid "Defines ..." msgstr "" #: lazarusidestrconsts.lisdlgedit #, fuzzy #| msgid "Edit..." msgctxt "lazarusidestrconsts.lisdlgedit" msgid "Edit ..." msgstr "Edita" #: lazarusidestrconsts.lisdlgexport msgctxt "lazarusidestrconsts.lisdlgexport" msgid "Export ..." msgstr "" #: lazarusidestrconsts.lisdlgimport msgctxt "lazarusidestrconsts.lisdlgimport" msgid "Import ..." msgstr "" #: lazarusidestrconsts.lisdlgmore msgctxt "lazarusidestrconsts.lisdlgmore" msgid "More ..." msgstr "" #: lazarusidestrconsts.lisdlgopen msgctxt "lazarusidestrconsts.lisdlgopen" msgid "Open ..." msgstr "" #: lazarusidestrconsts.lisdoesnotexists #, object-pascal-format msgid "%s does not exist: %s" msgstr "" #: lazarusidestrconsts.lisdonotchange msgid "Do not change" msgstr "" #: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning msgid "Do not check if another IDE instance is already running." msgstr "" #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" msgstr "" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "Do not compile dependencies." msgstr "" #: lazarusidestrconsts.lisdonotshowsplashscreen #, fuzzy #| msgid "Do not show splash screen" msgid "Do not show splash screen." msgstr "No mostris la finestra de venvinguda" #: lazarusidestrconsts.lisdonotshowthisdialogforthisproject msgid "Do not show this dialog for this project" msgstr "" #: lazarusidestrconsts.lisdonotshowthismessageagain msgid "Do not show this message again" msgstr "" #: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured." msgstr "" #: lazarusidestrconsts.lisdonwloadonlinepackages #, object-pascal-format msgid "" "The following package(s) are not available locally: %s.\n" "In order to install it, you must download them first. Download now?" msgstr "" #: lazarusidestrconsts.lisdown msgctxt "lazarusidestrconsts.lisdown" msgid "Down" msgstr "Avall" #: lazarusidestrconsts.lisdowngrade msgid "Downgrade" msgstr "" #: lazarusidestrconsts.lisdowngradeconfiguration msgid "Downgrade configuration" msgstr "" #: lazarusidestrconsts.lisdownload msgid "Download" msgstr "" #: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject msgid "Do you still want to create the new project?" msgstr "" #: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject msgid "Do you still want to open another project?" msgstr "" #: lazarusidestrconsts.lisdoyoustillwanttoquit msgid "Do you still want to quit?" msgstr "" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" msgstr "" #: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing." msgstr "" #: lazarusidestrconsts.lisdropdowncount msgid "Drop Down Count" msgstr "" #: lazarusidestrconsts.lisdropdowncounthint msgid "Used for all ComboBoxes in IDE dialogs" msgstr "" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Copia els components seleccionats al porta-retalls" #: lazarusidestrconsts.lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Retalla els components seleccionats al porta-retalls" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" msgstr "Mou component u cap enrere" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" msgstr "Mou component u cap endavant" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" msgstr "Mou component al fons" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" msgstr "Mou component al front" #: lazarusidestrconsts.lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Enganxa els components seleccionats des del porta-retalls" #: lazarusidestrconsts.lisdsgselectparentcomponent msgid "Select parent component" msgstr "Selecciona el component pare" #: lazarusidestrconsts.lisdsgshownonvisualcomponents msgid "Show nonvisual components" msgstr "" #: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents msgid "Toggle showing nonvisual components" msgstr "" #: lazarusidestrconsts.lisduplicate msgid "Duplicate" msgstr "" #: lazarusidestrconsts.lisduplicateentry msgid "Duplicate entry" msgstr "" #: lazarusidestrconsts.lisduplicatefilename msgid "Duplicate File Name" msgstr "" #: lazarusidestrconsts.lisduplicatefoundofvalue #, object-pascal-format msgid "Duplicate found of value \"%s\"." msgstr "" #: lazarusidestrconsts.lisduplicatemodename #, object-pascal-format msgid "Mode \"%s\" is already present in the list." msgstr "" #: lazarusidestrconsts.lisduplicatename msgid "Duplicate Name" msgstr "" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe #, object-pascal-format msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" msgstr "" #: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "" #: lazarusidestrconsts.lisduplicatesearchpath msgid "Duplicate search path" msgstr "" #: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "" #: lazarusidestrconsts.lisduplicateunit msgid "Duplicate Unit" msgstr "" #: lazarusidestrconsts.lisduplicateunitin #, object-pascal-format msgid "Duplicate unit \"%s\" in \"%s\"" msgstr "" #: lazarusidestrconsts.lisdynpkgamounttoscrollin msgid "Amount to scroll in" msgstr "" #: lazarusidestrconsts.lisdynpkgamounttoscrollin2 msgid "Amount to scroll in (%)" msgstr "" #: lazarusidestrconsts.lisdynpkgamounttoscrollinmax msgid "Amount to scroll in (Max)" msgstr "" #: lazarusidestrconsts.lisdynpkgautoscrollondeletepa msgid "Auto Scroll on delete past left border" msgstr "" #: lazarusidestrconsts.lisdynpkgautoscrollontypepast msgid "Auto Scroll on type past right border" msgstr "" #: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw msgid "Trigger on min chars (% of width)" msgstr "" #: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis msgid "Trigger on min chars visible" msgstr "" #: lazarusidestrconsts.lisedit msgctxt "lazarusidestrconsts.lisedit" msgid "Edit" msgstr "Edita" #: lazarusidestrconsts.liseditadditionalhelpformessages msgid "Edit additional help for messages" msgstr "" #: lazarusidestrconsts.liseditbuildmodes msgid "Edit build modes" msgstr "" #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" msgstr "" #: lazarusidestrconsts.lisedithelp msgid "Edit help" msgstr "" #: lazarusidestrconsts.liseditkey msgid "Edit Key" msgstr "" #: lazarusidestrconsts.liseditorcolors msgid "Editor Colors" msgstr "" #: lazarusidestrconsts.liseditormacros msgctxt "lazarusidestrconsts.liseditormacros" msgid "Editor Macros" msgstr "" #: lazarusidestrconsts.liseditortoolbar msgid "Editor ToolBar" msgstr "" #: lazarusidestrconsts.liseditortoolbarsettings msgid "Editor Toolbar Settings" msgstr "" #: lazarusidestrconsts.liseditortoolbarvisible msgid "Editor Toolbar is &visible" msgstr "" #: lazarusidestrconsts.lisedoptsloadascheme msgid "Load a scheme" msgstr "" #: lazarusidestrconsts.lisedtdefcurrentproject msgid "Current Project" msgstr "Projecte actual" #: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Una eina vàlida necessita al menys, títol i nom de fitxer" #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" msgstr "Edita l'eina" #: lazarusidestrconsts.lisedtexttoolkey msgctxt "lazarusidestrconsts.lisedtexttoolkey" msgid "Key" msgstr "Tecla" #: lazarusidestrconsts.lisedtexttoolmacros msgctxt "lazarusidestrconsts.lisedtexttoolmacros" msgid "Macros" msgstr "Macroinstruccions" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" msgstr "Paràmetres:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Nom de programa:" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages #, fuzzy #| msgid "Scan output for Free Pascal Compiler messages" msgid "Scan output for FPC messages" msgstr "Explora a la sortida els missatges del compilador Free Pascal" #: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages #, fuzzy #| msgid "Scan output for make messages" msgid "Scan output for \"make\" messages" msgstr "Explora a la sortida els missatges de Make" #: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Es requereix títol i nom de fitxer" #: lazarusidestrconsts.lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Directori de treball:" #: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")" msgstr "" #: lazarusidestrconsts.lisemdall msgctxt "lazarusidestrconsts.lisemdall" msgid "All" msgstr "" #: lazarusidestrconsts.lisemdemptymethods msgctxt "lazarusidestrconsts.lisemdemptymethods" msgid "Empty Methods" msgstr "" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" msgstr "" #: lazarusidestrconsts.lisemdnoclass msgid "No class" msgstr "" #: lazarusidestrconsts.lisemdnoclassat #, object-pascal-format msgid "No class at %s(%s,%s)" msgstr "" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" msgstr "" #: lazarusidestrconsts.lisemdpublic msgid "Public" msgstr "" #: lazarusidestrconsts.lisemdpublished msgid "Published" msgstr "" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" msgstr "" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "" #: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause #, object-pascal-format msgid "Unable to show empty methods of the current class, because%s%s" msgstr "" #: lazarusidestrconsts.lisempty msgid "Empty" msgstr "" #: lazarusidestrconsts.lisemptydestinationforpublishing msgid "Destination directory for publishing is either a relative path or empty." msgstr "" #: lazarusidestrconsts.lisenabledonlyforpackages msgid "Enabled only for packages." msgstr "" #: lazarusidestrconsts.lisenableflaguseunitofunitinpackage #, object-pascal-format msgid ". Enable flag \"Use Unit\" of unit %s in package %s" msgstr "" #: lazarusidestrconsts.lisenablei18nforlfm msgid "Enable I18N for LFM" msgstr "" #: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport msgid "Enable internationalization and translation support" msgstr "" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" msgstr "Permet Macroinstruccions" #: lazarusidestrconsts.lisenableoptiondwarf2 msgid "Enable Dwarf 2 (-gw)" msgstr "" #: lazarusidestrconsts.lisenableoptiondwarf2sets msgid "Enable Dwarf 2 with sets" msgstr "" #: lazarusidestrconsts.lisenableoptiondwarf3 msgid "Enable Dwarf 3 (-gw3)" msgstr "" #: lazarusidestrconsts.lisenableoptionxg msgid "Enable Option -Xg?" msgstr "" #: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier" msgstr "" #: lazarusidestrconsts.lisencloseinifdef msgid "Enclose in $IFDEF" msgstr "" #: lazarusidestrconsts.lisencodingnumberoffilesfailed #, object-pascal-format msgid "Number of files failed to convert: %d" msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis #, object-pascal-format msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisenternewnameformacros #, object-pascal-format msgid "Enter new name for Macro \"%s\"" msgstr "" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" msgstr "" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "El nom del depurador no és vàlid" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg #, object-pascal-format msgid "The debugger file \"%s\" is not an executable." msgstr "El fitxer del depurador \"%s\" no és executable" #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg #, object-pascal-format msgid "Test directory \"%s\" not found." msgstr "No s'ha trobat el directori de les proves \"%s\"." #: lazarusidestrconsts.liserrinvalidoption #, object-pascal-format msgid "Invalid option at position %d: \"%s\"" msgstr "" #: lazarusidestrconsts.liserrnooptionallowed #, object-pascal-format msgid "Option at position %d does not allow an argument: %s" msgstr "L'opció en la posició %d no permet un argument: %s" #: lazarusidestrconsts.liserroptionneeded #, object-pascal-format msgid "Option at position %d needs an argument : %s" msgstr "" #: lazarusidestrconsts.liserror msgid "Error: " msgstr "S'ha produït un error: " #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" msgstr "S'ha produït un error mentre es creava el fitxer" #: lazarusidestrconsts.liserrordeletingfile msgid "Error deleting file" msgstr "S'ha produït un error mentre s'eliminava el fitxer" #: lazarusidestrconsts.liserrorin #, object-pascal-format msgid "Error in %s" msgstr "Hi ha un error a %s" #: lazarusidestrconsts.liserrorinthecompilerfilename msgid "Error in the compiler file name:" msgstr "" #: lazarusidestrconsts.liserrorinthecustomcompileroptionsother msgid "Error in the custom compiler options (Other):" msgstr "" #: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):" msgstr "" #: lazarusidestrconsts.liserrorinthedebuggerpathaddition msgid "Error in the \"Debugger path addition\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforincludefiles msgid "Error in the search path for \"Include files\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforlibraries msgid "Error in the search path for \"Libraries\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles msgid "Error in the search path for \"Object files\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforothersources msgid "Error in the search path for \"Other sources\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles msgid "Error in the search path for \"Other unit files\":" msgstr "" #: lazarusidestrconsts.liserrorintheunitoutputdirectory msgid "Error in the \"unit output directory\":" msgstr "" #: lazarusidestrconsts.liserrorinvalidbuildmode #, object-pascal-format msgid "Error: invalid build mode \"%s\"" msgstr "" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" msgstr "" #: lazarusidestrconsts.liserrorloadingfile2 #, object-pascal-format msgid "Error loading file \"%s\":" msgstr "" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" msgstr "S'ha produït un error mentre es movia el component" #: lazarusidestrconsts.liserrormovingcomponent2 #, object-pascal-format msgid "Error moving component %s:%s" msgstr "S'ha produït un error mentre es movia el component %s:%s" #: lazarusidestrconsts.liserrornamingcomponent msgid "Error naming component" msgstr "" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" msgstr "" #: lazarusidestrconsts.liserroropeningform msgid "Error opening form" msgstr "" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "" #: lazarusidestrconsts.liserrorreadingpackagelistfromfile #, object-pascal-format msgid "Error reading package list from file%s%s%s%s" msgstr "S'ha produït un error mentre es llegia la llista de paquets des del fitxer%s%s%s%s" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" msgstr "" #: lazarusidestrconsts.liserrorreadingxmlfile #, object-pascal-format msgid "Error reading xml file \"%s\"%s%s" msgstr "" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" msgstr "S'ha produït un error mentre es canviava el nom del fitxer" #: lazarusidestrconsts.liserrors msgctxt "lazarusidestrconsts.liserrors" msgid "Errors" msgstr "Errors" #: lazarusidestrconsts.liserrors2 #, object-pascal-format msgid ", Errors: %s" msgstr "" #: lazarusidestrconsts.liserrorsavingform msgid "Error saving form" msgstr "" #: lazarusidestrconsts.liserrorsettingthenameofacomponentto #, object-pascal-format msgid "Error setting the name of a component %s to %s" msgstr "" #: lazarusidestrconsts.liserrorwritingfile #, object-pascal-format msgid "Error writing file \"%s\"" msgstr "" #: lazarusidestrconsts.liserrorwritingpackagelisttofile #, object-pascal-format msgid "Error writing package list to file%s%s%s%s" msgstr "S'ha produït un error mentre s'escrivia la llista de paquets al fitxer%s%s%s%s" #: lazarusidestrconsts.liseverynthlinenumber msgid "Show every n-th line number" msgstr "" #: lazarusidestrconsts.lisexamplefile msgid "Example file:" msgstr "" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac #, object-pascal-format msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "" #: lazarusidestrconsts.lisexclude msgid "Exclude" msgstr "" #: lazarusidestrconsts.lisexcludedatruntime #, object-pascal-format msgid "%s excluded at run time" msgstr "" #: lazarusidestrconsts.lisexcludesforstars msgid "Excludes for * and ** in unit and include search paths" msgstr "" #: lazarusidestrconsts.lisexecutableisadirectory #, object-pascal-format msgid "executable \"%s\" is a directory" msgstr "" #: lazarusidestrconsts.lisexecutablelacksthepermissiontorun #, object-pascal-format msgid "executable \"%s\" lacks the permission to run" msgstr "" #: lazarusidestrconsts.lisexecuteafter msgid "Execute After" msgstr "" #: lazarusidestrconsts.lisexecutebefore msgid "Execute Before" msgstr "" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" msgstr "S'ha aturat l'execució" #: lazarusidestrconsts.lisexecutionstoppedexitcode #, object-pascal-format msgid "Execution stopped with exit-code %1:d ($%2:s)" msgstr "" #: lazarusidestrconsts.lisexit msgctxt "lazarusidestrconsts.lisexit" msgid "Exit" msgstr "Surt" #: lazarusidestrconsts.lisexitcode #, object-pascal-format msgid "Exit code %s" msgstr "" #: lazarusidestrconsts.lisexpand msgid "Expand" msgstr "" #: lazarusidestrconsts.lisexpandall msgid "Expand All [Ctrl+Plus]" msgstr "" #: lazarusidestrconsts.lisexpandall2 msgid "Expand All" msgstr "" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" msgstr "" #: lazarusidestrconsts.lisexpandallpackages msgid "Expand all packages" msgstr "" #: lazarusidestrconsts.lisexpandallunits msgid "Expand all units" msgstr "" #: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "Nom del fitxer estès de l'actual fitxer editor" #: lazarusidestrconsts.lisexport msgctxt "lazarusidestrconsts.lisexport" msgid "Export" msgstr "" #: lazarusidestrconsts.lisexportall msgid "Export all" msgstr "" #: lazarusidestrconsts.lisexportallitemstofile msgid "Export All Items to File" msgstr "" #: lazarusidestrconsts.lisexportenvironmentoptions msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" msgid "Export environment options" msgstr "" #: lazarusidestrconsts.lisexporthtml msgid "Export as HTML" msgstr "" #: lazarusidestrconsts.lisexportimport msgid "Export / Import" msgstr "" #: lazarusidestrconsts.lisexportpackagelistxml msgid "Export package list" msgstr "" #: lazarusidestrconsts.lisexportselected msgid "Export selected" msgstr "" #: lazarusidestrconsts.lisexportsub msgid "Export >>" msgstr "" #: lazarusidestrconsts.lisextract msgid "Extract" msgstr "Extrau" #: lazarusidestrconsts.lisextractprocedure #, fuzzy #| msgid "Extract procedure" msgctxt "lazarusidestrconsts.lisextractprocedure" msgid "Extract Procedure" msgstr "Extrau el procediment" #: lazarusidestrconsts.lisextraopts msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them." msgstr "" #: lazarusidestrconsts.lisextremelyverbose msgid "Extremely Verbose" msgstr "" #: lazarusidestrconsts.lisexttoolexternaltools #, fuzzy #| msgid "External tools" msgid "External Tools" msgstr "Ferramentes Externes" #: lazarusidestrconsts.lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "Número màxim d'eines accedides" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools #, object-pascal-format msgid "There is a maximum of %s tools." msgstr "Hi ha un màxim de %s eines." #: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources #, object-pascal-format msgid "Failed to add %d not unique resource(s)" msgstr "" #: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor #, object-pascal-format msgid "Failed to create Application Bundle for \"%s\"" msgstr "" #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" msgstr "" #: lazarusidestrconsts.lisfailedtoresolvemacros msgid "failed to resolve macros" msgstr "" #: lazarusidestrconsts.lisfailedtosavefile msgid "Failed to save file." msgstr "" #: lazarusidestrconsts.lisfatal msgctxt "lazarusidestrconsts.lisfatal" msgid "Fatal" msgstr "" #: lazarusidestrconsts.lisfile msgctxt "lazarusidestrconsts.lisfile" msgid "File" msgstr "Fitxer" #: lazarusidestrconsts.lisfile2 msgid "File: " msgstr "" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" msgstr "" #: lazarusidestrconsts.lisfilefilter msgid "File filter" msgstr "" #: lazarusidestrconsts.lisfilefilters msgid "File Filters" msgstr "" #: lazarusidestrconsts.lisfilefiltersaddrow msgid "Add Row" msgstr "" #: lazarusidestrconsts.lisfilefiltersdeleterow msgid "Delete Row" msgstr "" #: lazarusidestrconsts.lisfilefiltersinsertrow msgid "Insert Row" msgstr "" #: lazarusidestrconsts.lisfilefiltersmask msgid "File mask" msgstr "" #: lazarusidestrconsts.lisfilefilterssetdefaults msgid "Set defaults" msgstr "" #: lazarusidestrconsts.lisfilefilterstitle msgid "These are file filters that will appear in all File Open dialogs" msgstr "" #: lazarusidestrconsts.lisfilefound msgid "File found" msgstr "" #: lazarusidestrconsts.lisfilehaschangedsave #, object-pascal-format msgid "File \"%s\" has changed. Save?" msgstr "" #: lazarusidestrconsts.lisfilehasnoproject msgid "File has no project" msgstr "" #: lazarusidestrconsts.lisfileisdirectory msgid "File is directory" msgstr "" #: lazarusidestrconsts.lisfileisnotanexecutable msgid "File is not an executable" msgstr "" #: lazarusidestrconsts.lisfileisvirtual #, object-pascal-format, fuzzy, badformat #| msgid "File %s%s%s is virtual." msgid "File \"%s\" is virtual." msgstr "El fitxer %s%s%s és virtual." #: lazarusidestrconsts.lisfilenamestyle msgid "Filename Style" msgstr "" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "No s'ha trobat el fitxer" #: lazarusidestrconsts.lisfilenotfound3 #, object-pascal-format msgid "file %s not found" msgstr "" #: lazarusidestrconsts.lisfilenotfound4 msgid "file not found" msgstr "" #: lazarusidestrconsts.lisfilenotfound5 #, object-pascal-format msgid "File not found:%s%s" msgstr "" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit #, object-pascal-format, fuzzy, badformat #| msgid "File %s%s%s not found.%sDo you want to create it?%s" msgid "File \"%s\" not found.%sDo you want to create it?" msgstr "No s'ha trobat el fitxer %s%s%s.%sEl voleu crear?%s" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" msgstr "El fitxer no és en minúscules" #: lazarusidestrconsts.lisfilescountconvertedtotextformat #, object-pascal-format msgid "%d files were converted to text format." msgstr "" #: lazarusidestrconsts.lisfilesettings msgid "File Settings" msgstr "" #: lazarusidestrconsts.lisfileshasincorrectsyntax #, object-pascal-format msgid "File %s has incorrect syntax." msgstr "" #: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection #, object-pascal-format msgid "Files: %s, has Register procedure: %s, in package uses section: %s" msgstr "" #: lazarusidestrconsts.lisfileshaverightencoding msgid "*** All found files already have the right encoding ***" msgstr "" #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilesisconvertedtotextformat #, object-pascal-format msgid "File %s was converted to text format." msgstr "" #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "File where debug output is written to. Default is write to the console." msgstr "" #: lazarusidestrconsts.lisfilter msgid "Filter" msgstr "" #: lazarusidestrconsts.lisfilter3 #, object-pascal-format msgid "Filter: %s" msgstr "" #: lazarusidestrconsts.lisfilterallmessagesofcertaintype msgid "Filter all messages of certain type" msgstr "" #: lazarusidestrconsts.lisfilterallmessagesoftype #, object-pascal-format msgid "Filter all messages of type %s" msgstr "" #: lazarusidestrconsts.lisfilteralreadyexists msgid "Filter already exists" msgstr "" #: lazarusidestrconsts.lisfilterdebugmessagesandbelow msgid "Filter Debug Messages and below" msgstr "" #: lazarusidestrconsts.lisfilterhintsandbelow msgid "Filter Hints and below" msgstr "" #: lazarusidestrconsts.lisfilterhintswithoutsourceposition msgid "Filter Hints without Source Position" msgstr "" #: lazarusidestrconsts.lisfilternonedonotfilterbyurgency msgid "Filter None, do not filter by urgency" msgstr "" #: lazarusidestrconsts.lisfilternonurgentmessages msgid "Filter non urgent Messages" msgstr "" #: lazarusidestrconsts.lisfilternotesandbelow msgid "Filter Notes and below" msgstr "" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" msgstr "" #: lazarusidestrconsts.lisfiltertheavailableoptionslist msgid "Filter the available options list" msgstr "" #: lazarusidestrconsts.lisfilterverbosemessagesandbelow msgid "Filter Verbose Messages and below" msgstr "" #: lazarusidestrconsts.lisfilterwarningsandbelow msgid "Filter Warnings and below" msgstr "" #: lazarusidestrconsts.lisfind msgid "Find ..." msgstr "" #: lazarusidestrconsts.lisfinddeclarationof #, object-pascal-format msgid "Find Declaration of %s" msgstr "" #: lazarusidestrconsts.lisfindfiledirectories msgid "D&irectories" msgstr "" #: lazarusidestrconsts.lisfindfilefilemask msgid "Fi&le mask" msgstr "" #: lazarusidestrconsts.lisfindfileincludesubdirectories #, fuzzy #| msgid "Include sub directories" msgid "Include &sub directories" msgstr "Inclou els subdirectoris" #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "" #: lazarusidestrconsts.lisfindfilereplacementisnotpossible msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:" msgstr "" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "all files in &project" msgstr "" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "all &open files" msgstr "" #: lazarusidestrconsts.lisfindfilesearchinactivefile msgid "&active file" msgstr "" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "&directories" msgstr "" #: lazarusidestrconsts.lisfindfilessearchinprojectgroup msgid "project &group" msgstr "" #: lazarusidestrconsts.lisfindfilewhere #, fuzzy #| msgid "Where" msgid "Search location" msgstr "On" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" msgstr "" #: lazarusidestrconsts.lisfindmissingunit msgid "Find missing unit" msgstr "" #: lazarusidestrconsts.lisfindoption msgid "Find option" msgstr "" #: lazarusidestrconsts.lisfirst msgid "First" msgstr "" #: lazarusidestrconsts.lisfirsttest msgid "&First test" msgstr "" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" msgstr "Fixa el fitxer LFM" #: lazarusidestrconsts.lisfocushint msgid "Focus hint" msgstr "" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" msgstr "" #: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units" msgstr "" #: lazarusidestrconsts.lisform msgid "Form" msgstr "" #: lazarusidestrconsts.lisformacosdarwin msgid "For macOS (Darwin)" msgstr "" #: lazarusidestrconsts.lisformaterror msgid "Format error" msgstr "S'ha produït un error de format" #: lazarusidestrconsts.lisforwindows msgid "For Windows" msgstr "" #: lazarusidestrconsts.lisfoundversionexpected #, object-pascal-format msgid "Found version %s, expected %s" msgstr "" #: lazarusidestrconsts.lisfpcfullversioneg20701 msgid "FPC version as one number (e.g. 20701)" msgstr "" #: lazarusidestrconsts.lisfpcmessagefile2 msgid "FPC message file:" msgstr "" #: lazarusidestrconsts.lisfpcmessagesappendix msgid "FPC messages: Appendix" msgstr "" #: lazarusidestrconsts.lisfpcresources msgid "FPC resources (.res)" msgstr "" #: lazarusidestrconsts.lisfpcsources msgid "FPC sources" msgstr "" #: lazarusidestrconsts.lisfpctooold msgid "FPC too old" msgstr "" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " msgstr "" #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lisfpdocerrorwriting #, object-pascal-format msgid "Error writing \"%s\"%s%s" msgstr "" #: lazarusidestrconsts.lisfpdocfpdocsyntaxerror msgid "FPDoc syntax error" msgstr "" #: lazarusidestrconsts.lisfpdocpackagename msgid "FPDoc package name:" msgstr "" #: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename msgid "FPDoc package name. Default is project file name." msgstr "" #: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement #, object-pascal-format msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" msgstr "" #: lazarusidestrconsts.lisfppkgcompilerproblem msgid "there is a problem with the Free Pascal compiler executable, " msgstr "" #: lazarusidestrconsts.lisfppkgconfgenproblems msgid "Warnings have to be resolved first" msgstr "" #: lazarusidestrconsts.lisfppkgconfiguration msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default." msgstr "" #: lazarusidestrconsts.lisfppkgconfigurationfilenotfound #, object-pascal-format msgid "Fppkg configuration file not found:%s%s" msgstr "" #: lazarusidestrconsts.lisfppkgcreatefilefailed #, object-pascal-format msgid "Failed to generate the configuration file \"%s\": %s" msgstr "" #: lazarusidestrconsts.lisfppkgfilestobewritten msgid "Files to be written:" msgstr "" #: lazarusidestrconsts.lisfppkgfixconfiguration msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually." msgstr "" #: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed msgid "Failed to retrieve the version of the fpcmkcfg configuration tool." msgstr "" #: lazarusidestrconsts.lisfppkgfpcmkcfgmissing msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files." msgstr "" #: lazarusidestrconsts.lisfppkgfpcmkcfgneeded msgid "An up-to-date version is needed to create the configuration files." msgstr "" #: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold" msgid "It is probably too old to create the configuration files." msgstr "" #: lazarusidestrconsts.lisfppkgfpcmkcfgtooold #, object-pascal-format msgid "The fpcmkcfg configuration tool it too old [%s]." msgstr "" #: lazarusidestrconsts.lisfppkginstallationpath #, object-pascal-format msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\"" msgstr "" #: lazarusidestrconsts.lisfppkglibprefix #, object-pascal-format msgid "Fpc library prefix: %s" msgstr "" #: lazarusidestrconsts.lisfppkgprefix #, object-pascal-format msgid "Fpc prefix: %s" msgstr "" #: lazarusidestrconsts.lisfppkgproblem msgid "Problem with Fppkg configuration" msgstr "" #: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable." msgstr "" #: lazarusidestrconsts.lisfppkgwriteconfexception #, object-pascal-format msgid "A problem occurred while trying to create a new Fppkg configuration: %s" msgstr "" #: lazarusidestrconsts.lisfppkgwriteconffailed #, object-pascal-format msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal." msgstr "" #: lazarusidestrconsts.lisfppkgwriteconfigfile msgid "Write new configuration files" msgstr "" #: lazarusidestrconsts.lisframe msgid "Frame" msgstr "" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" msgstr "" #: lazarusidestrconsts.lisfreeingbufferlines #, object-pascal-format msgid "freeing buffer lines: %s" msgstr "" #: lazarusidestrconsts.lisfreepascalcompilermessages msgid "Free Pascal Compiler messages" msgstr "" #: lazarusidestrconsts.lisfreepascalprefix msgid "Free Pascal compiler prefix" msgstr "" #: lazarusidestrconsts.lisfreepascalsourcedirectory #, fuzzy #| msgid "Freepascal source directory" msgid "Free Pascal source directory" msgstr "Directori del codi font del FreePascal" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" msgstr "" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Fitxers addicionals a cercar (p.e. /trajectòria/*.pas;/trajec2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "Cerca o reanomena l'identificador" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" msgstr "Cerca les referències" #: lazarusidestrconsts.lisfriidentifier #, object-pascal-format msgid "Identifier: %s" msgstr "Identificador: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "en tots els projectes i paquets oberts" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" msgstr "en la unitat actual" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" msgstr "en el projecte principal" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "en el projecte/paquet que es propietari de la unitat actual" #: lazarusidestrconsts.lisfriinvalididentifier msgid "Invalid Identifier" msgstr "L'identificador no és vàlid" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" msgstr "Canvia el nom de totes les referències" #: lazarusidestrconsts.lisfrirenaming msgid "Renaming" msgstr "" #: lazarusidestrconsts.lisfrisearch msgid "Search" msgstr "" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Cerca també en els comentaris" #: lazarusidestrconsts.lisfull msgid "Full" msgstr "" #: lazarusidestrconsts.lisfunction msgid "Function" msgstr "" #: lazarusidestrconsts.lisgeneral msgctxt "lazarusidestrconsts.lisgeneral" msgid "General" msgstr "General" #: lazarusidestrconsts.lisgeneratefppkgcfg #, object-pascal-format msgid "Fppkg configuration: %s" msgstr "" #: lazarusidestrconsts.lisgeneratefppkgcompcfg #, object-pascal-format msgid "Fppkg compiler configuration: %s" msgstr "" #: lazarusidestrconsts.lisgeneratefppkgconfiguration msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool." msgstr "" #: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption msgid "Generate new Fppkg configuration files" msgstr "" #: lazarusidestrconsts.lisgetbuildmodes msgid "Print a list of build modes in the project. Active mode is listed first." msgstr "" #: lazarusidestrconsts.lisgetexpandtext msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode." msgstr "" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition msgid "get word at current cursor position" msgstr "" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition2 msgid "Get word at current cursor position." msgstr "" #: lazarusidestrconsts.lisglobalsettings msgid "Global settings" msgstr "" #: lazarusidestrconsts.lisgotoline msgid "Goto Line" msgstr "" #: lazarusidestrconsts.lisgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" "\n" "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" "\n" "A copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" #: lazarusidestrconsts.lisgroup msgid "Group" msgstr "" #: lazarusidestrconsts.lisgrouplocalvariables msgid "Group automatically defined local variables" msgstr "" #: lazarusidestrconsts.lisgroupsfordebugoutput msgid "Enable or disable groups of debug output. Valid options are:" msgstr "" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" msgstr "" #: lazarusidestrconsts.lisgutterpartmargin msgid "Margin" msgstr "" #: lazarusidestrconsts.lisgutterpartvisible msgid "Visible" msgstr "" #: lazarusidestrconsts.lisgutterpartwidth msgid "Width" msgstr "" #: lazarusidestrconsts.lishashelp msgid "Has Help" msgstr "" #: lazarusidestrconsts.lisheadercolors msgid "Header colors" msgstr "" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" msgstr "Comentari de capçalera per a la classe" #: lazarusidestrconsts.lishelpentries msgid "Help entries" msgstr "" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" msgstr "" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage msgid "Help for Free Pascal Compiler message" msgstr "" #: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh msgid "Hide all hints and warnings by inserting IDE directives {%H-}" msgstr "" #: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh msgid "Hide message at %s by inserting IDE directive {%H-}" msgstr "" #: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh msgid "Hide message by inserting IDE directive {%H-}" msgstr "" #: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit #, object-pascal-format msgid "Hide message by inserting {$warn %s off} to unit \"%s\"" msgstr "" #: lazarusidestrconsts.lishidesearch msgid "Hide Search" msgstr "" #: lazarusidestrconsts.lishidewindow msgctxt "lazarusidestrconsts.lishidewindow" msgid "Hide window" msgstr "" #: lazarusidestrconsts.lishidewithpackageoptionvm #, object-pascal-format msgid "Hide with package option (-vm%s)" msgstr "" #: lazarusidestrconsts.lishidewithprojectoptionvm #, object-pascal-format msgid "Hide with project option (-vm%s)" msgstr "" #: lazarusidestrconsts.lishint msgctxt "lazarusidestrconsts.lishint" msgid "Hint" msgstr "" #: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals msgid "Hint: A default value can be defined in the conditionals." msgstr "" #: lazarusidestrconsts.lishintatpropertysnameshowsdescription msgid "A hint at property's name shows its description." msgstr "" #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "" #: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from." msgstr "" #: lazarusidestrconsts.lishints #, object-pascal-format msgid ", Hints: %s" msgstr "" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon #, object-pascal-format msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "Suggeriment: La funció de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu l'expressió i torneu-ho a provar." #: lazarusidestrconsts.lishintviewforms msgid "View Forms" msgstr "Mostra les formes" #: lazarusidestrconsts.lishintviewunits msgid "View Units" msgstr "Mostra les unitats" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" msgstr "Base de dades" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" msgstr "Opcions de l'ajuda" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" msgstr "Propietats:" #: lazarusidestrconsts.lishlpoptsviewers msgid "Viewers" msgstr "Visualitzadors" #: lazarusidestrconsts.lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" msgstr "Horitzontal" #: lazarusidestrconsts.lishorizontallinesbetweenproperties msgid "Horizontal lines between properties." msgstr "" #: lazarusidestrconsts.lisid msgctxt "lazarusidestrconsts.lisid" msgid "ID" msgstr "ID" #: lazarusidestrconsts.lisidcaddition msgid "Addition" msgstr "" #: lazarusidestrconsts.lisidcopening msgid "Opening" msgstr "" #: lazarusidestrconsts.liside msgid "IDE" msgstr "" #: lazarusidestrconsts.lisidebuildoptions msgid "IDE build options" msgstr "" #: lazarusidestrconsts.lisidecaptioncustomhint msgid "Additional info to display in the IDE title" msgstr "" #: lazarusidestrconsts.lisidecompileandrestart msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages." msgstr "" #: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus #, object-pascal-format msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s" msgstr "" #: lazarusidestrconsts.lisideinfoinformationabouttheide msgid "Information about the IDE" msgstr "" #: lazarusidestrconsts.lisidemacros msgid "IDE Macros" msgstr "" #: lazarusidestrconsts.lisidemaintainsscaledinmainunit msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit." msgstr "" #: lazarusidestrconsts.lisidemaintainsthetitleinmainunit msgid "The IDE maintains the title in main unit." msgstr "" #: lazarusidestrconsts.lisidentifier msgid "identifier" msgstr "" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "" #: lazarusidestrconsts.lisidentifiercontains msgid "Identifier contains ..." msgstr "" #: lazarusidestrconsts.lisideoptions msgid "IDE Options:" msgstr "Opcions IDE:" #: lazarusidestrconsts.lisidetitlecustom msgid "Custom IDE title" msgstr "" #: lazarusidestrconsts.lisidetitleoptions msgid "IDE main window and taskbar title" msgstr "" #: lazarusidestrconsts.lisidetitlestartswithprojectname msgid "Show custom IDE title before built-in IDE title or info" msgstr "" #: lazarusidestrconsts.lisiecoallbuildmodes msgid "All build modes" msgstr "" #: lazarusidestrconsts.lisiecocompileroptionsof msgid "Compiler options of" msgstr "" #: lazarusidestrconsts.lisiecocurrentbuildmode msgid "Current build mode" msgstr "" #: lazarusidestrconsts.lisiecoerroropeningxml msgid "Error opening XML" msgstr "" #: lazarusidestrconsts.lisiecoerroropeningxmlfile #, object-pascal-format msgid "Error opening XML file \"%s\":%s%s" msgstr "" #: lazarusidestrconsts.lisiecoexportcompileroptions msgid "Export Compiler Options" msgstr "" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti #, object-pascal-format msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts.lisiecoimportcompileroptions msgid "Import Compiler Options" msgstr "" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" msgstr "Carrega des de l'arxiu" #: lazarusidestrconsts.lisieconocompileroptionsinfile #, object-pascal-format msgid "File \"%s\" does not contain compiler options." msgstr "" #: lazarusidestrconsts.lisiecosavetofile msgid "Save to file" msgstr "Desa a l'arxiu" #: lazarusidestrconsts.lisifnotchecked msgid "If not checked:" msgstr "" #: lazarusidestrconsts.lisifonlysessioninfochangedthenask msgid "If only the session info changed, ask about saving it." msgstr "" #: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst #, object-pascal-format msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" msgstr "" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" msgstr "" #: lazarusidestrconsts.lisignoreuseasancestor #, object-pascal-format msgid "Ignore, use %s as ancestor" msgstr "" #: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage msgid "Imitate indentation of current unit, project or package" msgstr "" #: lazarusidestrconsts.lisimplementationcommentforclass msgid "Implementation comment for class" msgstr "" #: lazarusidestrconsts.lisimport msgctxt "lazarusidestrconsts.lisimport" msgid "Import" msgstr "" #: lazarusidestrconsts.lisimportant msgctxt "lazarusidestrconsts.lisimportant" msgid "Important" msgstr "" #: lazarusidestrconsts.lisimportenvironmentoptions msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" msgid "Import environment options" msgstr "" #: lazarusidestrconsts.lisimportfromfile msgid "Import from File" msgstr "" #: lazarusidestrconsts.lisimportingbuildmodesnotsupported msgid "Importing BuildModes is not supported for packages." msgstr "" #: lazarusidestrconsts.lisimportpackagelistxml msgid "Import package list" msgstr "" #: lazarusidestrconsts.lisimpossible msgid "Impossible" msgstr "" #: lazarusidestrconsts.lisinasourcedirectoryofthepackage #, object-pascal-format msgid "In a source directory of the package \"%s\"." msgstr "" #: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates msgid "In a source directory of the project. Check for duplicates." msgstr "" #: lazarusidestrconsts.lisincludepath msgid "include path" msgstr "trajectòria dels fitxers inclosos" #: lazarusidestrconsts.lisincludepaths msgid "Include paths" msgstr "" #: lazarusidestrconsts.lisincluderecursive msgid "Include, recursive" msgstr "" #: lazarusidestrconsts.lisincompatibleppu #, object-pascal-format msgid ", incompatible ppu=%s" msgstr "" #: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound msgid "Incorrect configuration directory found" msgstr "" #: lazarusidestrconsts.lisincorrectfppkgconfiguration #, object-pascal-format msgid "there is a problem with the Fppkg configuration. (%s)" msgstr "" #: lazarusidestrconsts.lisindentationforpascalsources msgid "Indentation for Pascal sources" msgstr "" #: lazarusidestrconsts.lisinformation msgid "Information" msgstr "" #: lazarusidestrconsts.lisinformationaboutunit #, object-pascal-format msgid "Information about %s" msgstr "Informació de %s" #: lazarusidestrconsts.lisinformationaboutusedfpc msgid "Information about used FPC" msgstr "" #: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." msgstr "" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" msgstr "" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" msgstr "" #: lazarusidestrconsts.lisinheritedparameters msgid "Inherited parameters" msgstr "" #: lazarusidestrconsts.lisinheritedprojectcomponent msgid "Inherited project component" msgstr "" #: lazarusidestrconsts.lisinitialchecks msgid "Initial Checks" msgstr "" #: lazarusidestrconsts.lisinitializelocalvariable msgid "Initialize Local Variable" msgstr "" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil #, object-pascal-format msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" msgstr "" #: lazarusidestrconsts.lisinsert msgctxt "lazarusidestrconsts.lisinsert" msgid "Insert" msgstr "Insereix" #: lazarusidestrconsts.lisinsertassignment #, object-pascal-format msgid "Insert Assignment %s := ..." msgstr "" #: lazarusidestrconsts.lisinsertdate msgid "insert date" msgstr "" #: lazarusidestrconsts.lisinsertdateandtime msgid "insert date and time" msgstr "" #: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring msgid "Insert date and time. Optional: format string." msgstr "" #: lazarusidestrconsts.lisinsertdateoptionalformatstring msgid "Insert date. Optional: format string." msgstr "" #: lazarusidestrconsts.lisinsertendifneeded msgid "insert end if needed" msgstr "" #: lazarusidestrconsts.lisinsertheaderofcurrentprocedure msgid "" "Insert header of current procedure.\n" "\n" "Optional Parameters (comma separated):\n" "WithStart, // proc keyword e.g. 'function', 'class procedure'\n" "WithoutClassKeyword,// without 'class' proc keyword\n" "AddClassName, // extract/add ClassName.\n" "WithoutClassName, // skip classname\n" "WithoutName, // skip function name\n" "WithoutParamList, // skip param list\n" "WithVarModifiers, // extract 'var', 'out', 'const'\n" "WithParameterNames, // extract parameter names\n" "WithoutParamTypes, // skip colon, param types and default values\n" "WithDefaultValues, // extract default values\n" "WithResultType, // extract colon + result type\n" "WithOfObject, // extract 'of object'\n" "WithCallingSpecs, // extract cdecl; inline;\n" "WithProcModifiers, // extract forward; alias; external;\n" "WithComments, // extract comments and spaces\n" "InUpperCase, // turn to uppercase\n" "CommentsToSpace, // replace comments with a single space\n" " // (default is to skip unnecessary space,\n" " // e.g 'Do ;' normally becomes 'Do;'\n" " // with this option you get 'Do ;')\n" "WithoutBrackets, // skip start- and end-bracket of parameter list\n" "WithoutSemicolon, // skip semicolon at end\n" msgstr "" #: lazarusidestrconsts.lisinsertmacro msgctxt "lazarusidestrconsts.lisinsertmacro" msgid "Insert Macro" msgstr "Insereix Macroinstrucció" #: lazarusidestrconsts.lisinsertnameofcurrentprocedure msgid "Insert name of current procedure." msgstr "" #: lazarusidestrconsts.lisinsertprintshorttag2 msgid "Insert printshort tag" msgstr "" #: lazarusidestrconsts.lisinsertprocedurehead msgid "insert procedure head" msgstr "" #: lazarusidestrconsts.lisinsertprocedurename msgid "insert procedure name" msgstr "" #: lazarusidestrconsts.lisinsertsemicolonifneeded msgid "Insert semicolon if needed" msgstr "" #: lazarusidestrconsts.lisinserttime msgid "insert time" msgstr "" #: lazarusidestrconsts.lisinserttimeoptionalformatstring msgid "Insert time. Optional: format string." msgstr "" #: lazarusidestrconsts.lisinserturltag msgid "Insert url tag" msgstr "" #: lazarusidestrconsts.lisinsession msgid "In session" msgstr "" #: lazarusidestrconsts.lisinstalled msgid "installed" msgstr "" #: lazarusidestrconsts.lisinstallitilikethefat msgid "Install it, I like the fat" msgstr "" #: lazarusidestrconsts.lisinstallpackagesmsg #, object-pascal-format msgid "" "The following packages are not installed, but available in the main repository: %s.\n" "Do you wish to install missing packages?" msgstr "" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" msgstr "Instal·la la selecció" #: lazarusidestrconsts.lisinstalluninstallpackages msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" msgid "Install/Uninstall Packages" msgstr "" #: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile msgid "Instead of compiling a package create a simple Makefile." msgstr "" #: lazarusidestrconsts.lisinsufficientencoding msgid "Insufficient encoding" msgstr "" #: lazarusidestrconsts.lisinteractive msgid "Interactive" msgstr "" #: lazarusidestrconsts.lisinternalerror #, object-pascal-format msgid "internal error: %s" msgstr "" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" msgstr "L'eliminació no és vàlida" #: lazarusidestrconsts.lisinvalidexecutable msgid "Invalid Executable" msgstr "" #: lazarusidestrconsts.lisinvalidexecutablemessagetext #, object-pascal-format msgid "The file \"%s\" is not executable." msgstr "" #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction #, object-pascal-format msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "L'expressió no és vàlida.%sSuggeriment: La funció de la cadena del recurs espera una constant de cadena en un sol fitxer. Si us plau, seleccioneu l'expressió i torneu-ho a provar." #: lazarusidestrconsts.lisinvalidfilename msgid "Invalid file name" msgstr "" #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" msgstr "" #: lazarusidestrconsts.lisinvalidlinecolumninmessage #, object-pascal-format msgid "Invalid line, column in message%s%s" msgstr "" #: lazarusidestrconsts.lisinvalidmacrosin #, object-pascal-format msgid "Invalid macros in \"%s\"" msgstr "" #: lazarusidestrconsts.lisinvalidmacrosinexternaltool #, object-pascal-format msgid "Invalid macros \"%s\" in external tool \"%s\"" msgstr "" #: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie #, object-pascal-format msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." msgstr "" #: lazarusidestrconsts.lisinvalidmacrothenameisakeyword #, object-pascal-format msgid "Invalid macro name \"%s\". The name is a keyword." msgstr "" #: lazarusidestrconsts.lisinvalidmask msgid "Invalid Mask" msgstr "" #: lazarusidestrconsts.lisinvalidmode #, object-pascal-format msgid "Invalid mode %s" msgstr "" #: lazarusidestrconsts.lisinvalidmultiselection msgid "Invalid multiselection" msgstr "La multiselecció no és vàlida" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "L'identificador de Pascal no és vàlid" #: lazarusidestrconsts.lisinvalidpascalidentifiername #, object-pascal-format msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?" msgstr "" #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" msgstr "El nom del procediment no és vàlid" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" msgstr "El nom del fitxer del projecte no és vàlid" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" msgstr "La selecció no és vàlida" #: lazarusidestrconsts.lisinvalidversionin #, object-pascal-format msgid "invalid version in %s" msgstr "" #: lazarusidestrconsts.lisisalreadypartoftheproject #, object-pascal-format msgid "%s is already part of the Project." msgstr "%s ja forma part del Projecte." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject #, object-pascal-format, fuzzy, badformat #| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s no és un nom de projecte vàlid. %s Si us plau, escolliu-ne un altre (p.e. project1.lpi)" #: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed #, object-pascal-format msgid "%s is a %s.%sThis circular dependency is not allowed." msgstr "" #: lazarusidestrconsts.lisisddirectorynotfound msgid "directory not found" msgstr "" #: lazarusidestrconsts.lisissues msgid "Issues" msgstr "" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe #, object-pascal-format msgid "I wonder how you did that. Error in the %s:" msgstr "" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory msgid "I wonder how you did that: Error in the base directory:" msgstr "" #: lazarusidestrconsts.lisjhjumphistory #, fuzzy #| msgid "Jump History ..." msgctxt "lazarusidestrconsts.lisjhjumphistory" msgid "Jump History" msgstr "Mostra la història dels salts ..." #: lazarusidestrconsts.lisjumptoerror msgid "Jump to error" msgstr "" #: lazarusidestrconsts.lisjumptoerroratidentifiercompletion msgid "When an error in the sources is found at identifier completion, jump to it." msgstr "" #: lazarusidestrconsts.lisjumptoprocedure #, object-pascal-format msgid "Jump to procedure %s" msgstr "" #: lazarusidestrconsts.liskb #, object-pascal-format msgid "%s KB" msgstr "" #: lazarusidestrconsts.liskeep2 msgid "Keep" msgstr "" #: lazarusidestrconsts.liskeepfileopen msgid "Keep converted files open in editor" msgstr "" #: lazarusidestrconsts.liskeepfileopenhint msgid "All project files will be open in editor after conversion" msgstr "" #: lazarusidestrconsts.liskeepname msgid "Keep name" msgstr "Manté el nom" #: lazarusidestrconsts.liskeepopen msgid "Keep open" msgstr "" #: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate msgid "Keep absolute indentation, regardless of the current cursor indentation in the text." msgstr "" #: lazarusidestrconsts.liskeepsubindentation msgid "Absolute indentation" msgstr "" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" msgstr "Mantin-los i continua" #: lazarusidestrconsts.liskey msgctxt "lazarusidestrconsts.liskey" msgid "Key" msgstr "Tecla" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" msgstr "Ordres personalitzades" #: lazarusidestrconsts.liskeycatdesigner msgid "Designer commands" msgstr "Ordres del dissenyador" #: lazarusidestrconsts.liskeycatobjinspector msgid "Object Inspector commands" msgstr "" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" msgstr "" #: lazarusidestrconsts.liskmaddbpaddress msgid "Add Address Breakpoint" msgstr "" #: lazarusidestrconsts.liskmaddbpsource msgid "Add Source Breakpoint" msgstr "" #: lazarusidestrconsts.liskmaddbpwatchpoint msgid "Add Data/WatchPoint" msgstr "" #: lazarusidestrconsts.liskmaddwatch msgctxt "lazarusidestrconsts.liskmaddwatch" msgid "Add watch" msgstr "" #: lazarusidestrconsts.liskmbuildmanymodes msgid "Build many modes" msgstr "" #: lazarusidestrconsts.liskmbuildprojectprogram msgid "Build project/program" msgstr "" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "" #: lazarusidestrconsts.liskmclassic msgid "Classic" msgstr "Clàssic" #: lazarusidestrconsts.liskmcleanupandbuild msgctxt "lazarusidestrconsts.liskmcleanupandbuild" msgid "Clean up and build" msgstr "" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" msgstr "" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "" #: lazarusidestrconsts.liskmcompileprojectprogram msgid "Compile project/program" msgstr "" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config \"Build File\"" msgstr "" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure Custom Components" msgstr "" #: lazarusidestrconsts.liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "" #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "" #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi Project to Lazarus Project" msgstr "" #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit msgid "Convert Delphi Unit to Lazarus Unit" msgstr "" #: lazarusidestrconsts.liskmconvertdfmfiletolfm msgid "Convert DFM File to LFM" msgstr "" #: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard msgid "Copy selected components" msgstr "" #: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard msgid "Cut selected components" msgstr "" #: lazarusidestrconsts.liskmdefaulttoosx msgid "Default adapted to macOS" msgstr "" #: lazarusidestrconsts.liskmdeletelastchar msgid "Delete last char" msgstr "" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff Editor Files" msgstr "" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" msgstr "" #: lazarusidestrconsts.liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "" #: lazarusidestrconsts.liskmencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts.liskmevaluatemodify msgid "Evaluate/Modify" msgstr "" #: lazarusidestrconsts.liskmexternaltoolssettings msgid "External Tools settings" msgstr "" #: lazarusidestrconsts.liskmfindincremental msgid "Find Incremental" msgstr "" #: lazarusidestrconsts.liskmgotomarker0 msgid "Go to bookmark 0" msgstr "" #: lazarusidestrconsts.liskmgotomarker1 msgid "Go to bookmark 1" msgstr "" #: lazarusidestrconsts.liskmgotomarker2 msgid "Go to bookmark 2" msgstr "" #: lazarusidestrconsts.liskmgotomarker3 msgid "Go to bookmark 3" msgstr "" #: lazarusidestrconsts.liskmgotomarker4 msgid "Go to bookmark 4" msgstr "" #: lazarusidestrconsts.liskmgotomarker5 msgid "Go to bookmark 5" msgstr "" #: lazarusidestrconsts.liskmgotomarker6 msgid "Go to bookmark 6" msgstr "" #: lazarusidestrconsts.liskmgotomarker7 msgid "Go to bookmark 7" msgstr "" #: lazarusidestrconsts.liskmgotomarker8 msgid "Go to bookmark 8" msgstr "" #: lazarusidestrconsts.liskmgotomarker9 msgid "Go to bookmark 9" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "" #: lazarusidestrconsts.liskminsertdateandtime msgid "Insert date and time" msgstr "" #: lazarusidestrconsts.liskminsertusername msgid "Insert username" msgstr "" #: lazarusidestrconsts.liskminspect msgid "Inspect" msgstr "" #: lazarusidestrconsts.liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus default" msgstr "" #: lazarusidestrconsts.liskmmacosxapple msgid "macOS, Apple style" msgstr "" #: lazarusidestrconsts.liskmmacosxlaz msgid "macOS, Lazarus style" msgstr "" #: lazarusidestrconsts.liskmnewpackage msgid "New package" msgstr "" #: lazarusidestrconsts.liskmnewproject msgid "New project" msgstr "" #: lazarusidestrconsts.liskmnewprojectfromfile msgid "New project from file" msgstr "" #: lazarusidestrconsts.liskmnewunit #, fuzzy msgctxt "lazarusidestrconsts.liskmnewunit" msgid "New Unit" msgstr "Nova unitat" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." msgstr "" #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" msgstr "" #: lazarusidestrconsts.liskmopenrecent msgctxt "lazarusidestrconsts.liskmopenrecent" msgid "Open Recent" msgstr "" #: lazarusidestrconsts.liskmopenrecentpackage msgid "Open recent package" msgstr "" #: lazarusidestrconsts.liskmopenrecentproject msgid "Open recent project" msgstr "" #: lazarusidestrconsts.liskmpastecomponentsfromclipboard msgid "Paste Components" msgstr "" #: lazarusidestrconsts.liskmpauseprogram msgid "Pause program" msgstr "" #: lazarusidestrconsts.liskmpublishproject msgid "Publish project" msgstr "" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "" #: lazarusidestrconsts.liskmremoveactivefilefromproject msgid "Remove Active File from Project" msgstr "" #: lazarusidestrconsts.liskmrunprogram msgid "Run program" msgstr "" #: lazarusidestrconsts.liskmsaveall #, fuzzy msgctxt "lazarusidestrconsts.liskmsaveall" msgid "Save All" msgstr "Desa-ho Tot" #: lazarusidestrconsts.liskmsaveas msgid "Save As" msgstr "" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" msgstr "" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" msgstr "" #: lazarusidestrconsts.liskmselectlineend #, fuzzy msgctxt "lazarusidestrconsts.liskmselectlineend" msgid "Select Line End" msgstr "Selecciona al final de la línia" #: lazarusidestrconsts.liskmselectlinestart #, fuzzy msgctxt "lazarusidestrconsts.liskmselectlinestart" msgid "Select Line Start" msgstr "Selecciona al començament de la línia" #: lazarusidestrconsts.liskmselectpagebottom #, fuzzy msgctxt "lazarusidestrconsts.liskmselectpagebottom" msgid "Select Page Bottom" msgstr "Selecciona la pàgina inferior" #: lazarusidestrconsts.liskmselectpagetop #, fuzzy msgctxt "lazarusidestrconsts.liskmselectpagetop" msgid "Select Page Top" msgstr "Selecciona la pàgina superior" #: lazarusidestrconsts.liskmselectwordleft #, fuzzy msgctxt "lazarusidestrconsts.liskmselectwordleft" msgid "Select Word Left" msgstr "Selecciona una paraula a l'esquerra" #: lazarusidestrconsts.liskmselectwordright #, fuzzy msgctxt "lazarusidestrconsts.liskmselectwordright" msgid "Select Word Right" msgstr "Selecciona una paraula a la dreta" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" msgstr "" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set bookmark 0" msgstr "" #: lazarusidestrconsts.liskmsetmarker1 msgid "Set bookmark 1" msgstr "" #: lazarusidestrconsts.liskmsetmarker2 msgid "Set bookmark 2" msgstr "" #: lazarusidestrconsts.liskmsetmarker3 msgid "Set bookmark 3" msgstr "" #: lazarusidestrconsts.liskmsetmarker4 msgid "Set bookmark 4" msgstr "" #: lazarusidestrconsts.liskmsetmarker5 msgid "Set bookmark 5" msgstr "" #: lazarusidestrconsts.liskmsetmarker6 msgid "Set bookmark 6" msgstr "" #: lazarusidestrconsts.liskmsetmarker7 msgid "Set bookmark 7" msgstr "" #: lazarusidestrconsts.liskmsetmarker8 msgid "Set bookmark 8" msgstr "" #: lazarusidestrconsts.liskmsetmarker9 msgid "Set bookmark 9" msgstr "" #: lazarusidestrconsts.liskmstopprogram msgid "Stop Program" msgstr "" #: lazarusidestrconsts.liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle bookmark 0" msgstr "" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle bookmark 1" msgstr "" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle bookmark 2" msgstr "" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle bookmark 3" msgstr "" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle bookmark 4" msgstr "" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle bookmark 5" msgstr "" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle bookmark 6" msgstr "" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle bookmark 7" msgstr "" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle bookmark 8" msgstr "" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle bookmark 9" msgstr "" #: lazarusidestrconsts.liskmtoggleviewassembler msgctxt "lazarusidestrconsts.liskmtoggleviewassembler" msgid "View Assembler" msgstr "" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "View Breakpoints" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcallstack #, fuzzy msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack" msgid "View Call Stack" msgstr "Mostra la pila de les crides" #: lazarusidestrconsts.liskmtoggleviewcodebrowser msgid "Toggle view Code Browser" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle View Component Palette" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdebugevents msgid "View Debuger Event Log" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdebuggeroutput msgid "View Debugger Output" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewhistory msgctxt "lazarusidestrconsts.liskmtoggleviewhistory" msgid "View History" msgstr "" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "View Local Variables" msgstr "" #: lazarusidestrconsts.liskmtoggleviewmemviewer msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer" msgid "View Mem viewer" msgstr "" #: lazarusidestrconsts.liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "" #: lazarusidestrconsts.liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "" #: lazarusidestrconsts.liskmtoggleviewpseudoterminal msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal" msgid "View Console In/Output" msgstr "" #: lazarusidestrconsts.liskmtoggleviewregisters msgid "View Registers" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewthreads msgctxt "lazarusidestrconsts.liskmtoggleviewthreads" msgid "View Threads" msgstr "" #: lazarusidestrconsts.liskmtoggleviewwatches msgid "View Watches" msgstr "" #: lazarusidestrconsts.liskmviewjumphistory msgid "View jump history" msgstr "" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" msgstr "" #: lazarusidestrconsts.liskmviewprojectsource msgid "View Project Source" msgstr "" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" msgstr "" #: lazarusidestrconsts.lislastopened msgid "Last opened" msgstr "" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "L'execució de l'aplicació no és vàlida" #: lazarusidestrconsts.lislaunchingcmdline msgid "Launching target command line" msgstr "Executant línia d'ordres de destinació" #: lazarusidestrconsts.lislazarusdefault msgid "Lazarus Default" msgstr "" #: lazarusidestrconsts.lislazarusdirectory msgid "Lazarus directory" msgstr "Directori del Lazarus" #: lazarusidestrconsts.lislazarusdirhint #, object-pascal-format msgid "Lazarus sources. This path is relative to primary config directory (%s)." msgstr "" #: lazarusidestrconsts.lislazarusdiroverride msgid "Directory to be used as a basedirectory." msgstr "" #: lazarusidestrconsts.lislazaruseditorv #, object-pascal-format msgid "Lazarus IDE v%s" msgstr "" #: lazarusidestrconsts.lislazaruside msgid "Lazarus IDE" msgstr "" #: lazarusidestrconsts.lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "" #: lazarusidestrconsts.lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "" #: lazarusidestrconsts.lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [opcions] " #: lazarusidestrconsts.lislazbuild msgid "lazbuild" msgstr "" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "" #: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile msgid "Are you sure you want to delete this build profile?" msgstr "" #: lazarusidestrconsts.lislazbuildbuildmany msgid "Build Many" msgstr "" #: lazarusidestrconsts.lislazbuildcommonsettings msgid "Common Settings" msgstr "" #: lazarusidestrconsts.lislazbuildconfirmbuild msgid "Confirm before build" msgstr "" #: lazarusidestrconsts.lislazbuildconfirmdeletion msgid "Confirm deletion" msgstr "" #: lazarusidestrconsts.lislazbuilddebugide msgid "Debug IDE" msgstr "" #: lazarusidestrconsts.lislazbuilddefines msgid "Defines" msgstr "" #: lazarusidestrconsts.lislazbuilddefineswithoutd msgid "Defines without -d" msgstr "" #: lazarusidestrconsts.lislazbuildeditdefines msgctxt "lazarusidestrconsts.lislazbuildeditdefines" msgid "Edit Defines" msgstr "" #: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile msgid "Edit list of defines which can be used by any profile" msgstr "" #: lazarusidestrconsts.lislazbuilderrorwritingfile msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" msgid "Error writing file" msgstr "S'ha produït un error mentre s'escrivia el fitxer" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow #, object-pascal-format msgid "%s%s%s%slazbuild is non interactive, aborting now." msgstr "" #: lazarusidestrconsts.lislazbuildmanageprofiles msgid "Manage Build Profiles" msgstr "" #: lazarusidestrconsts.lislazbuildmanageprofiles2 msgid "Manage profiles" msgstr "" #: lazarusidestrconsts.lislazbuildnameoftheactiveprofile msgid "Name of the active profile" msgstr "" #: lazarusidestrconsts.lislazbuildnewprof msgid "Add New Profile" msgstr "" #: lazarusidestrconsts.lislazbuildnewprofinfo msgid "Current build options will be associated with:" msgstr "" #: lazarusidestrconsts.lislazbuildnormalide msgid "Normal IDE" msgstr "" #: lazarusidestrconsts.lislazbuildoptimizedide msgid "Optimized IDE" msgstr "" #: lazarusidestrconsts.lislazbuildoptions msgid "Options:" msgstr "Opcions:" #: lazarusidestrconsts.lislazbuildoptionspassedtocompiler msgid "Options passed to compiler" msgstr "" #: lazarusidestrconsts.lislazbuildoptionssyntax msgid "lazbuild [options] " msgstr "" #: lazarusidestrconsts.lislazbuildprofile msgid "Profile to build" msgstr "" #: lazarusidestrconsts.lislazbuildrenameprof msgid "Rename Profile" msgstr "" #: lazarusidestrconsts.lislazbuildrenameprofinfo msgid "New name for profile:" msgstr "" #: lazarusidestrconsts.lislazbuildrestartafterbuild msgid "Restart after building IDE" msgstr "" #: lazarusidestrconsts.lislazbuildrestartlazarusautomatically msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically" msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" msgstr "" #: lazarusidestrconsts.lislazbuildselectprofilestobuild msgid "Select profiles to build" msgstr "" #: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding" msgid "Show confirmation dialog when building directly from Tools menu" msgstr "" #: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline msgid "Show options and defines for command line" msgstr "" #: lazarusidestrconsts.lislazbuildtargetcpu msgid "Target CPU:" msgstr "" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" msgstr "" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" msgstr "SO dest:" #: lazarusidestrconsts.lislazbuildunabletowritefile #, object-pascal-format msgid "Unable to write file \"%s\":%s" msgstr "" #: lazarusidestrconsts.lislazbuildupdaterevinc msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc" msgid "Update revision.inc" msgstr "" #: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog msgid "Update revision info in \"About Lazarus\" dialog" msgstr "" #: lazarusidestrconsts.lislazcleanupbuildall msgctxt "lazarusidestrconsts.lislazcleanupbuildall" msgid "Clean Up + Build all" msgstr "" #: lazarusidestrconsts.lislazver msgid "Lazarus Version (e.g. 1.2.4)" msgstr "" #: lazarusidestrconsts.lislclwidgettype #, fuzzy #| msgid "LCL Widget Type" msgid "LCL widget type" msgstr "Tipus de giny LCL" #: lazarusidestrconsts.lisldaddlinktoinherited msgid "Add link to inherited" msgstr "" #: lazarusidestrconsts.lisldcopyfrominherited msgid "Copy from inherited" msgstr "" #: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo #, object-pascal-format msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s" msgstr "" #: lazarusidestrconsts.lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "" #: lazarusidestrconsts.lisldnovalidfpdocpath msgid "No valid FPDoc path" msgstr "" #: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe #, object-pascal-format msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "" #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "" #: lazarusidestrconsts.lisleftgroupboxcaption msgid "Left anchoring" msgstr "" #: lazarusidestrconsts.lisleftgutter #, fuzzy msgctxt "lazarusidestrconsts.lisleftgutter" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "" #: lazarusidestrconsts.lisleftsides msgid "Left sides" msgstr "Costats esquerres" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" msgstr "Iguala l'espai esquerra" #: lazarusidestrconsts.lisless msgctxt "lazarusidestrconsts.lisless" msgid "Less" msgstr "" #: lazarusidestrconsts.lislevels msgctxt "lazarusidestrconsts.lislevels" msgid "Levels" msgstr "" #: lazarusidestrconsts.lislfmfile msgid "LFM file" msgstr "Fitxer LFM" #: lazarusidestrconsts.lislfmfilecontainsinvalidproperties msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." msgstr "" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" msgstr "El fitxer LFM està corromput" #: lazarusidestrconsts.lislfmisok msgid "LFM is ok" msgstr "" #: lazarusidestrconsts.lislgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" #: lazarusidestrconsts.lislibrarypath msgid "library path" msgstr "trajectòria de les biblioteques" #: lazarusidestrconsts.lislibraryprogramdescriptor msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)." msgstr "" #: lazarusidestrconsts.lislink msgid "Link:" msgstr "" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" msgstr "opcions de l'enllaçador" #: lazarusidestrconsts.lislinktarget msgid "Link target" msgstr "" #: lazarusidestrconsts.lislistofallcasevalues msgid "list of all case values" msgstr "" #: lazarusidestrconsts.lisloadingfailed #, object-pascal-format msgid "Loading %s failed." msgstr "" #: lazarusidestrconsts.lisloadmacrofrom msgid "Load macro from" msgstr "" #: lazarusidestrconsts.lislocal msgid "&Local" msgstr "" #: lazarusidestrconsts.lislowercasestring msgid "lowercase string" msgstr "" #: lazarusidestrconsts.lislowercasestringgivenasparameter msgid "Lowercase string given as parameter." msgstr "" #: lazarusidestrconsts.lislpicompatibilitymodecheckbox msgid "Maximize compatibility of project files (LPI and LPS)" msgstr "" #: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions." msgstr "" #: lazarusidestrconsts.lislpkcompatibilitymodecheckbox msgid "Maximize compatibility of package file (LPK)" msgstr "" #: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions." msgstr "" #: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative #, object-pascal-format msgid "lpk has vanished on disk. Using as alternative%s" msgstr "" #: lazarusidestrconsts.lislpkismissing msgid "lpk is missing" msgstr "" #: lazarusidestrconsts.lislrsincludefiles msgid "Lazarus resources (.lrs) include files" msgstr "" #: lazarusidestrconsts.lismacpreferences msgid "Preferences..." msgstr "" #: lazarusidestrconsts.lismacro #, object-pascal-format msgid "Macro %s" msgstr "" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" msgstr "Entra les dades" #: lazarusidestrconsts.lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Entra els paràmetres d'execució" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject #, fuzzy #| msgid "Main Unit has Uses Section containing all Units of project" msgid "Main unit has Uses section containing all units of project" msgstr "La unitat principal té secció USES amb totes les unitats del projecte" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main unit is Pascal source" msgstr "" #: lazarusidestrconsts.lismainunitispascalsourcehint msgid "Assume Pascal even if it does not end with .pas/.pp suffix." msgstr "" #: lazarusidestrconsts.lismajorchangesdetected msgid "Major changes detected" msgstr "" #: lazarusidestrconsts.lismakecurrent msgctxt "lazarusidestrconsts.lismakecurrent" msgid "Current" msgstr "" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" msgstr "Fes executable" #: lazarusidestrconsts.lismakenotfound msgid "Make not found" msgstr "No s'ha trobat Make" #: lazarusidestrconsts.lismakeresourcestring msgid "Make ResourceString" msgstr "Fes cadena del recurs" #: lazarusidestrconsts.lismakeresstrappendtosection msgid "Append to section" msgstr "Afegeix a la secció" #: lazarusidestrconsts.lismakeresstrchooseanothername #, object-pascal-format, fuzzy, badformat #| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escolliu-ne un altre nom. %s Escolliu - Ignora - per afegir-la de tota manera" #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" msgstr "Opcions de conversió" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "Identificador personalitzat" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" msgid "Identifier" msgstr "Identificador" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" msgstr "Longitud de l'identificador" #: lazarusidestrconsts.lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "Prefix de l'identificador" #: lazarusidestrconsts.lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "Insereix alfabèticament" #: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "Insereix sensitivament al context" #: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "La secció de la cadena del recurs no és vàlida" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "Ja existeix la cadena del recurs" #: lazarusidestrconsts.lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "Secció de cadena del recurs" #: lazarusidestrconsts.lismakeresstrsourcepreview msgid "Source preview" msgstr "Visualització prèvia del codi font" #: lazarusidestrconsts.lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "Constant de cadena en el codi font" #: lazarusidestrconsts.lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Cadenes amb el mateix valor:" #: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto msgid "Make sure all ppu files of a package are in its output directory." msgstr "" #: lazarusidestrconsts.lismanagesourceeditors msgid "Manage Source Editors ..." msgstr "" #: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system." msgstr "" #: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault #, object-pascal-format msgid "Maximum parallel processes, 0 means default (%s)" msgstr "" #: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage #, object-pascal-format msgid "%s Maybe you have to recompile the package." msgstr "" #: lazarusidestrconsts.lismb #, object-pascal-format msgid "%s MB" msgstr "" #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" msgstr "Avorta el muntatge" #: lazarusidestrconsts.lismenuaboutfpc msgid "About FPC" msgstr "" #: lazarusidestrconsts.lismenuaddbreakpoint #, fuzzy #| msgid "Add breakpoint" msgid "Add &Breakpoint" msgstr "Afegeix un punt de ruptura" #: lazarusidestrconsts.lismenuaddcurfiletopkg msgid "Add Active File to Package ..." msgstr "" #: lazarusidestrconsts.lismenuaddjumppointtohistory #, fuzzy #| msgid "Add jump point to history" msgid "Add Jump Point to History" msgstr "Afegeix un punt de salt a la història" #: lazarusidestrconsts.lismenuaddtoproject #, fuzzy #| msgid "Add editor file to Project" msgid "Add Editor File to Project" msgstr "Afegeix el fitxer de l'editor al Projecte" #: lazarusidestrconsts.lismenuaddwatch #, fuzzy #| msgid "Add watch ..." msgid "Add &Watch ..." msgstr "Afegeix control ..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in Selection" msgstr "" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" msgstr "Munta el fitxer" #: lazarusidestrconsts.lismenubuildlazarus #, fuzzy #| msgid "Build Lazarus with current profile" msgid "Build Lazarus with Current Profile" msgstr "Munta el Lazarus" #: lazarusidestrconsts.lismenubuildlazarusprof #, object-pascal-format msgid "Build Lazarus with Profile: %s" msgstr "" #: lazarusidestrconsts.lismenuchecklfm #, fuzzy #| msgid "Check LFM file in editor" msgid "Check LFM File in Editor" msgstr "Comprova el fitxer LFM en l'editor" #: lazarusidestrconsts.lismenucleandirectory #, fuzzy #| msgid "Clean directory ..." msgid "Clean Directory ..." msgstr "Neteja el directori ..." #: lazarusidestrconsts.lismenucleanupandbuild msgid "Clean up and Build ..." msgstr "" #: lazarusidestrconsts.lismenucloseeditorfile msgid "&Close Editor File" msgstr "" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" msgstr "" #: lazarusidestrconsts.lismenucodetoolsdefineseditor #, fuzzy #| msgid "CodeTools defines editor ..." msgid "CodeTools Defines Editor ..." msgstr "Editor de definició de les eines del codi ..." #: lazarusidestrconsts.lismenucommentselection #, fuzzy #| msgid "Comment selection" msgid "Comment Selection" msgstr "Comenta la selecció" #: lazarusidestrconsts.lismenucomparefiles msgid "Compare files ..." msgstr "" #: lazarusidestrconsts.lismenucompilemanymodes msgid "Compile many Modes ..." msgstr "" #: lazarusidestrconsts.lismenucompletecode msgctxt "lazarusidestrconsts.lismenucompletecode" msgid "Complete Code" msgstr "Completa el codi" #: lazarusidestrconsts.lismenucompletecodeinteractive msgid "Complete Code (with dialog)" msgstr "" #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Configura Arxiu Build+Run ..." #: lazarusidestrconsts.lismenuconfigcustomcomps #, fuzzy #| msgid "Configure custom components ..." msgid "Configure Custom Components ..." msgstr "Configura els components personalitzats ..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure External Tools ..." msgstr "" #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Configura \"Build Lazarus\" ..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" msgstr "Ajuda sensitiva al context" #: lazarusidestrconsts.lismenuconvertdelphipackage #, fuzzy #| msgid "Convert Delphi package to Lazarus package ..." msgid "Convert Delphi Package to Lazarus Package ..." msgstr "Converteix paquet Delphi a paquet Lazarus ..." #: lazarusidestrconsts.lismenuconvertdelphiproject #, fuzzy #| msgid "Convert Delphi project to Lazarus project ..." msgid "Convert Delphi Project to Lazarus Project ..." msgstr "Converteix projecte Delphi a projecte Lazarus ..." #: lazarusidestrconsts.lismenuconvertdelphiunit #, fuzzy #| msgid "Convert Delphi unit to Lazarus unit ..." msgid "Convert Delphi Unit to Lazarus Unit ..." msgstr "Converteix la unitat Delphi a unitat Lazarus ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm #, fuzzy #| msgid "Convert binary DFM to text LFM + check syntax ..." msgid "Convert Binary DFM to LFM ..." msgstr "Converteix el fitxer DFM a LFM ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert Encoding of Projects/Packages ..." msgstr "" #: lazarusidestrconsts.lismenudebugwindows #, fuzzy #| msgid "Debug windows" msgid "Debug Windows" msgstr "Finestres de depuració" #: lazarusidestrconsts.lismenudelphiconversion msgid "Delphi Conversion" msgstr "" #: lazarusidestrconsts.lismenuedit msgid "&Edit" msgstr "&Edita" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." msgstr "Plantilles de codi ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "" #: lazarusidestrconsts.lismenueditinstallpkgs #, fuzzy #| msgid "Install/Uninstall packages ..." msgid "Install/Uninstall Packages ..." msgstr "Configura els paquets intal·lats ..." #: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging #, object-pascal-format msgid "Accelerator(&&) key \"%s\" needs changing" msgstr "" #: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem msgid "Add a new item above selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem msgid "Add a new item after selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem msgid "Add a new item before selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem msgid "Add a new item below selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem msgid "Add a submenu at the right of selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem msgid "Add a submenu below selected item" msgstr "" #: lazarusidestrconsts.lismenueditoraddfromtemplate msgid "&Add from template ..." msgstr "" #: lazarusidestrconsts.lismenueditoraddiconfroms #, object-pascal-format msgid "Add icon from %s" msgstr "" #: lazarusidestrconsts.lismenueditoraddimagelisticon msgid "Add imagelist &icon" msgstr "" #: lazarusidestrconsts.lismenueditoraddmenuitem msgid "Add menu item" msgstr "" #: lazarusidestrconsts.lismenueditoraddnewitemabove msgid "&Add new item above" msgstr "" #: lazarusidestrconsts.lismenueditoraddnewitemafter msgid "Add ne&w item after" msgstr "" #: lazarusidestrconsts.lismenueditoraddnewitembefore msgid "&Add new item before" msgstr "" #: lazarusidestrconsts.lismenueditoraddnewitembelow msgid "Add ne&w item below" msgstr "" #: lazarusidestrconsts.lismenueditoraddonclickhandler msgid "Add &OnClick handler" msgstr "" #: lazarusidestrconsts.lismenueditoraddseparatorafter msgid "Add separator &after" msgstr "" #: lazarusidestrconsts.lismenueditoraddseparatorbefore msgid "Add separator &before" msgstr "" #: lazarusidestrconsts.lismenueditoraddsubmenu msgid "Add submenu" msgstr "" #: lazarusidestrconsts.lismenueditoraddsubmenubelow msgid "Add &submenu below" msgstr "" #: lazarusidestrconsts.lismenueditoraddsubmenuright msgid "Add &submenu right" msgstr "" #: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved #, object-pascal-format msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items" msgstr "" #: lazarusidestrconsts.lismenueditorbasiceditmenutemplate msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,," msgstr "" #: lazarusidestrconsts.lismenueditorbasicfilemenutemplate msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,," msgstr "" #: lazarusidestrconsts.lismenueditorbasichelpmenutemplate msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,," msgstr "" #: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,," msgstr "" #: lazarusidestrconsts.lismenueditorcaption msgid "Caption" msgstr "" #: lazarusidestrconsts.lismenueditorcaptioneditemss #, object-pascal-format msgid "Captioned items: %s" msgstr "" #: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank msgid "Caption should not be blank" msgstr "" #: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators #, object-pascal-format msgid "Change conflicting accelerator \"%s\"" msgstr "" #: lazarusidestrconsts.lismenueditorchangeimagelisticon msgid "Change imagelist &icon" msgstr "" #: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent #, object-pascal-format msgid "Change %s for %s" msgstr "" #: lazarusidestrconsts.lismenueditorchangeshortcutconflicts #, object-pascal-format msgid "Change shortcut conflict \"%s\"" msgstr "" #: lazarusidestrconsts.lismenueditorchangetheshortcutfors #, object-pascal-format msgid "Change the shortCut for %s" msgstr "" #: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors #, object-pascal-format msgid "Change the shortCutKey2 for %s" msgstr "" #: lazarusidestrconsts.lismenueditorchoosetemplatetodelete msgid "Choose template to delete" msgstr "" #: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert msgid "Choose template to insert" msgstr "" #: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column" msgstr "" #: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind msgid "Component is unexpected kind" msgstr "" #: lazarusidestrconsts.lismenueditorcomponentisunnamed msgid "Component is unnamed" msgstr "" #: lazarusidestrconsts.lismenueditorconflictresolutioncomplete msgid "" msgstr "" #: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd #, object-pascal-format msgid "Conflicts found initially: %d" msgstr "" #: lazarusidestrconsts.lismenueditordeepestnestedmenulevels #, object-pascal-format msgid "Deepest nested menu level: %s" msgstr "" #: lazarusidestrconsts.lismenueditordeleteitem #, fuzzy #| msgid "Delete Item" msgid "&Delete item" msgstr "Elimina l'element" #: lazarusidestrconsts.lismenueditordeletemenutemplate msgid "&Delete menu template ..." msgstr "" #: lazarusidestrconsts.lismenueditordeletesavedmenutemplate msgid "Delete saved menu template" msgstr "" #: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate msgid "Delete selected menu template" msgstr "" #: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems msgid "Delete this item and its subitems?" msgstr "" #: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu msgid "Display preview as &Popup menu" msgstr "" #: lazarusidestrconsts.lismenueditoreditcaption msgid "Edit &Caption" msgstr "" #: lazarusidestrconsts.lismenueditoreditingcaptionofs #, object-pascal-format msgid "Editing Caption of %s" msgstr "" #: lazarusidestrconsts.lismenueditoreditingsdots #, object-pascal-format msgid "To resolve conflict edit %s.%s" msgstr "" #: lazarusidestrconsts.lismenueditoreditingsfors #, object-pascal-format msgid "Editing %s for %s" msgstr "" #: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected #, object-pascal-format msgid "Editing %s.%s - no menuitem selected" msgstr "" #: lazarusidestrconsts.lismenueditorenteramenudescription msgid "Enter a menu &Description:" msgstr "" #: lazarusidestrconsts.lismenueditorenteranewshortcutfors #, object-pascal-format msgid "Enter a new ShortCut for %s" msgstr "" #: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors #, object-pascal-format msgid "Enter a new ShortCutKey2 for %s" msgstr "" #: lazarusidestrconsts.lismenueditorexistingsavedtemplates msgid "Existing saved templates" msgstr "" #: lazarusidestrconsts.lismenueditorfurthershortcutconflict msgid "Further shortcut conflict" msgstr "" #: lazarusidestrconsts.lismenueditorgethelptousethiseditor msgid "Get help to use this editor" msgstr "" #: lazarusidestrconsts.lismenueditorgrabkey msgid "&Grab key" msgstr "" #: lazarusidestrconsts.lismenueditorgroupindexd #, object-pascal-format msgid "GroupIndex: %d" msgstr "" #: lazarusidestrconsts.lismenueditorgroupindexvaluess #, object-pascal-format msgid "Values in use: %s" msgstr "" #: lazarusidestrconsts.lismenueditorinadequatedescription msgid "Inadequate Description" msgstr "" #: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs #, object-pascal-format msgid "Insert menu template into root of %s" msgstr "" #: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate msgid "Insert selected menu template" msgstr "" #: lazarusidestrconsts.lismenueditorisnotassigned msgid "is not assigned" msgstr "" #: lazarusidestrconsts.lismenueditoritemswithicons #, object-pascal-format msgid "Items with icon: %s" msgstr "" #: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators #, object-pascal-format msgid "List shortcuts and &accelerators for %s ..." msgstr "" #: lazarusidestrconsts.lismenueditorlistshortcutsfors #, object-pascal-format msgid "List shortcuts for %s ..." msgstr "" #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" msgstr "Editor del menú" #: lazarusidestrconsts.lismenueditormenuitemactions msgid "Menu Item actions" msgstr "" #: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins #, object-pascal-format msgid "Menuitem shortcut conflicts in %s" msgstr "" #: lazarusidestrconsts.lismenueditormoveitemdown msgid "Mo&ve item down" msgstr "" #: lazarusidestrconsts.lismenueditormoveitemleft msgid "&Move item left" msgstr "" #: lazarusidestrconsts.lismenueditormoveitemright msgid "Mo&ve item right" msgstr "" #: lazarusidestrconsts.lismenueditormoveitemup msgid "&Move item up" msgstr "" #: lazarusidestrconsts.lismenueditormoveselecteditemdown msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown" msgid "Move selected item down" msgstr "" #: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft msgid "Move selected item to the left" msgstr "" #: lazarusidestrconsts.lismenueditormoveselecteditemtotheright msgid "Move selected item to the right" msgstr "" #: lazarusidestrconsts.lismenueditormoveselecteditemup msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup" msgid "Move selected item up" msgstr "" #: lazarusidestrconsts.lismenueditorna msgid "n/a" msgstr "" #: lazarusidestrconsts.lismenueditornomenuselected msgid "(no menu selected)" msgstr "" #: lazarusidestrconsts.lismenueditornone msgid "" msgstr "" #: lazarusidestrconsts.lismenueditornonenone msgid "," msgstr "" #: lazarusidestrconsts.lismenueditornoshortcutconflicts msgid "" msgstr "" #: lazarusidestrconsts.lismenueditornousersavedtemplates msgid "No user-saved templates" msgstr "" #: lazarusidestrconsts.lismenueditorpickaniconfroms #, object-pascal-format msgid "Pick an icon from %s" msgstr "" #: lazarusidestrconsts.lismenueditorpopupassignmentss #, object-pascal-format msgid "Popup assignments: %s" msgstr "" #: lazarusidestrconsts.lismenueditorradioitem msgid "RadioItem" msgstr "" #: lazarusidestrconsts.lismenueditorremainingconflictss #, object-pascal-format msgid "Remaining conflicts: %s" msgstr "" #: lazarusidestrconsts.lismenueditorremoveallseparators msgid "&Remove all separators" msgstr "" #: lazarusidestrconsts.lismenueditorresolvedconflictss #, object-pascal-format msgid "Resolved conflicts: %s" msgstr "" #: lazarusidestrconsts.lismenueditorresolveselectedconflict msgid "Resolve selected conflict" msgstr "" #: lazarusidestrconsts.lismenueditorresolveshortcutconflicts msgid "&Resolve shortcut conflicts ..." msgstr "" #: lazarusidestrconsts.lismenueditorsavedtemplates msgid "Saved templates" msgstr "" #: lazarusidestrconsts.lismenueditorsavemenuasatemplate msgid "&Save menu as a template ..." msgstr "" #: lazarusidestrconsts.lismenueditorsavemenuastemplate msgid "Save menu as template" msgstr "" #: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse msgid "Save menu as template for future use" msgstr "" #: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate msgid "Save menu shown as a new template" msgstr "" #: lazarusidestrconsts.lismenueditorsconflictswiths #, object-pascal-format msgid "%s conflicts with %s" msgstr "" #: lazarusidestrconsts.lismenueditorseparators msgid "Se¶tors" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutitemss #, object-pascal-format msgid "Shortcut items: %s" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutnotyetchanged msgid "Shortcut not yet changed" msgstr "" #: lazarusidestrconsts.lismenueditorshortcuts msgid "Shortcuts" msgstr "" #: lazarusidestrconsts.lismenueditorshortcuts2 msgid "Shortc&uts" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys msgid "Shortcuts and Accelerator keys" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsd #, object-pascal-format msgid "Shortcuts (%d)" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd #, object-pascal-format msgid "Shortcuts (%d) and Accelerator keys (%d)" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsourceproperty msgid "Shortcut,Source Property" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsusedins #, object-pascal-format msgid "Shortcuts used in %s" msgstr "" #: lazarusidestrconsts.lismenueditorshortcutsusedinsd #, object-pascal-format msgid "Shortcuts used in %s (%d)" msgstr "" #: lazarusidestrconsts.lismenueditorsins #, object-pascal-format msgid "\"%s\" in %s" msgstr "" #: lazarusidestrconsts.lismenueditorsisalreadyinuse #, object-pascal-format msgid "" "\"%s\" is already in use in %s as a shortcut.\n" "Try a different shortcut." msgstr "" #: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand #, object-pascal-format msgid "Please expand: \"%s\" is not a sufficient Description" msgstr "" #: lazarusidestrconsts.lismenueditorsshortcuts #, object-pascal-format msgid "%s: Shortcuts" msgstr "" #: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys #, object-pascal-format msgid "%s: Shortcuts and accelerator keys" msgstr "" #: lazarusidestrconsts.lismenueditorsssonclicks #, object-pascal-format msgid "%s.%s.%s - OnClick: %s" msgstr "" #: lazarusidestrconsts.lismenueditorstandardtemplates msgid "Standard templates" msgstr "" #: lazarusidestrconsts.lismenueditortemplatedescription msgid "Template description:" msgstr "" #: lazarusidestrconsts.lismenueditortemplates msgid "&Templates" msgstr "" #: lazarusidestrconsts.lismenueditortemplatesaved msgid "Template saved" msgstr "" #: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates msgid "" "There are no user-saved menu templates.\n" "\n" "Only standard default templates are available." msgstr "" #: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis #, object-pascal-format msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" msgstr "" #: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict #, object-pascal-format msgid "" "You have to change the shortcut from %s\n" "to avoid a conflict" msgstr "" #: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption msgid "You must enter text for the Caption" msgstr "" #: lazarusidestrconsts.lismenuencloseinifdef msgid "Enclose in $IFDEF ..." msgstr "" #: lazarusidestrconsts.lismenuencloseselection #, fuzzy #| msgid "Enclose selection ..." msgid "Enclose Selection ..." msgstr "Tanca la selecció ..." #: lazarusidestrconsts.lismenuevaluate #, fuzzy #| msgid "Evaluate/Modify ..." msgid "E&valuate/Modify ..." msgstr "Avalua/Modifica ..." #: lazarusidestrconsts.lismenuextractproc #, fuzzy #| msgid "Extract procedure ..." msgid "Extract Procedure ..." msgstr "Extrau el procediment ..." #: lazarusidestrconsts.lismenufile msgid "&File" msgstr "&Fitxer" #: lazarusidestrconsts.lismenufind msgctxt "lazarusidestrconsts.lismenufind" msgid "Find" msgstr "Cerca" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." msgstr "" #: lazarusidestrconsts.lismenufindblockotherendofcodeblock #, fuzzy #| msgid "Find other end of code block" msgid "Find Other End of Code Block" msgstr "Cerca l'altre cap del bloc del codi" #: lazarusidestrconsts.lismenufindcodeblockstart #, fuzzy #| msgid "Find code block start" msgid "Find Start of Code Block" msgstr "Cerca l'inici del bloc del codi" #: lazarusidestrconsts.lismenufinddeclarationatcursor #, fuzzy #| msgid "Find Declaration at cursor" msgid "Find Declaration at Cursor" msgstr "Cerca la declaració al cursor" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Cerca les referències de l'identificador ..." #: lazarusidestrconsts.lismenufindinfiles #, fuzzy #| msgid "Find &in files ..." msgid "Find &in Files ..." msgstr "Cerca &en els Fitxers ..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" msgstr "Cerca el següe&nt" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" msgstr "Cerca l'an&terior" #: lazarusidestrconsts.lismenufindreferencesofusedunit msgid "Find References Of Used Unit" msgstr "" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." msgstr "" #: lazarusidestrconsts.lismenugotoincludedirective #, fuzzy #| msgid "Goto include directive" msgid "Goto Include Directive" msgstr "Vés a la directiva Include" #: lazarusidestrconsts.lismenugotoline #, fuzzy #| msgid "Goto line ..." msgid "Goto Line ..." msgstr "Vés a la línia ..." #: lazarusidestrconsts.lismenuguessmisplacedifdef #, fuzzy #| msgid "Guess misplaced IFDEF/ENDIF" msgid "Guess Misplaced IFDEF/ENDIF" msgstr "Suposa IFDEF/ENDIF omès" #: lazarusidestrconsts.lismenuguessunclosedblock #, fuzzy #| msgid "Guess unclosed block" msgid "Guess Unclosed Block" msgstr "Suposa bloc no tancat" #: lazarusidestrconsts.lismenuhelp msgid "&Help" msgstr "A&juda" #: lazarusidestrconsts.lismenuideinternals msgid "IDE Internals" msgstr "" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" msgstr "Recerca incremental" #: lazarusidestrconsts.lismenuindentselection #, fuzzy #| msgid "Indent selection" msgid "Indent Selection" msgstr "Sagna la selecció" #: lazarusidestrconsts.lismenuinsertchangelogentry #, fuzzy #| msgid "ChangeLog entry" msgid "ChangeLog Entry" msgstr "Entrada de registre de canvis" #: lazarusidestrconsts.lismenuinsertcharacter #, fuzzy #| msgid "Insert from Character Map" msgid "Insert from Character Map ..." msgstr "Insereix desde el mapa de caràcters" #: lazarusidestrconsts.lismenuinsertcvskeyword #, fuzzy #| msgid "Insert CVS keyword" msgid "Insert CVS Keyword" msgstr "Paraula clau del CVS" #: lazarusidestrconsts.lismenuinsertdatetime #, fuzzy #| msgid "Current date and time" msgid "Current Date and Time" msgstr "Data i hora actuals" #: lazarusidestrconsts.lismenuinsertfilename msgid "Insert Full Filename ..." msgstr "" #: lazarusidestrconsts.lismenuinsertgeneral #, fuzzy #| msgid "General" msgctxt "lazarusidestrconsts.lismenuinsertgeneral" msgid "Insert General" msgstr "General" #: lazarusidestrconsts.lismenuinsertgplnotice #, fuzzy #| msgid "GPL notice" msgid "GPL Notice" msgstr "Comentari GPL" #: lazarusidestrconsts.lismenuinsertgplnoticetranslated msgid "GPL Notice (translated)" msgstr "" #: lazarusidestrconsts.lismenuinsertlgplnotice #, fuzzy #| msgid "LGPL notice" msgid "LGPL Notice" msgstr "Comentari LGPL" #: lazarusidestrconsts.lismenuinsertlgplnoticetranslated msgid "LGPL Notice (translated)" msgstr "" #: lazarusidestrconsts.lismenuinsertmitnotice msgid "MIT Notice" msgstr "" #: lazarusidestrconsts.lismenuinsertmitnoticetranslated msgid "MIT Notice (translated)" msgstr "" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL Notice" msgstr "" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated msgid "Modified LGPL Notice (translated)" msgstr "" #: lazarusidestrconsts.lismenuinsertusername #, fuzzy #| msgid "Current username" msgid "Current Username" msgstr "Nom d'usuari actual" #: lazarusidestrconsts.lismenuinspect #, fuzzy #| msgid "Inspect ..." msgctxt "lazarusidestrconsts.lismenuinspect" msgid "&Inspect ..." msgstr "Inspecciona ..." #: lazarusidestrconsts.lismenujumpback #, fuzzy #| msgid "Jump back" msgctxt "lazarusidestrconsts.lismenujumpback" msgid "Jump Back" msgstr "Salta enrera" #: lazarusidestrconsts.lismenujumpforward #, fuzzy #| msgid "Jump forward" msgctxt "lazarusidestrconsts.lismenujumpforward" msgid "Jump Forward" msgstr "Salta endavant" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" msgstr "Ves a" #: lazarusidestrconsts.lismenujumptoimplementation msgid "Jump to Implementation" msgstr "" #: lazarusidestrconsts.lismenujumptoimplementationuses msgid "Jump to Implementation uses" msgstr "" #: lazarusidestrconsts.lismenujumptoinitialization msgid "Jump to Initialization" msgstr "" #: lazarusidestrconsts.lismenujumptointerface msgid "Jump to Interface" msgstr "" #: lazarusidestrconsts.lismenujumptointerfaceuses msgid "Jump to Interface uses" msgstr "" #: lazarusidestrconsts.lismenujumptonextbookmark #, fuzzy #| msgid "Jump to next bookmark" msgid "Jump to Next Bookmark" msgstr "Ves al següent marcador" #: lazarusidestrconsts.lismenujumptonexterror #, fuzzy #| msgid "Jump to next error" msgid "Jump to Next Error" msgstr "Salta al següent error" #: lazarusidestrconsts.lismenujumptoprevbookmark #, fuzzy #| msgid "Jump to previous bookmark" msgid "Jump to Previous Bookmark" msgstr "Ves al marcador anterior" #: lazarusidestrconsts.lismenujumptopreverror #, fuzzy #| msgid "Jump to previous error" msgid "Jump to Previous Error" msgstr "Salta a l'error previ" #: lazarusidestrconsts.lismenujumptoprocedurebegin msgid "Jump to Procedure begin" msgstr "" #: lazarusidestrconsts.lismenujumptoprocedureheader msgid "Jump to Procedure header" msgstr "" #: lazarusidestrconsts.lismenulowercaseselection #, fuzzy #| msgid "Lowercase selection" msgid "Lowercase Selection" msgstr "Fica a minúscules la selecció" #: lazarusidestrconsts.lismenumacrolistview msgctxt "lazarusidestrconsts.lismenumacrolistview" msgid "Editor Macros" msgstr "" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." msgstr "Fes cadena del recurs ..." #: lazarusidestrconsts.lismenumultipaste msgctxt "lazarusidestrconsts.lismenumultipaste" msgid "MultiPaste ..." msgstr "" #: lazarusidestrconsts.lismenunewcomponent msgctxt "lazarusidestrconsts.lismenunewcomponent" msgid "New Component" msgstr "Nou component" #: lazarusidestrconsts.lismenunewcustom #, object-pascal-format msgid "New %s" msgstr "" #: lazarusidestrconsts.lismenunewform msgid "New Form" msgstr "Nova forma" #: lazarusidestrconsts.lismenunewother msgid "New ..." msgstr "Nou ..." #: lazarusidestrconsts.lismenunewpackage msgid "New Package ..." msgstr "" #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." msgstr "Nou projecte ..." #: lazarusidestrconsts.lismenunewprojectfromfile #, fuzzy #| msgid "New Project from file ..." msgid "New Project from File ..." msgstr "Nou projecte des del fitxer ..." #: lazarusidestrconsts.lismenunewunit msgctxt "lazarusidestrconsts.lismenunewunit" msgid "New Unit" msgstr "Nova unitat" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "Ajuda en línia" #: lazarusidestrconsts.lismenuopen #, fuzzy #| msgid "Open ..." msgid "&Open ..." msgstr "Obre ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor #, fuzzy #| msgid "Open filename at cursor" msgid "Open Filename at Cursor" msgstr "Obre nom del fitxer al cursor" #: lazarusidestrconsts.lismenuopenfolder msgid "Open Folder ..." msgstr "" #: lazarusidestrconsts.lismenuopenpackage #, fuzzy #| msgid "Open loaded package ..." msgid "Open Loaded Package ..." msgstr "Obre el paquet carregat ..." #: lazarusidestrconsts.lismenuopenpackagefile #, fuzzy #| msgid "Open package file (.lpk) ..." msgid "Open Package File (.lpk) ..." msgstr "Obre arxiu de paquet (.lpk)" #: lazarusidestrconsts.lismenuopenpackageofcurunit #, fuzzy #| msgid "Open package of current unit" msgid "Open Package of Current Unit" msgstr "Obre el paquet de la unitat actual" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." msgstr "Obre el projecte ..." #: lazarusidestrconsts.lismenuopenrecent #, fuzzy #| msgid "Open &Recent ..." msgid "Open &Recent" msgstr "Obre recent ..." #: lazarusidestrconsts.lismenuopenrecentpkg #, fuzzy #| msgid "Open recent package" msgid "Open Recent Package" msgstr "Obre el paquet recent ..." #: lazarusidestrconsts.lismenuopenrecentproject #, fuzzy #| msgid "Open Recent Project ..." msgctxt "lazarusidestrconsts.lismenuopenrecentproject" msgid "Open Recent Project" msgstr "Obre el projecte recent ..." #: lazarusidestrconsts.lismenuopenunit msgid "Open Unit ..." msgstr "" #: lazarusidestrconsts.lismenupackage msgid "Pa&ckage" msgstr "" #: lazarusidestrconsts.lismenupackagegraph #, fuzzy #| msgid "Package Graph ..." msgid "Package Graph" msgstr "Gràfica dels paquets ..." #: lazarusidestrconsts.lismenupackagelinks msgid "Package Links ..." msgstr "" #: lazarusidestrconsts.lismenupastefromclipboard msgctxt "lazarusidestrconsts.lismenupastefromclipboard" msgid "Paste from clipboard" msgstr "" #: lazarusidestrconsts.lismenupkgnewpackagecomponent msgid "New package component" msgstr "" #: lazarusidestrconsts.lismenuprocedurelist msgctxt "lazarusidestrconsts.lismenuprocedurelist" msgid "Procedure List ..." msgstr "Llista de Procediments ..." #: lazarusidestrconsts.lismenuproject msgid "&Project" msgstr "&Projecte" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" msgstr "Inspector del projecte" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." msgstr "Opcions del projecte ..." #: lazarusidestrconsts.lismenuprojectrun #, fuzzy #| msgid "Run" msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "&Run" msgstr "Executa" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." msgstr "Publica el projecte ..." #: lazarusidestrconsts.lismenuquickcompile #, fuzzy #| msgid "Quick compile" msgid "Quick Compile" msgstr "Compilació ràpida" #: lazarusidestrconsts.lismenuquicksyntaxcheck #, fuzzy #| msgid "Quick syntax check" msgid "Quick Syntax Check" msgstr "Comprova la sintaxi ràpidament" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." msgstr "Elimina del projecte ..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Canvia el nom de l'identificador ..." #: lazarusidestrconsts.lismenurenamelowercase msgid "Rename Unit Files to LowerCase ..." msgstr "" #: lazarusidestrconsts.lismenureportingbug msgctxt "lazarusidestrconsts.lismenureportingbug" msgid "Reporting a Bug" msgstr "" #: lazarusidestrconsts.lismenuresaveformswithi18n msgid "Resave forms with enabled i18n" msgstr "" #: lazarusidestrconsts.lismenurescanfpcsourcedirectory #, fuzzy #| msgid "Rescan FPC source directory" msgid "Rescan FPC Source Directory" msgstr "Torna a escanejar el directori del codi font del FPC" #: lazarusidestrconsts.lismenuresetdebugger #, fuzzy #| msgid "Reset debugger" msgid "Reset Debugger" msgstr "Reinicia el depurador" #: lazarusidestrconsts.lismenurevert msgid "Revert" msgstr "Reverteix" #: lazarusidestrconsts.lismenurun #, fuzzy msgctxt "lazarusidestrconsts.lismenurun" msgid "&Run" msgstr "E&xecuta" #: lazarusidestrconsts.lismenurunfile msgid "Run File" msgstr "Executa el fitxer" #: lazarusidestrconsts.lismenurunparameters #, fuzzy #| msgid "Run Parameters ..." msgid "Run &Parameters ..." msgstr "Paràmetres de l'execució ..." #: lazarusidestrconsts.lismenuruntocursor #, fuzzy #| msgid "Run to &Cursor" msgctxt "lazarusidestrconsts.lismenuruntocursor" msgid "Run to Cursor" msgstr "Executa al cursor" #: lazarusidestrconsts.lismenurunwithdebugging msgid "Run with Debugging" msgstr "" #: lazarusidestrconsts.lismenurunwithoutdebugging msgid "Run without Debugging" msgstr "" #: lazarusidestrconsts.lismenusave #, fuzzy #| msgid "Save" msgctxt "lazarusidestrconsts.lismenusave" msgid "&Save" msgstr "Desa" #: lazarusidestrconsts.lismenusaveas #, fuzzy #| msgid "Save As ..." msgid "Save &As ..." msgstr "Anomena i desa ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" msgstr "Desa el projecte" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." msgstr "Anomena i desa el projecte ..." #: lazarusidestrconsts.lismenusearch msgid "&Search" msgstr "&Cerca" #: lazarusidestrconsts.lismenuselect msgid "Select" msgstr "Selecciona" #: lazarusidestrconsts.lismenuselectall #, fuzzy #| msgid "Select all" msgctxt "lazarusidestrconsts.lismenuselectall" msgid "Select All" msgstr "Selecciona-ho Tot" #: lazarusidestrconsts.lismenuselectcodeblock #, fuzzy #| msgid "Select code block" msgid "Select Code Block" msgstr "Selecciona el bloc del codi" #: lazarusidestrconsts.lismenuselectline #, fuzzy #| msgid "Select line" msgid "Select Line" msgstr "Selecciona la línia" #: lazarusidestrconsts.lismenuselectparagraph #, fuzzy #| msgid "Select paragraph" msgid "Select Paragraph" msgstr "Selecciona el paràgraf" #: lazarusidestrconsts.lismenuselecttobrace #, fuzzy #| msgid "Select to brace" msgid "Select to Brace" msgstr "Selecciona la tira" #: lazarusidestrconsts.lismenuselectword #, fuzzy #| msgid "Select word" msgid "Select Word" msgstr "Sel·lecciona paraula" #: lazarusidestrconsts.lismenusetfreebookmark #, fuzzy #| msgid "Set a free bookmark" msgctxt "lazarusidestrconsts.lismenusetfreebookmark" msgid "Set a Free Bookmark" msgstr "Estableix un marcador lliure" #: lazarusidestrconsts.lismenushowexecutionpoint msgid "S&how Execution Point" msgstr "" #: lazarusidestrconsts.lismenushowsmarthint msgid "Context sensitive smart hint" msgstr "" #: lazarusidestrconsts.lismenusortselection #, fuzzy #| msgid "Sort selection ..." msgid "Sort Selection ..." msgstr "Ordena la selecció ..." #: lazarusidestrconsts.lismenusource msgid "S&ource" msgstr "" #: lazarusidestrconsts.lismenuswapcaseselection msgid "Swap Case in Selection" msgstr "" #: lazarusidestrconsts.lismenutabstospacesselection #, fuzzy #| msgid "Tabs to spaces in selection" msgid "Tabs to Spaces in Selection" msgstr "Tabuladors a espais en la selecció" #: lazarusidestrconsts.lismenutemplateabout msgctxt "lazarusidestrconsts.lismenutemplateabout" msgid "About" msgstr "Quant a" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle Comment in Selection" msgstr "" #: lazarusidestrconsts.lismenutools msgid "&Tools" msgstr "Eine&s" #: lazarusidestrconsts.lismenuuncommentselection #, fuzzy #| msgid "Uncomment selection" msgid "Uncomment Selection" msgstr "Treu comentari de la selecció" #: lazarusidestrconsts.lismenuunindentselection #, fuzzy #| msgid "Unindent selection" msgid "Unindent Selection" msgstr "Dessagna la selecció" #: lazarusidestrconsts.lismenuuppercaseselection #, fuzzy #| msgid "Uppercase selection" msgid "Uppercase Selection" msgstr "Fica a majúscules la selecció" #: lazarusidestrconsts.lismenuuseunit msgctxt "lazarusidestrconsts.lismenuuseunit" msgid "Add Unit to Uses Section ..." msgstr "" #: lazarusidestrconsts.lismenuview msgid "&View" msgstr "&Visualitza" #: lazarusidestrconsts.lismenuviewanchoreditor #, fuzzy #| msgid "View Anchor Editor" msgid "Anchor Editor" msgstr "Mostra l'editor de les àncores" #: lazarusidestrconsts.lismenuviewcodebrowser msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" msgid "Code Browser" msgstr "" #: lazarusidestrconsts.lismenuviewcodeexplorer msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" msgid "Code Explorer" msgstr "Explorador del codi" #: lazarusidestrconsts.lismenuviewcomponentpalette #, fuzzy #| msgid "View Component Palette" msgid "Component Palette" msgstr "Vore Paleta de Components" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" msgstr "C&omponents" #: lazarusidestrconsts.lismenuviewdebugevents msgctxt "lazarusidestrconsts.lismenuviewdebugevents" msgid "Event Log" msgstr "Bitàcora d'events" #: lazarusidestrconsts.lismenuviewdebugoutput #, fuzzy #| msgid "Debug output" msgid "Debug Output" msgstr "Sortida de depuració" #: lazarusidestrconsts.lismenuviewforms #, fuzzy #| msgid "Forms..." msgid "Forms ..." msgstr "Formes..." #: lazarusidestrconsts.lismenuviewhistory msgctxt "lazarusidestrconsts.lismenuviewhistory" msgid "History" msgstr "" #: lazarusidestrconsts.lismenuviewjumphistory #, fuzzy #| msgid "Jump History ..." msgctxt "lazarusidestrconsts.lismenuviewjumphistory" msgid "Jump History" msgstr "Mostra la història dels salts ..." #: lazarusidestrconsts.lismenuviewlocalvariables msgctxt "lazarusidestrconsts.lismenuviewlocalvariables" msgid "Local Variables" msgstr "Variables Locals" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" msgstr "Missatges" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" msgid "Object Inspector" msgstr "Inspector dels objectes" #: lazarusidestrconsts.lismenuviewprojectsource msgid "&View Project Source" msgstr "" #: lazarusidestrconsts.lismenuviewpseudoterminal msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal" msgid "Console In/Output" msgstr "" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" msgid "Registers" msgstr "" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" msgstr "Cerca els resultats" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" msgid "Source Editor" msgstr "Editor del codi font" #: lazarusidestrconsts.lismenuviewtaborder msgid "Tab Order" msgstr "" #: lazarusidestrconsts.lismenuviewthreads msgctxt "lazarusidestrconsts.lismenuviewthreads" msgid "Threads" msgstr "" #: lazarusidestrconsts.lismenuviewtoggleformunit #, fuzzy #| msgid "Toggle form/unit view" msgid "Toggle Form/Unit View" msgstr "Canvia visió forma/unitat" #: lazarusidestrconsts.lismenuviewunitdependencies #, fuzzy #| msgid "Unit Dependencies ..." msgctxt "lazarusidestrconsts.lismenuviewunitdependencies" msgid "Unit Dependencies" msgstr "Mostra les dependències de les unitats" #: lazarusidestrconsts.lismenuviewunitinfo #, fuzzy #| msgid "Unit Information" msgid "Unit Information ..." msgstr "Mostra la informació de les unitats" #: lazarusidestrconsts.lismenuviewunits #, fuzzy #| msgid "Units..." msgid "Units ..." msgstr "Unitats..." #: lazarusidestrconsts.lismenuviewwatches msgctxt "lazarusidestrconsts.lismenuviewwatches" msgid "Watches" msgstr "Controls" #: lazarusidestrconsts.lismenuwhatneedsbuilding msgid "What Needs Building" msgstr "" #: lazarusidestrconsts.lismenuwindow msgid "&Window" msgstr "" #: lazarusidestrconsts.lismeother #, fuzzy #| msgid "Other" msgctxt "lazarusidestrconsts.lismeother" msgid "Other tabs" msgstr "Altres" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" msgstr "" #: lazarusidestrconsts.lismessageswindow msgid "Messages Window" msgstr "" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" msgstr "" #: lazarusidestrconsts.lismissingdirectory #, object-pascal-format msgid "missing directory \"%s\"" msgstr "" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" msgstr "" #: lazarusidestrconsts.lismissingexecutable #, object-pascal-format msgid "missing executable \"%s\"" msgstr "" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" msgstr "" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" msgstr "Paquets que falten" #: lazarusidestrconsts.lismissingunitschoices msgid "Your choices are:" msgstr "" #: lazarusidestrconsts.lismissingunitscomment msgid "Comment Out" msgstr "" #: lazarusidestrconsts.lismissingunitsfordelphi msgid "For Delphi only" msgstr "" #: lazarusidestrconsts.lismissingunitsinfo1 msgid "1) Comment out the selected units." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo1b msgid "1) Use the units only for Delphi." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo2 msgid "2) Search for units. Found paths are added to project settings." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo3 msgid "3) Leave these units in uses sections as they are." msgstr "" #: lazarusidestrconsts.lismissingunitssearch msgid "Search Unit Path" msgstr "" #: lazarusidestrconsts.lismissingunitsskip msgctxt "lazarusidestrconsts.lismissingunitsskip" msgid "Skip" msgstr "" #: lazarusidestrconsts.lismitnotice msgid "" "\n" "\n" "Copyright (c) \n" "\n" "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" "\n" "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" "\n" "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." msgstr "" #: lazarusidestrconsts.lismmadditionsandoverrides msgid "Additions and Overrides" msgstr "" #: lazarusidestrconsts.lismmaddscustomoptions msgid "Adds custom options:" msgstr "" #: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" msgstr "" #: lazarusidestrconsts.lismmapplytoallpackages msgid "Apply to all packages." msgstr "" #: lazarusidestrconsts.lismmapplytoallpackagesandprojects msgid "Apply to all packages and projects." msgstr "" #: lazarusidestrconsts.lismmapplytoallpackagesmatching #, object-pascal-format msgid "Apply to all packages matching name \"%s\"" msgstr "" #: lazarusidestrconsts.lismmapplytoproject msgid "Apply to project." msgstr "" #: lazarusidestrconsts.lismmcreateanewgroupofoptions msgid "Create a new group of options" msgstr "" #: lazarusidestrconsts.lismmcustomoption msgid "Custom Option" msgstr "" #: lazarusidestrconsts.lismmdeletetheselectedtargetoroption msgid "Delete the selected target or option" msgstr "" #: lazarusidestrconsts.lismmdoesnotaddcustomoptions msgid "Does not add custom options:" msgstr "" #: lazarusidestrconsts.lismmdoesnothaveidemacro #, object-pascal-format msgid "Does not have IDE Macro %s:=%s" msgstr "" #: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu msgid "Does not override OutDir (-FU)" msgstr "" #: lazarusidestrconsts.lismmexcludeallpackagesmatching #, object-pascal-format msgid "Exclude all packages matching name \"%s\"" msgstr "" #: lazarusidestrconsts.lismmexpectedaftermacronamebutfound #, object-pascal-format msgid "expected \":=\" after macro name but found \"%s\"" msgstr "" #: lazarusidestrconsts.lismmexpectedmacronamebutfound #, object-pascal-format msgid "expected macro name but found \"%s\"" msgstr "" #: lazarusidestrconsts.lismmfromto #, object-pascal-format msgid "From %s to %s" msgstr "" #: lazarusidestrconsts.lismmidemacro msgid "IDE Macro" msgstr "" #: lazarusidestrconsts.lismmidemacro2 #, object-pascal-format msgid "IDE Macro %s:=%s" msgstr "" #: lazarusidestrconsts.lismminvalidcharacterat #, object-pascal-format msgid "invalid character \"%s\" at %s" msgstr "" #: lazarusidestrconsts.lismminvalidcharacterinmacrovalue #, object-pascal-format msgid "invalid character in macro value \"%s\"" msgstr "" #: lazarusidestrconsts.lismmmissingmacroname msgid "missing macro name" msgstr "" #: lazarusidestrconsts.lismmmoveselecteditemdown msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown" msgid "Move selected item down" msgstr "" #: lazarusidestrconsts.lismmmoveselecteditemup msgctxt "lazarusidestrconsts.lismmmoveselecteditemup" msgid "Move selected item up" msgstr "" #: lazarusidestrconsts.lismmnewtarget msgid "New Target" msgstr "" #: lazarusidestrconsts.lismmoverrideoutdirfu #, object-pascal-format msgid "Override OutDir (-FU): %s" msgstr "" #: lazarusidestrconsts.lismmoverrideoutputdirectory msgid "Override output directory (-FU)" msgstr "" #: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget msgid "Override output directory -FU of target" msgstr "" #: lazarusidestrconsts.lismmredolastundotothisgrid msgid "Redo last undo to this grid" msgstr "" #: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32 msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32" msgstr "" #: lazarusidestrconsts.lismmsets #, object-pascal-format msgid "Set \"%s\"" msgstr "" #: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml msgid "Stored in IDE (environmentoptions.xml)" msgstr "" #: lazarusidestrconsts.lismmstoredinprojectlpi msgid "Stored in project (.lpi)" msgstr "" #: lazarusidestrconsts.lismmstoredinsessionofprojectlps msgid "Stored in session of project (.lps)" msgstr "" #: lazarusidestrconsts.lismmtargets msgid "Targets: " msgstr "" #: lazarusidestrconsts.lismmundolastchangetothisgrid msgid "Undo last change to this grid" msgstr "" #: lazarusidestrconsts.lismmvalues #, object-pascal-format msgid "Value \"%s\"" msgstr "" #: lazarusidestrconsts.lismmwas #, object-pascal-format msgid "(was \"%s\")" msgstr "" #: lazarusidestrconsts.lismmwidgetsetavailableforlclproject msgid "WidgetSet change is available only for LCL projects" msgstr "" #: lazarusidestrconsts.lismode #, object-pascal-format msgid ", Mode: %s" msgstr "" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" "\n" "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" #: lazarusidestrconsts.lismore msgctxt "lazarusidestrconsts.lismore" msgid "More" msgstr "" #: lazarusidestrconsts.lismoresub msgctxt "lazarusidestrconsts.lismoresub" msgid "More" msgstr "" #: lazarusidestrconsts.lismove msgid "Move" msgstr "" #: lazarusidestrconsts.lismovedown msgid "Move Down" msgstr "" #: lazarusidestrconsts.lismovefiles msgid "Move Files" msgstr "" #: lazarusidestrconsts.lismovefiles2 msgid "Move files?" msgstr "" #: lazarusidestrconsts.lismovefilesfromtothedirectoryof #, object-pascal-format msgid "Move %s file(s) from %s to the directory%s%s%sof %s?" msgstr "" #: lazarusidestrconsts.lismoveonepositiondown #, object-pascal-format msgid "Move \"%s\" one position down" msgstr "" #: lazarusidestrconsts.lismoveonepositionup #, object-pascal-format msgid "Move \"%s\" one position up" msgstr "" #: lazarusidestrconsts.lismoveorcopyfiles msgid "Move or Copy files?" msgstr "" #: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage #, object-pascal-format msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?" msgstr "" #: lazarusidestrconsts.lismovepage msgid "Move Page" msgstr "" #: lazarusidestrconsts.lismoveselecteddown msgid "Move selected item down (Ctrl+Down)" msgstr "" #: lazarusidestrconsts.lismoveselectedup msgid "Move selected item up (Ctrl+Up)" msgstr "" #: lazarusidestrconsts.lismoveto msgid "Move to: " msgstr "" #: lazarusidestrconsts.lismoveup msgid "Move Up" msgstr "" #: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa msgid "Moving these units will break their uses sections. See Messages window for details." msgstr "" #: lazarusidestrconsts.lismpcstyle msgid "C style: \" => \\\"" msgstr "" #: lazarusidestrconsts.lismpescapequotes msgid "Escape "es" msgstr "" #: lazarusidestrconsts.lismpmultipaste msgctxt "lazarusidestrconsts.lismpmultipaste" msgid "MultiPaste" msgstr "" #: lazarusidestrconsts.lismppascalstyle msgid "Pascal style: ' => ''" msgstr "" #: lazarusidestrconsts.lismppasteoptions msgid "Paste &options" msgstr "" #: lazarusidestrconsts.lismppreview msgid "&Preview" msgstr "" #: lazarusidestrconsts.lismptextaftereachline msgid "Text &after each line" msgstr "" #: lazarusidestrconsts.lismptextbeforeeachline msgid "Text &before each line" msgstr "" #: lazarusidestrconsts.lismptrimclipboardcontents msgid "&Trim clipboard contents" msgstr "" #: lazarusidestrconsts.lismsgcolors msgid "Message colors" msgstr "" #: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons msgid "Multiple directories are separated with semicolons" msgstr "" #: lazarusidestrconsts.lismultiplepack msgid ", multiple packages: " msgstr "" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Desa missatges a arxiu (*.txt)" #: lazarusidestrconsts.lisname msgctxt "lazarusidestrconsts.lisname" msgid "Name" msgstr "Nom" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" msgstr "" #: lazarusidestrconsts.lisnameofactivebuildmode msgid "Name of active build mode" msgstr "" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" msgstr "Nom del nou procediment" #: lazarusidestrconsts.lisnew msgctxt "lazarusidestrconsts.lisnew" msgid "New" msgstr "Nou" #: lazarusidestrconsts.lisnewclass msgid "New Class" msgstr "Nova Classe" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" msgstr "" #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype #, object-pascal-format msgid "Create a new editor file.%sChoose a type." msgstr "Crea un nou fitxer d'editor.%sEscolliu-ne un tipus" #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Crea un nou fitxer de text buit." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype #, object-pascal-format msgid "Create a new project.%sChoose a type." msgstr "Crea un nou projecte.%sEscolliu-ne un tipus." #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun #, object-pascal-format msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "Crea un nou paquet normalitzat.%sUn paquet és una col·lecció d'unitats i components." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "Crea una nova unitat amb un mòdul de dades." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame." msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "Crea una nova unitat amb una forma LCL." #: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent msgid "Inherit from a project form or component" msgstr "" #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" msgstr "No hi ha cap element seleccionat" #: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "Si us plau, primer seleccioneu un element." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" msgstr "" #: lazarusidestrconsts.lisnewmacroname #, object-pascal-format msgid "Macro %d" msgstr "" #: lazarusidestrconsts.lisnewmacroname2 msgid "New Macroname" msgstr "" #: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order." msgstr "" #: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last." msgstr "" #: lazarusidestrconsts.lisnewpage msgid "New page" msgstr "" #: lazarusidestrconsts.lisnewproject #, fuzzy #| msgid "%s - (new project)" msgid "(new project)" msgstr "%s - (nou projecte)" #: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved msgid "New recorded macros. Not to be saved" msgstr "" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections" msgstr "" #: lazarusidestrconsts.lisnoautosaveactivedesktop msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually." msgstr "" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" msgstr "" #: lazarusidestrconsts.lisnobuildprofilesselected msgid "No profiles are selected to be built." msgstr "" #: lazarusidestrconsts.lisnochange msgid "No change" msgstr "Cap canvi" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" msgstr "No hi ha codi seleccionat" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "No s'han heretat les opcions del compilador" #: lazarusidestrconsts.lisnofppkgprefix msgid "empty Free Pascal compiler prefix." msgstr "" #: lazarusidestrconsts.lisnohints msgid "no hints" msgstr "" #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" msgstr "" #: lazarusidestrconsts.lisnolfmfile msgid "No LFM file" msgstr "" #: lazarusidestrconsts.lisnomacroselected msgid "No macro selected" msgstr "" #: lazarusidestrconsts.lisnomessageselected msgid "(no message selected)" msgstr "" #: lazarusidestrconsts.lisnoname msgid "noname" msgstr "sense nom" #: lazarusidestrconsts.lisnoneclicktochooseone msgid "none, click to choose one" msgstr "" #: lazarusidestrconsts.lisnoneselected msgid "(None selected)" msgstr "" #: lazarusidestrconsts.lisnonewfilefound msgid "No new file found" msgstr "" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" msgstr "" #: lazarusidestrconsts.lisnopascalfile msgid "No Pascal file" msgstr "" #: lazarusidestrconsts.lisnoprogramfilesfound #, object-pascal-format msgid "No program file \"%s\" found." msgstr "" #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "No s'ha trobat la secció de la cadena del recurs" #: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "" #: lazarusidestrconsts.lisnostringconstantfound msgid "No string constant found" msgstr "No s'ha trobat la constant de cadena" #: lazarusidestrconsts.lisnotadesigntimepackage msgid "Not a designtime package" msgstr "" #: lazarusidestrconsts.lisnotaninstallpackage msgid "Not an install package" msgstr "" #: lazarusidestrconsts.lisnotavalidfppkgprefix msgid "Free Pascal compiler not found at the given prefix." msgstr "" #: lazarusidestrconsts.lisnote msgctxt "lazarusidestrconsts.lisnote" msgid "Note" msgstr "" #: lazarusidestrconsts.lisnotebooktabposbottom msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" msgid "Bottom" msgstr "" #: lazarusidestrconsts.lisnotebooktabposleft msgctxt "lazarusidestrconsts.lisnotebooktabposleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.lisnotebooktabposright msgctxt "lazarusidestrconsts.lisnotebooktabposright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.lisnotebooktabpostop msgctxt "lazarusidestrconsts.lisnotebooktabpostop" msgid "Top" msgstr "" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Free Pascal" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Lazarus" #: lazarusidestrconsts.lisnotemplateselected msgid "no template selected" msgstr "" #: lazarusidestrconsts.lisnothingtodo msgid "Nothing to do" msgstr "" #: lazarusidestrconsts.lisnotinstalled msgid "not installed" msgstr "" #: lazarusidestrconsts.lisnotinstalledpackages msgid "Not installed packages" msgstr "" #: lazarusidestrconsts.lisnotnow msgid "Not now" msgstr "Ara no" #: lazarusidestrconsts.lisnowloadedscheme msgid "Now loaded: " msgstr "" #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" msgstr "Crea un nou projecte" #: lazarusidestrconsts.lisnumberoffilestoconvert #, object-pascal-format msgid "Number of files to convert: %s" msgstr "" #: lazarusidestrconsts.lisobjectinspectorbecomesvisible msgid "Object Inspector becomes visible when components are selected in designer." msgstr "" #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" msgstr "" #: lazarusidestrconsts.lisobjectpath msgid "object path" msgstr "trajectòria dels objectes" #: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab msgid "Switch to Object Inspector Favorites tab" msgstr "" #: lazarusidestrconsts.lisofpackage #, object-pascal-format msgid " of package %s" msgstr "" #: lazarusidestrconsts.lisoftheprojectinspector msgid " of the Project Inspector" msgstr "" #: lazarusidestrconsts.lisoifaddtofavoriteproperties msgid "Add to favorite properties" msgstr "" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty #, object-pascal-format msgid "Choose a base class for the favorite property \"%s\"." msgstr "" #: lazarusidestrconsts.lisoifclassnotfound #, object-pascal-format, fuzzy, badformat #| msgid "Class %s%s%s not found." msgid "Class \"%s\" not found." msgstr "No s'ha trobat la Classe %s%s%S" #: lazarusidestrconsts.lisoifremovefromfavoriteproperties msgid "Remove from favorite properties" msgstr "" #: lazarusidestrconsts.lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "auto intal·la dinàmicament" #: lazarusidestrconsts.lisoipautoinstallstatic msgid "auto install static" msgstr "auto intal·la estàticament" #: lazarusidestrconsts.lisoipdescription msgid "Description: " msgstr "Descripció: " #: lazarusidestrconsts.lisoipdescriptiondescription #, object-pascal-format msgid "%sDescription: %s" msgstr "%sDescripció: %s" #: lazarusidestrconsts.lisoipfilename #, object-pascal-format msgid "Filename: %s" msgstr "Nom del fitxer: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" msgstr "instal·lat dinàmicament" #: lazarusidestrconsts.lisoipinstalledstatic msgid "installed static" msgstr "instal·lat estàticament" #: lazarusidestrconsts.lisoiplicenselicense #, object-pascal-format msgid "%sLicense: %s" msgstr "" #: lazarusidestrconsts.lisoipmissing msgid "missing" msgstr "falta" #: lazarusidestrconsts.lisoipmodified msgid "modified" msgstr "modificat" #: lazarusidestrconsts.lisoipopenloadedpackage #, fuzzy #| msgid "Open loaded package" msgid "Open Loaded Package" msgstr "Obre el paquet carregat" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" msgstr "Nom del paquet" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" msgstr "Si us plau, seleccioneu un paquet" #: lazarusidestrconsts.lisoipreadonly msgid "readonly" msgstr "només de lectura" #: lazarusidestrconsts.lisoipstate msgctxt "lazarusidestrconsts.lisoipstate" msgid "State" msgstr "Estat" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound #, object-pascal-format, fuzzy #| msgid "%sThis package is installed, but the lpk file was not found" msgid "%sThis package is installed but the lpk file was not found" msgstr "%sAquest paquet està intal·lat, però no s'ha trobat el fitxer lpk" #: lazarusidestrconsts.lisoldclass msgid "Old Class" msgstr "" #: lazarusidestrconsts.lisonbreaklineiereturnorenterkey msgid "On break line (i.e. return or enter key)" msgstr "" #: lazarusidestrconsts.lisonlinepackage msgid "available in the main repository" msgstr "" #: lazarusidestrconsts.lisonly32bit msgid "only 32bit" msgstr "" #: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden msgid "Only available on Windows. Run the tool hidden." msgstr "" #: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole msgid "Only available on Windows. Run tool in a new console." msgstr "" #: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression msgid "Only messages fitting this regular expression:" msgstr "" #: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated msgid "Only messages with these FPC IDs (comma separated):" msgstr "" #: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild msgid "Only register the Lazarus package files (.lpk). Do not build." msgstr "" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" msgstr "Cerca només paraules senceres" #: lazarusidestrconsts.lisonpastefromclipboard msgid "On paste from clipboard" msgstr "" #: lazarusidestrconsts.lisopen msgctxt "lazarusidestrconsts.lisopen" msgid "Open" msgstr "Obre" #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" msgstr "Obre com arxiu XML" #: lazarusidestrconsts.lisopendesigneronopenunit msgid "Open designer on open unit" msgstr "" #: lazarusidestrconsts.lisopendesigneronopenunithint msgid "Form is loaded in designer always when source unit is opened." msgstr "" #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" msgstr "" #: lazarusidestrconsts.lisopenfile #, fuzzy #| msgid "Open file" msgctxt "lazarusidestrconsts.lisopenfile" msgid "Open File" msgstr "Obre el fitxer" #: lazarusidestrconsts.lisopenfile2 #, fuzzy #| msgid "Open file" msgctxt "lazarusidestrconsts.lisopenfile2" msgid "Open file" msgstr "Obre el fitxer" #: lazarusidestrconsts.lisopenfileatcursor msgid "Open file at cursor" msgstr "" #: lazarusidestrconsts.lisopeninfileman msgid "Open in file manager" msgstr "" #: lazarusidestrconsts.lisopeninfilemanhint msgid "Open destination directory in file manager" msgstr "" #: lazarusidestrconsts.lisopenlfm #, object-pascal-format msgid "Open %s" msgstr "Obre %s" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" msgstr "Voleu obrir el paquet?" #: lazarusidestrconsts.lisopenpackage2 #, object-pascal-format msgid "Open package %s" msgstr "" #: lazarusidestrconsts.lisopenpackage3 msgid "Open Package" msgstr "" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" msgstr "Obre fitxer del paquet" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" msgstr "Voleu obrir el projecte?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" msgstr "Obre projecte" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" msgstr "Opre projecte de nou" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" msgstr "Obre el fitxer de projecte" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "" #: lazarusidestrconsts.lisopenthepackage #, object-pascal-format msgid "Open the package %s?" msgstr "Obrir el paquet %s?" #: lazarusidestrconsts.lisopentheproject #, object-pascal-format msgid "Open the project %s?" msgstr "Obrir el projecte %s?" #: lazarusidestrconsts.lisopentooloptions msgid "Open Tool Options" msgstr "" #: lazarusidestrconsts.lisopenunit msgid "Open Unit" msgstr "" #: lazarusidestrconsts.lisopenurl msgid "Open URL" msgstr "" #: lazarusidestrconsts.lisopenxml msgid "Open XML" msgstr "" #: lazarusidestrconsts.lisoptions #, fuzzy msgctxt "lazarusidestrconsts.lisoptions" msgid "Options" msgstr "Opcions" #: lazarusidestrconsts.lisoptionvalueignored msgid "ignored" msgstr "" #: lazarusidestrconsts.lisos #, object-pascal-format msgid ", OS: %s" msgstr "" #: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa #, object-pascal-format msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path." msgstr "" #: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource #, object-pascal-format msgid "output directory of %s contains Pascal unit source \"%s\"" msgstr "" #: lazarusidestrconsts.lisoutputfilenameofproject msgid "Output filename of project" msgstr "" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"." msgstr "" #: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype msgid "Override function result string types with the first parameter expression type" msgstr "" #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectbuildmode msgid "Override the project or IDE build mode." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 #, object-pascal-format msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau #, object-pascal-format msgid "Override the project operating system. For example: win32 linux. Default: %s." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectsubtarg msgid "Override the project subtarget." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond #, object-pascal-format msgid "Override the project widgetset. For example: gtk gtk2 qt win32 carbon. Default: %s." msgstr "" #: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot msgid "'Owner' is already used by TReader/TWriter. Please choose another name." msgstr "" #: lazarusidestrconsts.lispackage msgid "Package" msgstr "Paquet" #: lazarusidestrconsts.lispackage2 #, object-pascal-format msgid "package %s" msgstr "" #: lazarusidestrconsts.lispackage3 #, object-pascal-format msgid ", package %s" msgstr "" #: lazarusidestrconsts.lispackageinfo #, fuzzy #| msgid "Package Info" msgid "Package info" msgstr "Informació del Paquet" #: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint #, object-pascal-format msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages." msgstr "" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." msgstr "" #: lazarusidestrconsts.lispackagenamecontains msgid "Package name contains ..." msgstr "" #: lazarusidestrconsts.lispackageneedsanoutputdirectory msgid "Package needs an output directory." msgstr "" #: lazarusidestrconsts.lispackageneedsinstallation msgid "Package needs installation" msgstr "S'ha d'instal·lar el paquet" #: lazarusidestrconsts.lispackageoption #, object-pascal-format msgid "Package \"%s\" Option" msgstr "" #: lazarusidestrconsts.lispackageoutputdirectories msgid "Package output directories" msgstr "" #: lazarusidestrconsts.lispackagesourcedirectories msgid "Package source directories" msgstr "" #: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes #, object-pascal-format msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s" msgstr "" #: lazarusidestrconsts.lispackageunit msgid "package unit" msgstr "" #: lazarusidestrconsts.lispage msgctxt "lazarusidestrconsts.lispage" msgid "Page" msgstr "" #: lazarusidestrconsts.lispagename msgid "Page name" msgstr "" #: lazarusidestrconsts.lispagenamealreadyexists #, object-pascal-format msgid "Page name \"%s\" already exists. Not added." msgstr "" #: lazarusidestrconsts.lispanic msgctxt "lazarusidestrconsts.lispanic" msgid "Panic" msgstr "" #: lazarusidestrconsts.lisparsed msgid ", parsed " msgstr "" #: lazarusidestrconsts.lisparser #, object-pascal-format msgid "parser \"%s\": %s" msgstr "" #: lazarusidestrconsts.lisparsers msgid "Parsers:" msgstr "" #: lazarusidestrconsts.lispassingquiettwotimeswillp msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler." msgstr "" #: lazarusidestrconsts.lispasteclipboard msgid "paste clipboard" msgstr "" #: lazarusidestrconsts.lispastefromclipboard msgctxt "lazarusidestrconsts.lispastefromclipboard" msgid "Paste from clipboard." msgstr "" #: lazarusidestrconsts.lispastelcolors msgid "Pastel Colors" msgstr "" #: lazarusidestrconsts.lispath msgid "Path" msgstr "" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" msgid "Browse" msgstr "Navega" #: lazarusidestrconsts.lispatheditdeleteinvalidpaths msgid "Delete Invalid Paths" msgstr "" #: lazarusidestrconsts.lispatheditmovepathdown #, fuzzy #| msgid "Move path down" msgid "Move path down (Ctrl+Down)" msgstr "Mou la trajectòria avall" #: lazarusidestrconsts.lispatheditmovepathup #, fuzzy #| msgid "Move path up" msgid "Move path up (Ctrl+Up)" msgstr "Mou la trajectòria amunt" #: lazarusidestrconsts.lispatheditoraddhint msgid "Add new path to the list" msgstr "" #: lazarusidestrconsts.lispatheditordeletehint msgid "Delete the selected path" msgstr "" #: lazarusidestrconsts.lispatheditordeleteinvalidhint msgid "Remove non-existent (gray) paths from the list" msgstr "" #: lazarusidestrconsts.lispatheditorreplacehint msgid "Replace the selected path with a new path" msgstr "" #: lazarusidestrconsts.lispatheditortempladdhint msgid "Add template to the list" msgstr "" #: lazarusidestrconsts.lispatheditpathtemplates msgid "Path templates" msgstr "Plantilles de la trajectòria" #: lazarusidestrconsts.lispatheditsearchpaths msgid "Search paths:" msgstr "Trajectòries de recerca:" #: lazarusidestrconsts.lispathisnodirectory msgid "is not a directory" msgstr "" #: lazarusidestrconsts.lispathoftheinstantfpccache msgid "path of the instantfpc cache" msgstr "" #: lazarusidestrconsts.lispathofthemakeutility msgid "Path of the make utility" msgstr "" #: lazarusidestrconsts.lispathtoinstance msgid "Path to failed Instance:" msgstr "" #: lazarusidestrconsts.lispause msgctxt "lazarusidestrconsts.lispause" msgid "Pause" msgstr "Pausa" #: lazarusidestrconsts.lispckcleartousethepackagename msgid "Clear to use the package name" msgstr "" #: lazarusidestrconsts.lispckdisablei18noflfm msgid "Disable I18N of lfm" msgstr "" #: lazarusidestrconsts.lispckeditaddfilesfromfilesystem msgid "Add Files from File System" msgstr "" #: lazarusidestrconsts.lispckeditaddtoproject #, fuzzy #| msgid "Add to project" msgctxt "lazarusidestrconsts.lispckeditaddtoproject" msgid "Add to Project" msgstr "Afegeix al projecte" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" msgstr "Aplica els canvis" #: lazarusidestrconsts.lispckeditavailableonline msgid "(available online)" msgstr "" #: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit #, object-pascal-format msgid "Call %sRegister%s procedure of selected unit" msgstr "Crida %sRegistre%s procediment de l'unitat seleccionada" #: lazarusidestrconsts.lispckeditcheckavailabilityonline msgid "Check availability online" msgstr "" #: lazarusidestrconsts.lispckeditcleanupdependencies msgid "Clean up dependencies ..." msgstr "" #: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency msgid "Clear default/preferred filename of dependency" msgstr "" #: lazarusidestrconsts.lispckeditcommonoptions msgid "Common" msgstr "" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" msgstr "Voleu compilar-ho tot?" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" msgstr "Compila el paquet" #: lazarusidestrconsts.lispckeditcreatefpmakefile msgid "Create fpmake.pp" msgstr "" #: lazarusidestrconsts.lispckeditcreatemakefile msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" msgid "Create Makefile" msgstr "Crea Makefile" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" msgstr "" #: lazarusidestrconsts.lispckediteditgeneraloptions #, fuzzy #| msgid "Edit General Options" msgid "Edit general options" msgstr "Edita les opcions generals" #: lazarusidestrconsts.lispckeditfileproperties msgid "File Properties" msgstr "Propietats del fitxer" #: lazarusidestrconsts.lispckeditinstall msgid "Install" msgstr "Instal·la" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "la versió màxima no és vàlida" #: lazarusidestrconsts.lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "La versió mínima no és vàlida" #: lazarusidestrconsts.lispckeditmaximumversion msgid "Maximum Version:" msgstr "Número màxim de versió:" #: lazarusidestrconsts.lispckeditminimumversion msgid "Minimum Version:" msgstr "Número mínim de la versió:" #: lazarusidestrconsts.lispckeditmodified #, object-pascal-format msgid "Modified: %s" msgstr "Modificat: %s" #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" msgstr "Mou la dependènncia avall" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" msgstr "Mou la dependència amunt" #: lazarusidestrconsts.lispckeditoptionsforpackage #, object-pascal-format msgid "Options for Package %s" msgstr "" #: lazarusidestrconsts.lispckeditpackage #, object-pascal-format msgid "Package %s" msgstr "Paquet %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage #, object-pascal-format, fuzzy, badformat #| msgid "Package %s%s%s has changed.%sSave package?" msgid "Package \"%s\" has changed.%sSave package?" msgstr "El paquet %s%s%s ha canviat.%sEl voleu desar?" #: lazarusidestrconsts.lispckeditpackagenotsaved #, object-pascal-format msgid "package %s not saved" msgstr "no s'ha desat el paquet %s" #: lazarusidestrconsts.lispckeditpage #, object-pascal-format msgid "%s, Page: %s" msgstr "%s, Pàgina: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" msgstr "Torna a afegir la dependència" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" msgstr "Torna a afegir el fitxer" #: lazarusidestrconsts.lispckeditreadonly #, object-pascal-format msgid "Read Only: %s" msgstr "Només de lectura: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired #, fuzzy #| msgid "Recompile all required" msgid "Recompile All Required" msgstr "S'ha de tornar a compilar tot" #: lazarusidestrconsts.lispckeditrecompileclean #, fuzzy #| msgid "Recompile clean" msgid "Recompile Clean" msgstr "Torna a compilar en net" #: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "Voleu tornar a compilar aquest i tots el paquets requerits?" #: lazarusidestrconsts.lispckeditregisteredplugins msgid "Registered plugins" msgstr "Connectors registrats" #: lazarusidestrconsts.lispckeditregisterunit msgid "Register unit" msgstr "Registra la unitat" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" msgstr "Elimina la dependència" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage #, object-pascal-format, fuzzy, badformat #| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" msgstr "Voleu eliminar la dependència %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts.lispckeditremovedfiles msgid "Removed Files" msgstr "" #: lazarusidestrconsts.lispckeditremovedrequiredpackages msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages" msgid "Removed required packages" msgstr "S'han eliminat els paquets requerits" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" msgstr "Elimina el fitxer" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" msgstr "Voleu eliminar el fitxer?" #: lazarusidestrconsts.lispckeditremovefilefrompackage #, object-pascal-format, fuzzy, badformat #| msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgid "Remove file \"%s\"%sfrom package \"%s\"?" msgstr "Voleu eliminar el fitxer %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" msgstr "Elimina l'element seleccionat" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" msgstr "Paquets requerits" #: lazarusidestrconsts.lispckeditsavepackage #, fuzzy #| msgid "Save package" msgid "Save Package" msgstr "Desa el paquet" #: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency msgid "Store file name as default for this dependency" msgstr "" #: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency msgid "Store file name as preferred for this dependency" msgstr "" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion #, object-pascal-format, fuzzy, badformat #| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" msgstr "La versió màxima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion #, object-pascal-format, fuzzy, badformat #| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" msgstr "La versió mínima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" msgstr "Desinstal·la" #: lazarusidestrconsts.lispckeditviewpackagesource msgctxt "lazarusidestrconsts.lispckeditviewpackagesource" msgid "View Package Source" msgstr "Mostra les fonts dels paquets" #: lazarusidestrconsts.lispckexplbase msgid "Base, cannot be uninstalled" msgstr "" #: lazarusidestrconsts.lispckexplinstalled msgctxt "lazarusidestrconsts.lispckexplinstalled" msgid "Installed" msgstr "Instal·lat" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" msgstr "Instal·la en el proper inici" #: lazarusidestrconsts.lispckexplstate #, object-pascal-format msgid "%sState: " msgstr "%sEstat: " #: lazarusidestrconsts.lispckexpluninstallonnextstart #, fuzzy #| msgid "Uninstall on next start" msgid "Uninstall on next start (unless needed by an installed package)" msgstr "Desinstal·la en el proper inici" #: lazarusidestrconsts.lispckexpluninstallpackage #, object-pascal-format msgctxt "lazarusidestrconsts.lispckexpluninstallpackage" msgid "Uninstall package %s" msgstr "" #: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Afegeix les opcions en els paquets i projectes dependents" #: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Afegeix les trajectòries en els paquets/projectes dependents" #: lazarusidestrconsts.lispckoptsauthor #, fuzzy #| msgid "Author:" msgid "Author" msgstr "Autor" #: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Munta de nou automàticament quan es necessiti" #: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Munta de nou automàticament quan es munti tot" #: lazarusidestrconsts.lispckoptscustom msgid "Custom" msgstr "Personalitzat" #: lazarusidestrconsts.lispckoptsdescriptionabstract #, fuzzy #| msgid "Description/Abstract" msgid "Description / Abstract" msgstr "Descripció/Abstracte" #: lazarusidestrconsts.lispckoptsdesigntime msgid "Designtime" msgstr "" #: lazarusidestrconsts.lispckoptsdesigntimeandruntime #, fuzzy #| msgid "Designtime and Runtime" msgid "Designtime and runtime" msgstr "Temps de disseny i temp d'execució" #: lazarusidestrconsts.lispckoptsideintegration msgid "IDE Integration" msgstr "Integració IDE" #: lazarusidestrconsts.lispckoptsinclude msgid "Include" msgstr "Inclou" #: lazarusidestrconsts.lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "El tipus del paquet no és vàlid" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" msgstr "Biblioteca" #: lazarusidestrconsts.lispckoptslicense #, fuzzy #| msgid "License:" msgid "License" msgstr "llicència:" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" msgstr "Enllaçador" #: lazarusidestrconsts.lispckoptsmajor msgid "Major" msgstr "Major" #: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "Compilació manual (mai automàticament)" #: lazarusidestrconsts.lispckoptsminor msgid "Minor" msgstr "Menor" #: lazarusidestrconsts.lispckoptsobject msgid "Object" msgstr "Objecte" #: lazarusidestrconsts.lispckoptspackagetype #, fuzzy #| msgid "PackageType" msgid "Package type" msgstr "Tipus de paquet" #: lazarusidestrconsts.lispckoptsprovides msgid "Provides" msgstr "" #: lazarusidestrconsts.lispckoptsrelease msgid "Release" msgstr "Llença" #: lazarusidestrconsts.lispckoptsruntime msgid "Runtime" msgstr "" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans #, object-pascal-format, fuzzy, badformat #| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." msgstr "El paquet %s%s%s té el senyalador d'auto-intal·lar.%sAixò vol dir que s'instal·larà a l'IDE. Els paquets d'intal·lació%shan de ser paquets de temps de disseny." #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "" #: lazarusidestrconsts.lispckoptsupdaterebuild #, fuzzy #| msgid "Update/Rebuild" msgid "Update / Rebuild" msgstr "Actualitza/Munta de nou" #: lazarusidestrconsts.lispckoptsusage msgid "Usage" msgstr "Utilització" #: lazarusidestrconsts.lispckpackage msgid "Package:" msgstr "" #: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon." msgstr "" #: lazarusidestrconsts.lispckshowunneededdependencies msgid "Show unneeded dependencies" msgstr "" #: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked." msgstr "" #: lazarusidestrconsts.lispdabort msgctxt "lazarusidestrconsts.lispdabort" msgid "Abort" msgstr "Avortar" #: lazarusidestrconsts.lispdprogress msgid "Progress" msgstr "Progrés" #: lazarusidestrconsts.lispecollapsedirectory msgid "Collapse directory" msgstr "" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" msgstr "" #: lazarusidestrconsts.lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "" #: lazarusidestrconsts.lispeexpanddirectory msgid "Expand directory" msgstr "" #: lazarusidestrconsts.lispefilename msgid "Filename:" msgstr "Nom d'arxiu:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" msgstr "" #: lazarusidestrconsts.lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Nom d'arxiu per l'unitat no vàlid" #: lazarusidestrconsts.lispeinvalidunitname msgid "Invalid unitname" msgstr "Nom d'unitat no vàlida" #: lazarusidestrconsts.lispemissingfilesofpackage #, object-pascal-format msgid "Missing files of package %s" msgstr "" #: lazarusidestrconsts.lispenewfilenotinincludepath msgid "New file not in include path" msgstr "" #: lazarusidestrconsts.lispenofilesmissingallfilesexist msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist" msgid "No files missing. All files exist." msgstr "" #: lazarusidestrconsts.lisperemovefiles msgid "Remove files" msgstr "" #: lazarusidestrconsts.lisperevertpackage msgid "Revert Package" msgstr "" #: lazarusidestrconsts.lispesavepackageas msgid "Save Package As ..." msgstr "" #: lazarusidestrconsts.lispeshowdirectoryhierarchy msgid "Show directory hierarchy" msgstr "" #: lazarusidestrconsts.lispeshowmissingfiles msgid "Show Missing Files" msgstr "" #: lazarusidestrconsts.lispesortfiles msgid "Sort Files Permanently" msgstr "" #: lazarusidestrconsts.lispesortfilesalphabetically msgid "Sort files alphabetically" msgstr "" #: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea #, object-pascal-format msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" msgstr "" #: lazarusidestrconsts.lispeunitname msgid "Unitname:" msgstr "Nom d'unitat:" #: lazarusidestrconsts.lispeuseallunitsindirectory msgid "Use all units in directory" msgstr "" #: lazarusidestrconsts.lispeusenounitsindirectory msgid "Use no units in directory" msgstr "" #: lazarusidestrconsts.lispkgcleanuppackagedependencies msgid "Clean up package dependencies" msgstr "" #: lazarusidestrconsts.lispkgclearselection msgid "Clear Selection" msgstr "" #: lazarusidestrconsts.lispkgdeletedependencies msgid "Delete dependencies" msgstr "" #: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand #, object-pascal-format msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Voleu obviar tots els canvis del paquet %s i recarregar-lo del fitxer?" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "La nova unitat no és a la trajectòria de les unitats" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" msgstr "Publica el paquet" #: lazarusidestrconsts.lispkgeditrevertpackage msgid "Revert package?" msgstr "Voleu revertir el paquet?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?" msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?" msgstr "El fitxer %s%s%s%sja no és a la trajectòria d'unitats del paquet.%s%sVoleu afegir %s%s%s a la trajectòria de les unitats? " #: lazarusidestrconsts.lispkgedmorefunctionsforthepackage msgid "More functions for the package" msgstr "" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage #, object-pascal-format, fuzzy, badformat #| msgid "%sAdding new Dependency for package %s: package %s%s" msgid "%sAdding new Dependency for package %s: package %s" msgstr "%sS'està afegint nova dependència pel paquet %s: paquet %s%s" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage #, object-pascal-format, fuzzy, badformat #| msgid "%sAdding new Dependency for project %s: package %s%s" msgid "%sAdding new Dependency for project %s: package %s" msgstr "%sS'està afegint nova dependència pel projecte %s: paquet %s%s" #: lazarusidestrconsts.lispkgmangaddunittousesclause msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." msgstr "" #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "" #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Paquets instal·lats automàticament" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu #, object-pascal-format msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sAmbdós paquets estan connectats. Això vol dir, o que un paquet utilitza l'altre o que un tercer els utilitza tots dos." #: lazarusidestrconsts.lispkgmangbrokendependency msgid "Broken dependency" msgstr "Dependència Interrompuda" #: lazarusidestrconsts.lispkgmangcirculardependencies msgid "Circular dependencies found" msgstr "" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Voleu eliminar el fitxer de paquet antic?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 #, object-pascal-format, fuzzy, badformat #| msgid "Delete old package file %s%s%s?" msgid "Delete old package file \"%s\"?" msgstr "Voleu eliminar el fitxer de paquet antic %s%s%s?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner #, object-pascal-format msgid "Dependency without Owner: %s" msgstr "Dependència sense propietari: %s" #: lazarusidestrconsts.lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "S'ha produït un error mentre es llegia el paquet" #: lazarusidestrconsts.lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "S'ha produït un error mentre s'escrivia el paquet" #: lazarusidestrconsts.lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "El fitxer ja és al paquet" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" msgstr "El fitxer forma part del projecte" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "El nom del fitxer és diferent del nom del paquet" #: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "El nom del fitxer està essent utilitzat per un altre paquet" #: lazarusidestrconsts.lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "El nom del fitxer està essent utilitzat pel projecte" #: lazarusidestrconsts.lispkgmangfilenotfound #, object-pascal-format, fuzzy, badformat #| msgid "File %s%s%s not found." msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" msgid "File \"%s\" not found." msgstr "No s'ha trobat el fitxer %s%s%s." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" msgstr "No s'ha desat el fitxer" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac #, object-pascal-format msgid "Installing the package %s will automatically install the package:" msgstr "L'instal·lació del paquet %s instal·larà automàticament el paquet:" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 #, object-pascal-format msgid "Installing the package %s will automatically install the packages:" msgstr "L'instal·lació del paquet %s instal·larà automàticament els paquets:" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "L'extensió del fitxer no és vàlida" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "L'extensió del paquet no és vàlida" #: lazarusidestrconsts.lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "El nom del fitxer del paquet no és vàlid" #: lazarusidestrconsts.lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "El nom del paquet no és vàlid" #: lazarusidestrconsts.lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "El nom del paquet no és vàlid" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage #, object-pascal-format, fuzzy, badformat #| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" msgstr "Carrega el paquet %s reemplaçarà el paquet %s%sdel fitxer %s.%sEl paquet antic està modificat.%s%sVoleu desar el paquet antic %s?" #: lazarusidestrconsts.lispkgmangpackage #, object-pascal-format msgid "Package: %s" msgstr "Paquet: %s" #: lazarusidestrconsts.lispkgmangpackageconflicts msgid "Package conflicts" msgstr "Conflicte de paquets" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage #, fuzzy #| msgid "Package is no designtime package" msgid "Package is not a designtime package" msgstr "El paquet no és un paquet de temps de disseny" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" msgstr "Es requereix el paquet" #: lazarusidestrconsts.lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "Ja existeix el nom del paquet" #: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "Els paquets han de tenir l'extensió .lpk" #: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst msgid "Please compile the package first." msgstr "" #: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "Si us plau, deseu el fitxer abans d'afegir-lo a un paquet." #: lazarusidestrconsts.lispkgmangproject #, object-pascal-format msgid "Project: %s" msgstr "Projecte: %s" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Voleu tornar a muntar el Lazarus?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts.lispkgmangreplaceexistingfile #, object-pascal-format, fuzzy, badformat #| msgid "Replace existing file %s%s%s?" msgid "Replace existing file \"%s\"?" msgstr "Voleu substituir el fitxer existent %s%s%s?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" msgstr "Substitueix el fitxer" #: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound msgid "One or more required packages were not found. See package graph for details." msgstr "" #: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage #, object-pascal-format msgid "" "The package %s is already open in the IDE.\n" "You cannot save a package with the same name." msgstr "" #: lazarusidestrconsts.lispkgmangsavepackage #, fuzzy #| msgid "Save Package?" msgid "Save package?" msgstr "Voleu desar el paquet?" #: lazarusidestrconsts.lispkgmangsavepackagelpk #, object-pascal-format msgid "Save Package %s (*.lpk)" msgstr "Desa el paquet %s (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto #, object-pascal-format, fuzzy, badformat #| msgid "Should the file be renamed lowercase to%s%s%s%s?" msgid "Should the file be renamed lowercase to%s\"%s\"?" msgstr "Voleu canviar a minúscules el nom del fitxer a%s%s%s%s?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" msgstr "" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s%sis already in the package %s." msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" msgid "The file \"%s\"%sis already in the package %s." msgstr "El fitxer %s%s%s%sja és al paquet %s." #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s is not a Lazarus package." msgid "The file \"%s\" is not a Lazarus package." msgstr "El fitxer %s%s%s no és un paquet Lazarus." #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage #, object-pascal-format, fuzzy, badformat #| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" msgstr "El nom de fitxer %s%s%s no correspon al nom del paquet %s%s%s en el fitxer. %sVoleu canviar nom del paquet a %s%s%s?" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject #, object-pascal-format, fuzzy, badformat #| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no han de compartir fitxers." #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile #, object-pascal-format, fuzzy, badformat #| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." msgstr "El nom de fitxer %s%s%s està essent utilitzat pel%s paquet %s%s%s%s en el fitxer %s%s%s." #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "Ha fallat la carrega del següent paquet:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "Ha fallat la carrega dels següents paquets:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof #, object-pascal-format, fuzzy, badformat #| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgid "%sThe following units will be added to the uses section of%s%s:%s%s" msgstr "%sLes següents unitats s'afegiran a la secció USES de%s%s:%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename #, object-pascal-format, fuzzy, badformat #| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name." msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." msgstr "El nom de fitxer de paquet %s%s%s en %s%s%s no és un nom de paquet Lazarus vàlid." #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages #, object-pascal-format, fuzzy #| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." msgstr "El paquet %s és només un paquet de temps d'execució.%sAquests tipus de paquets no poden ser instal·lats a l'IDE." #: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec #, object-pascal-format msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound #, object-pascal-format, fuzzy, badformat #| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?" msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?" msgstr "No s'ha pogut trobar el paquet marcat per instal·lar %s%s%s.%sVoleu eliminar la dependència de la llista de paquets de la instal·lació?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation #, object-pascal-format, fuzzy #| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgid "The package %s is required by %s which is marked for installation.%sSee package graph." msgstr "El paquet %s el requereix %s, el qual està marcat per instal·lar.%sMireu la gràfica del paquet." #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean #, object-pascal-format, fuzzy, badformat #| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "El nom de paquet %s%s%s no és un nom de paquet vàlid%sSi us plau, escolliu-ne un altre (p.ex. paquet1.lpk)" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid #, object-pascal-format, fuzzy, badformat #| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." msgstr "El nom del paquet %s%s%s del%sfitxer %s%s%s no és vàlid." #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus #, object-pascal-format, fuzzy, badformat #| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" msgstr "S'ha marcat el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La des-instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus #, object-pascal-format, fuzzy, badformat #| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" msgstr "S'ha marcat per instal·lar el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound #, object-pascal-format, fuzzy, badformat #| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." msgstr "El projecte requereix el paquet %s%s%s.%sPerò no s'ha trobat. Mireu Projecte -> Inspector del Projecte." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from #, object-pascal-format, fuzzy, badformat #| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" msgstr "Hi ha dues unitats amb el mateix nom:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s" #: lazarusidestrconsts.lispkgmangthereisacirculardependency msgid "There is a circular dependency in the packages. See package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage #, object-pascal-format, fuzzy, badformat #| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgid "There is a FPC unit with the same name as a package:%s\"%s\"" msgstr "Hi ha una unitat FPC amb el mateix nom que un paquet:%s%s%s%s%s%s" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom #, object-pascal-format, fuzzy, badformat #| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" msgstr "Hi ha una unitat FPC amb el mateix nom que:%s%s%s%s%s de %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename #, object-pascal-format, fuzzy, badformat #| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" msgstr "Ja hi ha un altre paquet amb el nom %s%s%s.%sPaquet amb conficte: %s%s%s%sFitxer: %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile #, object-pascal-format, fuzzy, badformat #| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible." msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMireu Components -> Gràfica dels paquets.%sNo es pot reemplaçar." #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "Hi ha un paquet no desat en els paquets requerits. Mireu la gràfica dels paquets." #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 #, object-pascal-format, fuzzy, badformat #| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" msgstr "Hi ha una unitat amb el mateix nom que un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus #, object-pascal-format, fuzzy, badformat #| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages." msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." msgstr "No es pot crear el directori destinació del Lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els vostres paquets personalitzats." #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror #, object-pascal-format, fuzzy, badformat #| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" msgstr "No es pot escriure el paquet %s%s%s%sal fitxer %s%s%s.%sError: %s" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Voleu desinstal·lar el paquet?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 #, object-pascal-format msgid "Uninstall package %s?" msgstr "Voleu desinstal·lar el paquet %s?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" msgstr "No s'ha desat el paquet" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" msgstr "Utilitza Unitat" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject #, object-pascal-format, fuzzy, badformat #| msgid "Warning: The file %s%s%s%sbelongs to the current project." msgid "Warning: The file \"%s\"%sbelongs to the current project." msgstr "Avís: El fitxer %s%s%s%spertany al projecte actual." #: lazarusidestrconsts.lispkgmgrkeep msgctxt "lazarusidestrconsts.lispkgmgrkeep" msgid "keep" msgstr "" #: lazarusidestrconsts.lispkgmgrnew msgctxt "lazarusidestrconsts.lispkgmgrnew" msgid "new" msgstr "" #: lazarusidestrconsts.lispkgmgrremove msgctxt "lazarusidestrconsts.lispkgmgrremove" msgid "remove" msgstr "" #: lazarusidestrconsts.lispkgselectapackage msgid "Select a package" msgstr "" #: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies." msgstr "" #: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin #, object-pascal-format msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s" msgstr "" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "Aquest fitxer no és cap paquet carregat." #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror #, object-pascal-format msgid "Unable to read package file \"%s\".%sError: %s" msgstr "" #: lazarusidestrconsts.lisplay msgid "Play" msgstr "" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" msgid "Global" msgstr "" #: lazarusidestrconsts.lispldonline msgid "Online" msgstr "" #: lazarusidestrconsts.lispldonlinepackagescannotbedeleted msgid "Online packages cannot be deleted" msgstr "" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" msgstr "" #: lazarusidestrconsts.lispldshowgloballinksin msgid "Show global links in " msgstr "" #: lazarusidestrconsts.lispldshowonlinelinks msgid "Show online links" msgstr "" #: lazarusidestrconsts.lispldshowuserlinksin msgid "Show user links in " msgstr "" #: lazarusidestrconsts.lispldsomepackagescannotbedeleted msgid "Some packages cannot be deleted" msgstr "" #: lazarusidestrconsts.lisplduser msgid "User" msgstr "" #: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow msgid "Please fix the error shown in the message window which is normally below the source editor." msgstr "" #: lazarusidestrconsts.lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "Si us plau, obriu una unitat abans d'executar." #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "Si us plau, seleccioneu el codi per extraure'n un nou procediment/mètode." #: lazarusidestrconsts.lisplistall msgctxt "lazarusidestrconsts.lisplistall" msgid "" msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" msgstr "Canvia Font" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" msgstr "Flitra fent coincidir qualsevol part del mètode" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" msgstr "Filtra fent coincidir el principi del mètode" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" msgstr "Ves a la sel·lecció" #: lazarusidestrconsts.lisplistnone msgid "" msgstr "" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" msgstr "&Objectes" #: lazarusidestrconsts.lisplistprocedurelist msgid "Procedure List" msgstr "" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" msgid "Type" msgstr "Tipus" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "No desis cap informació de la sessió" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in .lps file in IDE config directory" msgstr "" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" msgstr "Desa en arxiu .lpi" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" msgstr "" #: lazarusidestrconsts.lisposavesessioninformationinhint msgid ".lpi is the project main info file, .lps is a separate file for session data only." msgstr "" #: lazarusidestrconsts.lisposition msgid "Position" msgstr "" #: lazarusidestrconsts.lispositionoutsideofsource #, object-pascal-format msgid "%s (position outside of source)" msgstr "" #: lazarusidestrconsts.lisppuinwrongdirectory #, object-pascal-format msgid "ppu in wrong directory=%s." msgstr "" #: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg #, object-pascal-format msgid "%s.ppu not found. Check your fpc.cfg." msgstr "" #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" msgstr "" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig #, object-pascal-format msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"." msgstr "" #: lazarusidestrconsts.lisprimaryconfigpath msgid "Primary config path" msgstr "" #: lazarusidestrconsts.lisprior #, object-pascal-format msgid "prior %s" msgstr "" #: lazarusidestrconsts.lispriority msgctxt "lazarusidestrconsts.lispriority" msgid "Priority" msgstr "" #: lazarusidestrconsts.lisprivate msgid "Private" msgstr "" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" msgstr "Mètode privat" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti #, object-pascal-format msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first." msgstr "" #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" msgid "Procedure" msgstr "Procediment" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" msgstr "Procediment amb interfície" #: lazarusidestrconsts.lisprogram msgctxt "lazarusidestrconsts.lisprogram" msgid "Program" msgstr "programa" #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" msgstr "S'ha detectat el programa" #: lazarusidestrconsts.lisprogramprogramdescriptor msgid "A Free Pascal command line program with some useful settings added." msgstr "" #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp #, fuzzy #| msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgid "Program source must have a Pascal extension like .pas, .pp or .lpr" msgstr "El codi font del programa ha de tenir una extensió pascal com .pas, .pp o .lpr" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Ja existeix la dependència" #: lazarusidestrconsts.lisprojaddeditorfile #, fuzzy #| msgid "Add editor files" msgid "Add Editor Files" msgstr "Afegeix els fitxers de l'editor" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "La versió min/max no és vàlida" #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" msgstr "la versió no és vàlida" #: lazarusidestrconsts.lisprojaddlocalpkg #, object-pascal-format msgid "Local (%s)" msgstr "" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "Número de versió màxim (opcional):" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Número mínim de la versió (opcional):" #: lazarusidestrconsts.lisprojaddnewfpmakerequirement msgid "New FPMake Requirement" msgstr "" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" msgstr "Nou requeriment" #: lazarusidestrconsts.lisprojaddonlinepkg #, object-pascal-format msgid "Online (%s)" msgstr "" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" msgstr "Nom del paquet:" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" msgstr "No s'ha trobat el paquet" #: lazarusidestrconsts.lisprojaddpackagetype msgid "Package Type:" msgstr "" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound #, object-pascal-format, fuzzy, badformat #| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." msgstr "No s'ha trobat la dependència %s%s%s.%sSi us plau, escolliu un paquet que existeixi" #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid #, object-pascal-format, fuzzy, badformat #| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" msgstr "La versió màxima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "La versió màxima és menor que la versió mínima" #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid #, object-pascal-format, fuzzy, badformat #| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" msgstr "La versió mínima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency #, object-pascal-format, fuzzy, badformat #| msgid "The project has already a dependency for the package %s%s%s." msgid "The project has already a dependency for the package \"%s\"." msgstr "El projecte ja té una dependència pel paquet %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject #, object-pascal-format, fuzzy, badformat #| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." msgstr "El nom d'unitat %s%s%s ja existeix en el projecte%sen el fitxer: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection #, object-pascal-format, fuzzy, badformat #| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." msgstr "El nom d'unitat %s%s%s ja existeix en la selecció%s en el fitxer: %s%s%s." #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts.lisproject #, object-pascal-format msgid "Project %s" msgstr "" #: lazarusidestrconsts.lisproject2 msgid "Project: " msgstr "" #: lazarusidestrconsts.lisproject3 msgid "project" msgstr "" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" msgstr "El projecte ha canviat" #: lazarusidestrconsts.lisprojectchangedondisk msgid "Project changed on disk" msgstr "" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" msgid "Project directory" msgstr "Directori del projecte" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" msgstr "Nom del fitxer del projecte" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" msgstr "Trajectòria dels inclosos del projecte" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" msgstr "S'ha detectat fitxer d'informacó del projecte" #: lazarusidestrconsts.lisprojectinspectorshowprops msgid "Show properties pane in Project Inspector" msgstr "" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" msgstr "El projecte és executable" #: lazarusidestrconsts.lisprojectisrunnablehint msgid "Generates a binary executable which can be run." msgstr "" #: lazarusidestrconsts.lisprojectmacro msgctxt "lazarusidestrconsts.lisprojectmacro" msgid "Project" msgstr "" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" msgstr "" #: lazarusidestrconsts.lisprojectnamespaces msgid "Project Namespaces" msgstr "" #: lazarusidestrconsts.lisprojectoption msgid "Project Option" msgstr "" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" msgstr "" #: lazarusidestrconsts.lisprojectoutputdirectory msgid "Project output directory" msgstr "" #: lazarusidestrconsts.lisprojectpathhint msgid "Directory where project's main file must be" msgstr "" #: lazarusidestrconsts.lisprojectsession msgid "Project Session" msgstr "" #: lazarusidestrconsts.lisprojectsessionchanged msgid "Project session changed" msgstr "" #: lazarusidestrconsts.lisprojectsourcedirectories msgid "Project source directories" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionataddress #, object-pascal-format msgid "%0:s%0:s At address %1:x" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss #, object-pascal-format msgid "Project %s raised exception class '%s'." msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess #, object-pascal-format msgid "Project %s raised exception class '%s' with message:%s%s" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at address %2:x" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileline #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at line %2:d" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" msgstr "" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Trajectòria del codi font del projecte" #: lazarusidestrconsts.lisprojectunit msgid "project unit" msgstr "" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" msgstr "Trajectòria de les unitats del projecte" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" msgstr "" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "Confirma l'eliminació de les dependències" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "" #: lazarusidestrconsts.lisprojinspdeletedependencyfor #, object-pascal-format msgid "Delete dependency for %s?" msgstr "Voleu eliminar la dependència per %s?" #: lazarusidestrconsts.lisprojinspprojectinspector #, object-pascal-format msgid "Project Inspector - %s" msgstr "Inspector del projecte - %s" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages" msgid "Removed required packages" msgstr "S'han eliminat els paquets requerits" #: lazarusidestrconsts.lisprojinspremovefilefromproject #, object-pascal-format msgid "Remove file %s from project?" msgstr "Voleu eliminar el fitxer %s del projecte?" #: lazarusidestrconsts.lisprojinspremoveitemsf #, object-pascal-format msgid "Remove %s items from project?" msgstr "" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Construeix sempre (inclús si res ha canviat)" #: lazarusidestrconsts.lisprojoptsalwaysbuildhint msgid "May be needed if there is a bug in dependency check, normally not needed." msgstr "" #: lazarusidestrconsts.lisprojoptserror msgctxt "lazarusidestrconsts.lisprojoptserror" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist #, object-pascal-format msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "No es pot canviar la llista de les formes creades automàticament en el codi font del programa. %s Si us plau, corregiu primer els errors." #: lazarusidestrconsts.lispromptforvalue msgid "Prompt for value" msgstr "Demana el valor" #: lazarusidestrconsts.lisproperties msgid "Properties (replace or remove)" msgstr "" #: lazarusidestrconsts.lisproperty #, object-pascal-format msgid "%s property" msgstr "" #: lazarusidestrconsts.lisprotected msgid "Protected" msgstr "" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" msgstr "Mètode protegit" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" msgstr "Mètode públic" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" msgstr "Mètode publicat" #: lazarusidestrconsts.lispublishedto #, object-pascal-format msgid "Published to %s" msgstr "" #: lazarusidestrconsts.lispublishmodulenote msgid "Files belonging to project / package will be included automatically." msgstr "" #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" msgstr "Publica el directori del projecte" #: lazarusidestrconsts.lispublishproject msgid "Publish Project" msgstr "" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" msgstr "" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint msgid "The resource will be available for FPC." msgstr "" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas #, fuzzy #| msgid "A pascal unit must have the extension .pp or .pas" msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" msgid "A Pascal unit must have the extension .pp or .pas" msgstr "Una unitat Pascal ha de tenir l'extensió .pp o .pas" #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" msgstr "" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile #, object-pascal-format msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" msgstr "Ja existeix una unitat amb aquest nom.%sArxiu: %s" #: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid Pascal identifier." msgstr "" #: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni #, object-pascal-format msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "" #: lazarusidestrconsts.lispwconvertproject msgid "Convert &Delphi Project" msgstr "" #: lazarusidestrconsts.lispwnewproject msgid "&New Project" msgstr "" #: lazarusidestrconsts.lispwopenproject msgid "&Open Project" msgstr "" #: lazarusidestrconsts.lispwopenrecentproject #, fuzzy #| msgid "Open Recent Project" msgctxt "lazarusidestrconsts.lispwopenrecentproject" msgid "Open &Recent Project" msgstr "Obre recent" #: lazarusidestrconsts.lispwviewexampleprojects msgid "View &Example Projects" msgstr "" #: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart msgid "Quick check Fppkg configuration at start" msgstr "" #: lazarusidestrconsts.lisquickfixerror msgid "QuickFix error" msgstr "" #: lazarusidestrconsts.lisquickfixes msgid "Quick fixes" msgstr "" #: lazarusidestrconsts.lisquickfixsearchidentifier msgid "Search identifier" msgstr "" #: lazarusidestrconsts.lisquit msgctxt "lazarusidestrconsts.lisquit" msgid "Quit" msgstr "" #: lazarusidestrconsts.lisquitlazarus msgid "&Quit Lazarus" msgstr "" #: lazarusidestrconsts.lisreallydelete msgid "Really delete?" msgstr "" #: lazarusidestrconsts.lisrecenttabs msgid "Recent tabs" msgstr "" #: lazarusidestrconsts.lisrecord msgctxt "lazarusidestrconsts.lisrecord" msgid "Record" msgstr "" #: lazarusidestrconsts.lisrecordedmacros msgid "Recorded" msgstr "" #: lazarusidestrconsts.lisredo msgctxt "lazarusidestrconsts.lisredo" msgid "Redo" msgstr "Torna a fer" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" msgstr "" #: lazarusidestrconsts.lisrelative msgid "Relative" msgstr "" #: lazarusidestrconsts.lisremove msgctxt "lazarusidestrconsts.lisremove" msgid "Remove" msgstr "" #: lazarusidestrconsts.lisremove2 msgid "Remove?" msgstr "" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Elimina totes les propietats no vàlides" #: lazarusidestrconsts.lisremoveallmessagetypefilters msgid "Remove all message type filters" msgstr "" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" msgstr "" #: lazarusidestrconsts.lisremovecompileroptionhidemessage msgid "Remove Compiler Option Hide Message" msgstr "" #: lazarusidestrconsts.lisremovedependenciesfrompackage #, object-pascal-format msgid "Remove %s dependencies from package \"%s\"?" msgstr "" #: lazarusidestrconsts.lisremovedpropertys #, object-pascal-format msgid "Removed property \"%s\"." msgstr "" #: lazarusidestrconsts.lisremovefilesfrompackage #, object-pascal-format msgid "Remove %s files from package \"%s\"?" msgstr "" #: lazarusidestrconsts.lisremovefromproject #, fuzzy #| msgid "Remove from project" msgid "Remove from Project" msgstr "Elimina del projecte" #: lazarusidestrconsts.lisremovefromsearchpath msgid "Remove from search path" msgstr "" #: lazarusidestrconsts.lisremoveincludepath msgid "Remove include path?" msgstr "" #: lazarusidestrconsts.lisremovelocalvariable3 #, object-pascal-format msgid "Remove local variable \"%s\"" msgstr "" #: lazarusidestrconsts.lisremovemessagetypefilter msgid "Remove Message Type Filter" msgstr "" #: lazarusidestrconsts.lisremovenonexistingfiles msgid "Remove nonexistent files" msgstr "" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" msgstr "" #: lazarusidestrconsts.lisremovethem msgid "Remove them" msgstr "" #: lazarusidestrconsts.lisremovethepathsfromothersources msgid "Remove the paths from \"Other sources\"" msgstr "" #: lazarusidestrconsts.lisremoveunitpath msgid "Remove unit path?" msgstr "" #: lazarusidestrconsts.lisremoveuses #, object-pascal-format msgid "Remove uses \"%s\"" msgstr "" #: lazarusidestrconsts.lisrename msgctxt "lazarusidestrconsts.lisrename" msgid "Rename" msgstr "Canvia el nom" #: lazarusidestrconsts.lisrename2 msgid "Rename ..." msgstr "" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" msgstr "Voleu canviar el nom del fitxer?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" msgstr "Ha fallat el canvi de nom del fitxer" #: lazarusidestrconsts.lisrenameshowresult msgid "Show list of renamed Identifiers" msgstr "" #: lazarusidestrconsts.lisrenameto #, object-pascal-format msgid "Rename to %s" msgstr "" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" msgstr "" #: lazarusidestrconsts.lisreopenproject msgid "Reopen project" msgstr "" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "" #: lazarusidestrconsts.lisrepeat msgctxt "lazarusidestrconsts.lisrepeat" msgid "Repeat" msgstr "" #: lazarusidestrconsts.lisreplace msgctxt "lazarusidestrconsts.lisreplace" msgid "Replace" msgstr "Substitueix" #: lazarusidestrconsts.lisreplacedpropertyswiths #, object-pascal-format msgid "Replaced property \"%s\" with \"%s\"." msgstr "" #: lazarusidestrconsts.lisreplacedtypeswiths #, object-pascal-format msgid "Replaced type \"%s\" with \"%s\"." msgstr "" #: lazarusidestrconsts.lisreplacement msgid "Replacement" msgstr "" #: lazarusidestrconsts.lisreplacementfuncs msgid "Replacement functions" msgstr "" #: lazarusidestrconsts.lisreplacements msgid "Replacements" msgstr "" #: lazarusidestrconsts.lisreplaceremoveunknown msgid "Fix unknown properties and types" msgstr "" #: lazarusidestrconsts.lisreplacewholeidentifier msgid "Replace whole identifier" msgstr "" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "" #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts.lisrescan msgid "Rescan" msgstr "" #: lazarusidestrconsts.lisreset msgctxt "lazarusidestrconsts.lisreset" msgid "Reset" msgstr "" #: lazarusidestrconsts.lisresetallfilefilterstodefaults msgid "Reset all file filters to defaults?" msgstr "" #: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?" msgstr "" #: lazarusidestrconsts.lisresourcenamemustbeunique msgid "Resource name must be unique." msgstr "" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" msgstr "S'ha produït un error mentre es desava el recurs" #: lazarusidestrconsts.lisresourcetypeofnewfiles msgid "Resource type of project" msgstr "" #: lazarusidestrconsts.lisrestart msgctxt "lazarusidestrconsts.lisrestart" msgid "Restart" msgstr "Reinicia" #: lazarusidestrconsts.lisresult2 msgid "Result:" msgstr "" #: lazarusidestrconsts.lisreturnparameterindexedword msgid "" "Return parameter-indexed word from the current line preceding cursor position.\n" "\n" "Words in a line are numbered 1,2,3,... from left to right, but the last word\n" "which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" "is always the current macro.\n" "\n" "Example line:\n" "i 0 count-1 forb|\n" "Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" "\n" "In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+" msgstr "" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "" "Return the list of all values of case variable in front of variable.\n" "\n" "Optional Parameters (comma separated):\n" "WithoutExtraIndent // the case list will be generated without extra indentation" msgstr "" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" msgstr "Ha fallat la reversió" #: lazarusidestrconsts.lisrevision msgid "Revision: " msgstr "" #: lazarusidestrconsts.lisright msgctxt "lazarusidestrconsts.lisright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" msgstr "" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "" #: lazarusidestrconsts.lisrightgutter #, fuzzy msgctxt "lazarusidestrconsts.lisrightgutter" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "" #: lazarusidestrconsts.lisrightsides msgid "Right sides" msgstr "Costats drets" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" msgstr "Iguala l'espai dret" #: lazarusidestrconsts.lisrun msgctxt "lazarusidestrconsts.lisrun" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations msgid "\"Run and Design time\" packages have no limitations." msgstr "" #: lazarusidestrconsts.lisrunning #, object-pascal-format msgid "%s (running ...)" msgstr "" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" msgstr "El fitxer no és executable" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable #, object-pascal-format, fuzzy, badformat #| msgid "The host application %s%s%s is not executable." msgid "The host application \"%s\" is not executable." msgstr "L'aplicació amfitriona %s%s%s no és executable" #: lazarusidestrconsts.lisrunstage msgctxt "lazarusidestrconsts.lisrunstage" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide msgid "Runtime only, cannot be installed in IDE" msgstr "" #: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly." msgstr "" #: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them." msgstr "" #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" msgstr "Ha fallat executar a" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract Methods - not yet overridden" msgstr "" #: lazarusidestrconsts.lissamabstractmethodsof #, object-pascal-format msgid "Abstract methods of %s" msgstr "" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" msgstr "" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods #, object-pascal-format msgid "%s is an abstract class, it has %s abstract methods." msgstr "" #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" msgstr "" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" msgstr "" #: lazarusidestrconsts.lissamselectnone msgid "Select none" msgstr "" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf #, object-pascal-format msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "" #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "" #: lazarusidestrconsts.lissave msgctxt "lazarusidestrconsts.lissave" msgid "Save" msgstr "" #: lazarusidestrconsts.lissaveall msgctxt "lazarusidestrconsts.lissaveall" msgid "Save All" msgstr "Desa-ho Tot" #: lazarusidestrconsts.lissaveallchecked msgid "Save All Checked" msgstr "" #: lazarusidestrconsts.lissaveallmodified #, fuzzy #| msgid "save all modified files" msgid "Save all modified files" msgstr "desa tots els fitxers modificats" #: lazarusidestrconsts.lissavealloriginalmessagestofile msgid "Save All/Original Messages to File ..." msgstr "" #: lazarusidestrconsts.lissaveandexitdialog #, fuzzy #| msgid "Save and exit dialog" msgid "Only Save" msgstr "Diàleg desa i surt" #: lazarusidestrconsts.lissaveandrebuildide #, fuzzy #| msgid "Save and rebuild IDE" msgid "Rebuild IDE" msgstr "Desa i remunta l'IDE" #: lazarusidestrconsts.lissavechangedfiles msgid "Save changed files?" msgstr "" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" msgstr "Voleu desar els canvis?" #: lazarusidestrconsts.lissavechangestoproject #, object-pascal-format msgid "Save changes to project %s?" msgstr "Voleu desar els canvis del projecte %s?" #: lazarusidestrconsts.lissavecurrenteditorfile #, fuzzy #| msgid "save current editor file" msgid "Save current editor file" msgstr "desa el fitxer editor actual" #: lazarusidestrconsts.lissavedwithidesettings msgid "Saved with IDE settings" msgstr "" #: lazarusidestrconsts.lissavedwithprojectsession msgid "Saved with project session" msgstr "" #: lazarusidestrconsts.lissavefilebeforeclosingform #, object-pascal-format, fuzzy, badformat #| msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgid "Save file \"%s\"%sbefore closing form \"%s\"?" msgstr "Voleu desar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" #: lazarusidestrconsts.lissavemacroas msgid "Save macro as" msgstr "" #: lazarusidestrconsts.lissavemessages msgid "Save messages" msgstr "" #: lazarusidestrconsts.lissaveproject #, object-pascal-format msgid "Save project %s (*%s)" msgstr "" #: lazarusidestrconsts.lissavesessionchangestoproject #, object-pascal-format msgid "Save session changes to project %s?" msgstr "" #: lazarusidestrconsts.lissavesessionfoldstate msgctxt "lazarusidestrconsts.lissavesessionfoldstate" msgid "Save fold info" msgstr "" #: lazarusidestrconsts.lissavesessionfoldstatehint msgid "Code editor supports folding (temporarily hiding) blocks of code." msgstr "" #: lazarusidestrconsts.lissavesessionjumphistory msgctxt "lazarusidestrconsts.lissavesessionjumphistory" msgid "Save jump history" msgstr "" #: lazarusidestrconsts.lissavesessionjumphistoryhint msgid "Ctrl-Click on an identifier in code editor is stored in jump history." msgstr "" #: lazarusidestrconsts.lissavesettings msgid "Save Settings" msgstr "" #: lazarusidestrconsts.lissaveshownmessagestofile msgid "Save Shown Messages to File ..." msgstr "" #: lazarusidestrconsts.lissavespace msgid "Save " msgstr "Desa " #: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn #, object-pascal-format msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s." msgstr "" #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" msgstr "Factor d'escalat:" #: lazarusidestrconsts.lisscanfilesinparentdir msgid "Scan files in parent directory" msgstr "" #: lazarusidestrconsts.lisscanfilesinparentdirhint msgid "Search for source files in sibling directories (parent directory and its children)" msgstr "" #: lazarusidestrconsts.lisscanning msgid "Scanning" msgstr "" #: lazarusidestrconsts.lisscanning2 #, object-pascal-format msgid "%s. Scanning ..." msgstr "" #: lazarusidestrconsts.lisscanparentdir msgid "Scanning parent directory" msgstr "" #: lazarusidestrconsts.lissearchpaths2 msgid "Search paths" msgstr "" #: lazarusidestrconsts.lissearchunit #, object-pascal-format msgid "Search Unit \"%s\"" msgstr "" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor #, object-pascal-format msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"." msgstr "" #: lazarusidestrconsts.lissecondaryconfigpath msgid "Secondary config path" msgstr "" #: lazarusidestrconsts.lissecondtest msgid "&Second test" msgstr "" #: lazarusidestrconsts.lisseemessages msgid "See messages." msgstr "Visualitza els missatges." #: lazarusidestrconsts.lisseeprojectprojectinspector #, object-pascal-format msgid "%sSee Project -> Project Inspector" msgstr "%sMireu Projecte -> Inspector del Projecte" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" msgstr "Selecciona un element de l'ajuda:" #: lazarusidestrconsts.lisselectanode msgid "Select a node" msgstr "Selecciona un node" #: lazarusidestrconsts.lisselectanotherlclwidgetset msgid "Select another LCL widgetset (macro LCLWidgetType)" msgstr "" #: lazarusidestrconsts.lisselectbuildmode msgid "Select build mode" msgstr "" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Selecciona els fitxers de formes Delphi (*.dfm)" #: lazarusidestrconsts.lisselected msgctxt "lazarusidestrconsts.lisselected" msgid "Selected" msgstr "" #: lazarusidestrconsts.lisselectedaddition msgid "Selected addition:" msgstr "" #: lazarusidestrconsts.lisselectedandchildcontrols msgid "Selected and child controls" msgstr "" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedcommandsmapping msgid "Selected Command's Mapping" msgstr "" #: lazarusidestrconsts.lisselectedforinstallation msgid "selected for installation" msgstr "" #: lazarusidestrconsts.lisselectedforuninstallation msgid "selected for uninstallation" msgstr "" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedmessageinmessageswindow msgid "Selected message in messages window:" msgstr "" #: lazarusidestrconsts.lisselectedmodeswerecompiled #, object-pascal-format msgid "Selected %d modes were successfully compiled." msgstr "" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" msgstr "" #: lazarusidestrconsts.lisselectfile msgid "Select the file" msgstr "" #: lazarusidestrconsts.lisselectfpcpath msgid "Select the path where FPC is installed" msgstr "" #: lazarusidestrconsts.lisselectfpcsourcedirectory msgid "Select FPC source directory" msgstr "" #: lazarusidestrconsts.lisselectframe msgid "Select Frame" msgstr "" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "La selecció excedeix la constant de la cadena" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" msgstr "Eina de selecció" #: lazarusidestrconsts.lisselectlazarussourcedirectory msgid "Select Lazarus source directory" msgstr "" #: lazarusidestrconsts.lisselectpathto #, object-pascal-format msgid "Select path to %s" msgstr "" #: lazarusidestrconsts.lisselecttargetdirectory msgid "Select target directory" msgstr "" #: lazarusidestrconsts.lissetallcolors msgid "Set all colors:" msgstr "" #: lazarusidestrconsts.lissetdefault msgid "Set default" msgstr "" #: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." msgstr "" #: lazarusidestrconsts.lissetupdefaultindentation msgid "(Set up default indentation)" msgstr "" #: lazarusidestrconsts.lisshort msgid "Short:" msgstr "" #: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty." msgstr "" #: lazarusidestrconsts.lisshortnopath msgid "Short, no path" msgstr "" #: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications #, object-pascal-format msgid "Should the component \"%s\" be auto created when the application starts?" msgstr "" #: lazarusidestrconsts.lisshow msgid "Show" msgstr "" #: lazarusidestrconsts.lisshowabstractmethodsof #, object-pascal-format msgid "Show abstract methods of \"%s\"" msgstr "" #: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector msgid "Show component tree" msgstr "" #: lazarusidestrconsts.lisshowconsole msgid "Show console" msgstr "" #: lazarusidestrconsts.lisshowdeclarationhints msgid "Show declaration hints" msgstr "" #: lazarusidestrconsts.lisshowdifferencesbetweenmodes msgid "Show differences between modes ..." msgstr "" #: lazarusidestrconsts.lisshowemptyunitspackages msgid "Show empty units/packages" msgstr "" #: lazarusidestrconsts.lisshowfpcmessagelinescompiled msgid "Show FPC message \"lines compiled\"" msgstr "" #: lazarusidestrconsts.lisshowglyphsfor msgid "Show Glyphs for" msgstr "" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" msgstr "" #: lazarusidestrconsts.lisshowhelp msgid "Show help" msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector #, fuzzy msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector" msgid "Show hints" msgstr "Mostra sugerències a l'inspector d'Objectes" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" msgstr "" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" msgstr "" #: lazarusidestrconsts.lisshowmessagetypeid msgid "Show Message Type ID" msgstr "" #: lazarusidestrconsts.lisshowmultiplelines msgid "Show multiple lines" msgstr "" #: lazarusidestrconsts.lisshowonlymodified msgid "Show only modified" msgstr "" #: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window." msgstr "" #: lazarusidestrconsts.lisshowoutput msgid "Show output" msgstr "" #: lazarusidestrconsts.lisshowoverviewgutter msgid "Show overview gutter" msgstr "" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" msgstr "" #: lazarusidestrconsts.lisshowpositionofsourceeditor msgid "Show position of source editor" msgstr "" #: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector msgid "Show property filter" msgstr "" #: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop msgid "Show recently used identifiers at top" msgstr "" #: lazarusidestrconsts.lisshowrelativepaths msgid "Show relative paths" msgstr "" #: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy msgid "Shows all controls in tree hierarchy." msgstr "" #: lazarusidestrconsts.lisshowsdescriptionforselectedproperty msgid "A box at the bottom shows description for the selected property." msgstr "" #: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings msgid "Show setup dialog for most important settings." msgstr "" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" msgstr "" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show statusbar" msgstr "" #: lazarusidestrconsts.lisshowunits msgid "Show units" msgstr "" #: lazarusidestrconsts.lisshowunitswithinitialization msgid "Show units with initialization/finalization sections" msgstr "" #: lazarusidestrconsts.lisshowunitswithinitializationhint msgid "These units may initialize global data used by the program/application. Remove with care." msgstr "" #: lazarusidestrconsts.lisshowunusedunits msgid "Show unused units ..." msgstr "" #: lazarusidestrconsts.lisshowvaluehintswhiledebugging msgid "Show value hints while debugging" msgstr "" #: lazarusidestrconsts.lisshowversionandexit msgid "Show version and exit." msgstr "" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" msgstr "" #: lazarusidestrconsts.lissibling msgid "Sibling" msgstr "" #: lazarusidestrconsts.lissimpleprogram msgid "Simple Program" msgstr "" #: lazarusidestrconsts.lissimpleprogramprogramdescriptor msgid "A most simple Free Pascal command line program." msgstr "" #: lazarusidestrconsts.lissimplesyntax #, fuzzy #| msgid "Simple Syntax" msgid "Simple syntax" msgstr "Sintaxi SImple" #: lazarusidestrconsts.lisskiperrors msgid "Skip errors" msgstr "" #: lazarusidestrconsts.lisskipfile msgid "Skip file" msgstr "" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project." msgstr "" #: lazarusidestrconsts.lisskipstartupchecks msgid "Skip selected checks at startup. Valid options are:" msgstr "" #: lazarusidestrconsts.lisslowerbutmoreaccurate msgid "Slower but more accurate." msgstr "" #: lazarusidestrconsts.lissmallerratherthanfaster msgid "Smaller rather than faster" msgstr "" #: lazarusidestrconsts.lissmatches msgid "Matches" msgstr "" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "Ho sento, aquest tipus encara no està implementat" #: lazarusidestrconsts.lissorthistorylimit msgid "History items limit" msgstr "" #: lazarusidestrconsts.lissorting msgid "Sorting" msgstr "" #: lazarusidestrconsts.lissortorderalphabetic msgid "Alphabetic" msgstr "" #: lazarusidestrconsts.lissortorderdefinition msgid "Definition (Scoped)" msgstr "" #: lazarusidestrconsts.lissortorderscopedalphabetic msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic" msgid "Alphabetic (Scoped)" msgstr "" #: lazarusidestrconsts.lissortordertitle msgid "Order by" msgstr "" #: lazarusidestrconsts.lissortselascending msgid "Ascending" msgstr "Ascendent" #: lazarusidestrconsts.lissortselcasesensitive msgctxt "lazarusidestrconsts.lissortselcasesensitive" msgid "&Case Sensitive" msgstr "" #: lazarusidestrconsts.lissortseldescending msgid "Descending" msgstr "Descendent" #: lazarusidestrconsts.lissortseldomain msgid "Domain" msgstr "Domini" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" msgstr "Ignora l'espai" #: lazarusidestrconsts.lissortsellines msgid "Lines" msgstr "Línies" #: lazarusidestrconsts.lissortseloptions msgctxt "lazarusidestrconsts.lissortseloptions" msgid "Options" msgstr "Opcions" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" msgstr "Paràgrafs" #: lazarusidestrconsts.lissortselpreview msgctxt "lazarusidestrconsts.lissortselpreview" msgid "Preview" msgstr "Visualització prèvia" #: lazarusidestrconsts.lissortselsort msgid "Accept" msgstr "Accepta" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" msgstr "Ordena la selecció" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" msgid "Words" msgstr "Paraules" #: lazarusidestrconsts.lissourceanddestinationaresame #, object-pascal-format msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory." msgstr "" #: lazarusidestrconsts.lissourcedirectorydoesnotexist #, object-pascal-format, fuzzy, badformat #| msgid "Source directory %s%s%s does not exist." msgid "Source directory \"%s\" does not exist." msgstr "El directori font %s%s%s no existeix." #: lazarusidestrconsts.lissourceeditorwindowmanager msgid "Source Editor Window Manager" msgstr "" #: lazarusidestrconsts.lissourcemodified msgid "Source modified" msgstr "S'ha modificat el codi font" #: lazarusidestrconsts.lissourceofpagehaschangedsave #, object-pascal-format, fuzzy, badformat #| msgid "Source of page %s%s%s has changed. Save?" msgid "Source of page \"%s\" has changed. Save?" msgstr "El codi font de la pàgina %s%s%s ha canviat. Voleu desar-lo?" #: lazarusidestrconsts.lissourceofpagehaschangedsaveex #, object-pascal-format msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" msgstr "" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" msgstr "" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" msgstr "Iguala els espais" #: lazarusidestrconsts.lissrcos msgid "Src OS" msgstr "" #: lazarusidestrconsts.lisssearching msgid "Searching" msgstr "Cercant" #: lazarusidestrconsts.lisssearchtext msgid "Search text" msgstr "Cerca text" #: lazarusidestrconsts.lisstartconversion msgid "Start Conversion" msgstr "" #: lazarusidestrconsts.lisstartide msgid "Start IDE" msgstr "" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" msgstr "Inicia amb un nou projecte" #: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass msgid "Statusbar shows the property's name and the class where it is published." msgstr "" #: lazarusidestrconsts.lisstop msgctxt "lazarusidestrconsts.lisstop" msgid "Stop" msgstr "Atura" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Detindre la sessió de depuració i reconstruïr el projecte?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" msgstr "Voleu aturar la depuració?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" msgstr "Dentindre la sessió de depuració?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" msgstr "" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" msgstr "Voleu aturar la depuració?" #: lazarusidestrconsts.lisstorepathdelimitersandas msgid "Store path delimiters \\ and / as" msgstr "" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" msgstr "S'ha produït un error d'afluent" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" msgstr "Subprocediment" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "Subprocediment en el mateix nivell" #: lazarusidestrconsts.lissubtarget msgid "Subtarget" msgstr "" #: lazarusidestrconsts.lissuccess msgid "Success" msgstr "Correcte!" #: lazarusidestrconsts.lissuccessfullyexported #, object-pascal-format msgid "Successfully exported to \"%s\"." msgstr "" #: lazarusidestrconsts.lissuccessfullyexportedbuildmodes #, object-pascal-format msgid "Successfully exported %d BuildModes to \"%s\"." msgstr "" #: lazarusidestrconsts.lissuccessfullyexportedcompileroptions #, object-pascal-format msgid "Successfully exported compiler options to \"%s\"." msgstr "" #: lazarusidestrconsts.lissuccessfullyimported #, object-pascal-format msgid "Successfully imported from \"%s\"." msgstr "" #: lazarusidestrconsts.lissuccessfullyimportedbuildmodes #, object-pascal-format msgid "Successfully imported %d BuildModes from \"%s\"." msgstr "" #: lazarusidestrconsts.lissuccessfullyimportedcompileroptions #, object-pascal-format msgid "Successfully imported compiler options from \"%s\"." msgstr "" #: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase msgid "Suggest default name of new file in lowercase" msgstr "" #: lazarusidestrconsts.lissuspiciousincludepath msgid "Suspicious include path" msgstr "" #: lazarusidestrconsts.lissuspiciousunitpath msgid "Suspicious unit path" msgstr "" #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "El nom de la variable no és vàlid" #: lazarusidestrconsts.lissvuoisnotavalididentifier #, object-pascal-format, fuzzy, badformat #| msgid "%s%s%s is not a valid identifier." msgid "\"%s\" is not a valid identifier." msgstr "%s%s%s no és un identificador vàlid" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" msgstr "Substitueix la variable del sistema" #: lazarusidestrconsts.lisswitchfiltersettings msgid "Switch Filter Settings" msgstr "" #: lazarusidestrconsts.lisswitchtofavoritestabafterasking msgid "Switch to Favorites tab after asking for component name." msgstr "" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" msgstr "" #: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg msgid "system.ppu not found. Check your fpc.cfg." msgstr "" #: lazarusidestrconsts.listab msgid "Tab" msgstr "Tabulador" #: lazarusidestrconsts.listaborderconfirmsort #, object-pascal-format msgid "Sort tab orders of all child controls of \"%s\" by their positions?" msgstr "" #: lazarusidestrconsts.listaborderdownhint msgid "Move the selected control down in tab order" msgstr "" #: lazarusidestrconsts.listaborderof #, object-pascal-format msgid "Tab Order of %s" msgstr "" #: lazarusidestrconsts.listaborderrecursionhint msgid "Calculate tab order recursively for child controls" msgstr "" #: lazarusidestrconsts.listaborderrecursively msgid "recursively" msgstr "" #: lazarusidestrconsts.listabordersorthint msgid "Calculate tab order for controls by their X- and Y- positions" msgstr "" #: lazarusidestrconsts.listaborderuphint msgid "Move the selected control up in tab order" msgstr "" #: lazarusidestrconsts.listabsfor #, object-pascal-format msgid "Tabs for %s" msgstr "" #: lazarusidestrconsts.listarget msgid "Target:" msgstr "" #: lazarusidestrconsts.listarget2 #, object-pascal-format msgid ", Target: %s" msgstr "" #: lazarusidestrconsts.listargetcpu msgid "Target CPU" msgstr "CPU destinació" #: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory msgid "Target file name: (-o, empty = use unit output directory)" msgstr "" #: lazarusidestrconsts.listargetfilenameo msgid "Target file name (-o):" msgstr "" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" msgstr "Nom del fitxer destinació del projecte" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" msgstr "" #: lazarusidestrconsts.listargetisreadonly msgid "Target is read only" msgstr "" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" msgid "Target OS" msgstr "SO de destinació" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" msgstr "" #: lazarusidestrconsts.listemplateeditparamcellhelp #, object-pascal-format msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")." msgstr "" #: lazarusidestrconsts.listemplatefile msgid "Template file" msgstr "" #: lazarusidestrconsts.listestdirectory msgid "Test directory" msgstr "Directori de proves" #: lazarusidestrconsts.listesturl msgid "Test URL" msgstr "" #: lazarusidestrconsts.listheapplicationbundlewascreatedfor #, object-pascal-format msgid "The Application Bundle was created for \"%s\"" msgstr "" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro #, object-pascal-format, fuzzy, badformat #| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste." msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." msgstr "La classe %s%s%s és un TControl i no pot ser enganxat dins un no-control%sNo s'ha pogut enganxar." #: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect #, object-pascal-format msgid "The compiler file \"%s\" does not look correct:%s%s" msgstr "" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby #, object-pascal-format msgid "The component %s can not be deleted because it is not owned by %s." msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror #, object-pascal-format msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated #, object-pascal-format, fuzzy, badformat #| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" msgstr "L'editor de component de classe %s%s%s%sinvocat amb el verb #%s %s%s%s%s ha generat l'error:%s%s%s%s" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp #, object-pascal-format msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "" #: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp #, object-pascal-format msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." msgstr "" #: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier." msgstr "" #: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted msgid "The configuration will be downgraded/converted." msgstr "" #: lazarusidestrconsts.listhecontainsanotexistingdirectory #, object-pascal-format msgid "The %s contains a nonexistent directory:%s%s" msgstr "" #: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch #, object-pascal-format msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." msgstr "" #: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." msgstr "" #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro #, object-pascal-format, fuzzy, badformat #| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options" msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" msgstr "El depurador %s%s%s%sno existeix o no es executable. %s%s%sMira Entorn -> Opcions del Depurador" #: lazarusidestrconsts.listhedefaultmodemustbestoredinproject msgid "The default mode must be stored in project, not in session." msgstr "" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist #, object-pascal-format, fuzzy, badformat #| msgid "The destination directory%s%s%s%s does not exist." msgid "The destination directory%s\"%s\" does not exist." msgstr "No existeix el directori de destinació%s%s%s%s." #: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere #, object-pascal-format msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" msgstr "" #: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi #, object-pascal-format msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" msgstr "" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit #, object-pascal-format msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" msgstr "" #: lazarusidestrconsts.listhefile #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s" msgid "The file \"%s\"" msgstr "El fitxer %s%s%s" #: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." msgstr "" #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi #, object-pascal-format msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" msgstr "" #: lazarusidestrconsts.listhefilemaskisinvalid #, object-pascal-format msgid "The file mask \"%s\" is invalid." msgstr "" #: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression #, object-pascal-format msgid "The file mask \"%s\" is not a valid regular expression." msgstr "" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "El fitxer %s%s%s%ssembla ser un programa. voleu tancar el projecte actual i crear un nou projecte Lazarus per aquest programa?%s\"No\" carregarà el fitxer com un codi font normal." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp #, object-pascal-format msgid "The file %s seems to be the program file of an existing Lazarus Project." msgstr "" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" msgstr "No s'ha trobat el fitxer %s%s%s%s.%sEl voleu localitzar manualment ?%s" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject #, object-pascal-format, fuzzy, badformat #| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "No s'ha trobat el fitxer %s%s%s%s.Ignora, carregarà el projecte.%sAvorta n'aturarà la càrrega." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth #, object-pascal-format msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" msgstr "" #: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect #, object-pascal-format msgid "The FPC source directory \"%s\" does not look correct:%s%s" msgstr "" #: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect #, object-pascal-format msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s" msgstr "" #: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename #, object-pascal-format msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." msgstr "" #: lazarusidestrconsts.listheideisstillbuilding msgid "The IDE is still building." msgstr "" #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "" #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand #, object-pascal-format msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?" msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists #, object-pascal-format msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta #, object-pascal-format msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth #, object-pascal-format msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." msgstr "" #: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect #, object-pascal-format msgid "The Lazarus directory \"%s\" does not look correct:%s%s" msgstr "" #: lazarusidestrconsts.listhelazarussourcesuse #, object-pascal-format msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild." msgstr "" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis #, fuzzy #| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually." msgstr "El fitxer LFM (Lazarus Form) conté propietats no vàlides. Això vol dir, per exemple, que conté algunes propietats/classes les quals no existeixen en la LCL actual. La manera normal de corregir això és eliminar aquestes propietats de la LFM i corregir manualment el codi pascal." #: lazarusidestrconsts.listhemacrodoesnotbeginwith #, object-pascal-format msgid "The macro \"%s\" does not begin with \"%s\"." msgstr "" #: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename #, object-pascal-format msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." msgstr "" #: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd #, object-pascal-format msgid "The new include file is not yet in the include search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory #, object-pascal-format msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts.listheoldconfigurationwillbeupgraded msgid "The old configuration will be upgraded." msgstr "" #: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint #, object-pascal-format msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" msgstr "" #: lazarusidestrconsts.listheoutputdirectoryismissing #, object-pascal-format msgid "The output directory \"%s\" is missing." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath #, object-pascal-format msgid "The output directory of %s is listed in the include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes #, object-pascal-format msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear #, object-pascal-format msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof #, object-pascal-format msgid "The output directory of %s is listed in the unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr "" #: lazarusidestrconsts.listheownerclasshasthisname msgid "The owner class has this name" msgstr "" #: lazarusidestrconsts.listheownerhasthisname msgid "The owner has this name" msgstr "" #: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi #, object-pascal-format msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "" #: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr #, object-pascal-format msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "" #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "" #: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi #, object-pascal-format msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package." msgstr "" #: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth #, object-pascal-format msgid "The package %s can not be uninstalled because it is needed by the IDE itself." msgstr "" #: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi #, object-pascal-format msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." msgstr "" #: lazarusidestrconsts.listhepackageisalreadyinthelist #, object-pascal-format msgid "The package %s is already in the list" msgstr "" #: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall #, object-pascal-format msgid "The package %s is not a design time package. It cannot be installed in the IDE." msgstr "" #: lazarusidestrconsts.listhepackageisusedby #, object-pascal-format msgid "The package \"%s\" is used by" msgstr "" #: lazarusidestrconsts.listhepathofmakeisnotcorrect #, object-pascal-format msgid "The path of \"make\" is not correct: \"%s\"" msgstr "" #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla #, object-pascal-format, fuzzy, badformat #| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s" msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." msgstr "No s'ha trobat el programa %sMake%s.%sEs necessita aquesta eina per muntar el Lazarus.%s" #: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption msgid "Running your application with debugger" msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging." msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption msgid "Run with no debugger" msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain #, object-pascal-format msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled." msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title msgid "Choose Debug Information format" msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems #, object-pascal-format msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces." msgstr "" #: lazarusidestrconsts.listheprojecthasnocompilecommandseepr #, object-pascal-format msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands" msgstr "" #: lazarusidestrconsts.listheprojecthasnomainsourcefile msgid "The project has no main source file." msgstr "" #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource #, object-pascal-format, fuzzy, badformat #| msgid "The project info file %s%s%s%sis equal to the project main source file!" msgid "The project info file \"%s\"%sis equal to the project main source file!" msgstr "El fitxer d'informació del projecte %s%s%s%sés igual al fitxer principal del codi font del projecte!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk #, object-pascal-format msgid "The project information file \"%s\"%shas changed on disk." msgstr "" #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest #, object-pascal-format, fuzzy #| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" msgstr "S'ha de desar el projecte abans de muntar de nou%sSi fiqueu el directori de les proves en les opcions de l'entorn,%spodeu crear projectes nous i muntar-los al mateix temps.%sVoleu desar el projecte?" #: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast msgid "The project uses FPC resources which require at least FPC 2.4" msgstr "" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar #, object-pascal-format msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgstr "" #: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe #, object-pascal-format msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable." msgstr "" #: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable #, object-pascal-format msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file." msgstr "" #: lazarusidestrconsts.listhereareadditionalnotesforthismessageon #, object-pascal-format msgid "%sThere are additional notes for this message on%s" msgstr "" #: lazarusidestrconsts.listherearenoconflictingkeys msgid "There are no conflicting keys." msgstr "" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename #, object-pascal-format msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no més son diferents en la capitalització:%s%s%sVoleu eliminar-los?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension #, object-pascal-format msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname msgid "There is already a build mode with this name." msgstr "" #: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename #, object-pascal-format msgid "There is already a component class with the name %s." msgstr "" #: lazarusidestrconsts.listhereisalreadyacomponentwiththisname msgid "There is already a component with this name" msgstr "" #: lazarusidestrconsts.listhereisalreadyafilein #, object-pascal-format msgid "There is already a file%s%s%sin %s" msgstr "" #: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue #, object-pascal-format msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" msgstr "" #: lazarusidestrconsts.listhereisalreadyaformwiththename #, object-pascal-format, fuzzy, badformat #| msgid "There is already a form with the name %s%s%s" msgid "There is already a form with the name \"%s\"" msgstr "Ja hi ha una forma amb el nom %s%s%s" #: lazarusidestrconsts.listhereisalreadyamacrowiththename #, object-pascal-format msgid "There is already a macro with the name \"%s\"." msgstr "" #: lazarusidestrconsts.listhereisalreadyanidemacrowiththename #, object-pascal-format msgid "There is already an IDE macro with the name \"%s\"" msgstr "" #: lazarusidestrconsts.listhereisalreadyapackageinthelist #, object-pascal-format msgid "There is already a package %s in the list" msgstr "" #: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur #, object-pascal-format msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?" msgstr "" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus #, object-pascal-format, fuzzy, badformat #| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." msgstr "Ja hi ha una unitat amb el nom %s%s%s. Els identificadors pascal han de ser únics." #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose #, object-pascal-format, fuzzy, badformat #| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" msgstr "En el projecte hi ha una unitat amb el nom %s%s%s.%sSi us plau, escolliu un nom diferent." #: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu #, object-pascal-format msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." msgstr "" #: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured #, object-pascal-format msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s" msgstr "" #: lazarusidestrconsts.listheremustbeatleastonebuildmode msgid "There must be at least one build mode." msgstr "" #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor #, object-pascal-format msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent #, object-pascal-format msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "S'ha produït un error mentre s'escrivia el component seleccionat %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe #, object-pascal-format msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "S'ha produït un error mentre es convertia l'afluent binari del component seleccionat %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli #, object-pascal-format msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "S'ha produït un error mentre es copiava l'afluent del component al porta-retalls:%s%s" #: lazarusidestrconsts.listherootcomponentcannotbedeleted #, fuzzy #| msgid "The root component can not be deleted." msgid "The root component cannot be deleted." msgstr "No es pot eliminar el component arrel." #: lazarusidestrconsts.listhesefileswillbedeleted msgid "These files will be deleted" msgstr "" #: lazarusidestrconsts.listhesesettingsarestoredwiththeproject msgid "These settings are stored with the project." msgstr "" #: lazarusidestrconsts.listheseunitswerenotfound msgid "These units were not found:" msgstr "" #: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro #, object-pascal-format msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." msgstr "" #: lazarusidestrconsts.listhetargetdirectoryisafile #, object-pascal-format msgid "The target directory is a file:%s" msgstr "" #: lazarusidestrconsts.listhetargetfilenameisadirectory msgid "The target file name is a directory." msgstr "" #: lazarusidestrconsts.listhetargetisnotwritable #, object-pascal-format msgid "The target %s is not writable." msgstr "" #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt #, object-pascal-format msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" msgstr "" #: lazarusidestrconsts.listheunitalreadyexists #, object-pascal-format msgid "The unit \"%s\" already exists." msgstr "" #: lazarusidestrconsts.listheunitbelongstopackage #, object-pascal-format msgid "The unit belongs to package %s." msgstr "" #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe #, object-pascal-format msgid "The unit %s exists twice in the unit path of the %s:" msgstr "" #: lazarusidestrconsts.listheunithasthisname msgid "The unit has this name" msgstr "" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler #, object-pascal-format msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" msgstr "" #: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd #, object-pascal-format msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." msgstr "" #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic #, object-pascal-format msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus #, object-pascal-format, fuzzy, badformat #| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." msgstr "La unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser únics." #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac #, object-pascal-format msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" msgstr "" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki #, object-pascal-format msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "" #: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename #, object-pascal-format msgid "This component already contains a class with the name %s." msgstr "" #: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor msgid "This function needs an open .lfm file in the source editor." msgstr "" #: lazarusidestrconsts.listhishelpmessage #, fuzzy #| msgid "this help message" msgid "This help message." msgstr "aquest missatge d'ajuda" #: lazarusidestrconsts.listhisistestprojectfordesigntimepackage msgid "This is a test project for a design time package, testing it outside the IDE." msgstr "" #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc #, object-pascal-format, fuzzy #| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "Sembla un arxiu pascal.%sS'hi recomana utilitzar minúscules per evitar problemes diversos amb alguns sistemes d'arxius i diferents compiladors.%sCanviar-li el nom a minúscules?" #: lazarusidestrconsts.listhisprojecthasnomainsourcefile msgid "This project has no main source file" msgstr "" #: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode msgid "This project has only the default build mode." msgstr "" #: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis #, object-pascal-format msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." msgstr "" #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode #, object-pascal-format msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "No s'ha pogut extraure aquesta declaració.%sSi us plau, seleccioneu codi per extreure'n un nou procediment/mètode." #: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme msgid "This will allow changing all build modes at once. Not implemented yet." msgstr "" #: lazarusidestrconsts.listhiswillcreateacirculardependency msgid "This will create a circular dependency." msgstr "" #: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed #, object-pascal-format msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" msgstr "" #: lazarusidestrconsts.listitle msgid "&Title" msgstr "" #: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus." msgstr "" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "" #: lazarusidestrconsts.listofpcpath msgid "Path:" msgstr "Trajectòria:" #: lazarusidestrconsts.listoolbarconfiguration msgid "Toolbar Configuration" msgstr "" #: lazarusidestrconsts.listoolhasnoexecutable #, object-pascal-format msgid "tool \"%s\" has no executable" msgstr "" #: lazarusidestrconsts.listoolheaderfailed msgid "Tool Header: Failed" msgstr "" #: lazarusidestrconsts.listoolheaderrunning msgid "Tool Header: Running" msgstr "" #: lazarusidestrconsts.listoolheaderscrolledup msgid "Tool Header: Scrolled up" msgstr "" #: lazarusidestrconsts.listoolheadersuccess msgid "Tool Header: Success" msgstr "" #: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo #, object-pascal-format msgid "tool stopped with exit code %s. Use context menu to get more information." msgstr "" #: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo #, object-pascal-format msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information." msgstr "" #: lazarusidestrconsts.listop msgctxt "lazarusidestrconsts.listop" msgid "Top" msgstr "" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" msgstr "" #: lazarusidestrconsts.listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "" #: lazarusidestrconsts.listopinfoview msgid "Show Class/Procedure hint" msgstr "" #: lazarusidestrconsts.listops msgid "Tops" msgstr "Límits superiors" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "" #: lazarusidestrconsts.listopspaceequally msgid "Top space equally" msgstr "Iguala l'espai superior" #: lazarusidestrconsts.listotalpages #, object-pascal-format msgid "Total Pages: %s" msgstr "" #: lazarusidestrconsts.listranslatetheenglishmessages msgid "Translate the English Messages" msgstr "" #: lazarusidestrconsts.listreeneedsrefresh msgid "Tree needs refresh" msgstr "" #: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein #, object-pascal-format msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" msgstr "" #: lazarusidestrconsts.listypes msgid "Types (not removed if no replacement)" msgstr "" #: lazarusidestrconsts.lisudadditionaldirectories msgid "Additional directories:" msgstr "" #: lazarusidestrconsts.lisudallpackageunits msgid "All package units" msgstr "" #: lazarusidestrconsts.lisudallsourceeditorunits msgid "All source editor units" msgstr "" #: lazarusidestrconsts.lisudallunits msgid "All units" msgstr "" #: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well." msgstr "" #: lazarusidestrconsts.lisudcollapseallnodes msgid "Collapse all nodes" msgstr "" #: lazarusidestrconsts.lisudexpandallnodes msgid "Expand all nodes" msgstr "" #: lazarusidestrconsts.lisudfile #, object-pascal-format msgid "File: %s" msgstr "" #: lazarusidestrconsts.lisudfilter msgid "(Filter)" msgstr "" #: lazarusidestrconsts.lisudimplementationuses #, object-pascal-format msgid "Implementation Uses: %s" msgstr "" #: lazarusidestrconsts.lisudimplementationuses2 #, object-pascal-format msgid "implementation uses: %s" msgstr "" #: lazarusidestrconsts.lisudinterfaceuses #, object-pascal-format msgid "Interface Uses: %s" msgstr "" #: lazarusidestrconsts.lisudinterfaceuses2 #, object-pascal-format msgid "interface uses: %s" msgstr "" #: lazarusidestrconsts.lisudprojectsandpackages msgid "Projects and packages" msgstr "" #: lazarusidestrconsts.lisudscanning msgid "Scanning ..." msgstr "" #: lazarusidestrconsts.lisudscanningunits #, object-pascal-format msgid "Scanning: %s units ..." msgstr "" #: lazarusidestrconsts.lisudsearch msgid "(Search)" msgstr "" #: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase msgid "Find next occurrence of this phrase" msgstr "" #: lazarusidestrconsts.lisudsearchnextunitofthisphrase msgid "Find next unit with this phrase" msgstr "" #: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase msgid "Find previous occurrence of this phrase" msgstr "" #: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase msgid "Find previous unit with this phrase" msgstr "" #: lazarusidestrconsts.lisudselectedunits msgid "Selected units" msgstr "" #: lazarusidestrconsts.lisudshownodesfordirectories msgid "Show nodes for directories" msgstr "" #: lazarusidestrconsts.lisudshownodesforprojectandpackages msgid "Show nodes for project and packages" msgstr "" #: lazarusidestrconsts.lisudunits msgid "Units" msgstr "" #: lazarusidestrconsts.lisudunits2 #, object-pascal-format msgid "Units: %s" msgstr "" #: lazarusidestrconsts.lisudusedbyimplementations #, object-pascal-format msgid "Used by Implementations: %s" msgstr "" #: lazarusidestrconsts.lisudusedbyimplementations2 #, object-pascal-format msgid "used by implementations: %s" msgstr "" #: lazarusidestrconsts.lisudusedbyinterfaces #, object-pascal-format msgid "Used by Interfaces: %s" msgstr "" #: lazarusidestrconsts.lisudusedbyinterfaces2 #, object-pascal-format msgid "used by interfaces: %s" msgstr "" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." msgstr "No mostres mes aquest missatge." #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Hi ha un error a l'expressió regular" #: lazarusidestrconsts.lisuefontwith msgid "Font without UTF-8" msgstr "Font sense UTF-8" #: lazarusidestrconsts.lisuegotoline #, fuzzy #| msgid "Goto line :" msgid "Goto line:" msgstr "Vés a la línia:" #: lazarusidestrconsts.lisuemodeseparator msgid "/" msgstr "" #: lazarusidestrconsts.lisuenotfound msgid "Not found" msgstr "No s'ha trobat" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith #, object-pascal-format, fuzzy, badformat #| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" msgstr "Voleu substituir aquesta ocurrència de %s%s%s%s amb %s%s%s?" #: lazarusidestrconsts.lisuesearching #, object-pascal-format msgid "Searching: %s" msgstr "Cercant: %s" #: lazarusidestrconsts.lisuesearchstringcontinuebeg msgid "Continue search from the beginning?" msgstr "" #: lazarusidestrconsts.lisuesearchstringcontinueend msgid "Continue search from the end?" msgstr "" #: lazarusidestrconsts.lisuesearchstringnotfound #, object-pascal-format msgid "Search string '%s' not found!" msgstr "No s'ha trobat la cadena '%s'" #: lazarusidestrconsts.lisuethecurre #, object-pascal-format, fuzzy #| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." msgstr "La font de l'editor actual no soport UTF-8, però pareix que el teu sistema està utilitzant-la.%sAçò implica que els caràcters no ASCII probablement no s'hi voran corrèctament.%sPodries sel·leccionar un altra font a les opcions de l'editor." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" msgstr "" #: lazarusidestrconsts.lisuidbytes #, object-pascal-format msgid "%s bytes" msgstr "%s octets" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" msgstr "Inclòs per:" #: lazarusidestrconsts.lisuidinproject #, fuzzy #| msgid "in Project:" msgid "In project:" msgstr "en el projecte:" #: lazarusidestrconsts.lisuidlines msgctxt "lazarusidestrconsts.lisuidlines" msgid "Lines:" msgstr "Línies:" #: lazarusidestrconsts.lisuidname msgctxt "lazarusidestrconsts.lisuidname" msgid "Name:" msgstr "Nom:" #: lazarusidestrconsts.lisuidno msgid "no" msgstr "no" #: lazarusidestrconsts.lisuidsize msgid "Size:" msgstr "Tamany:" #: lazarusidestrconsts.lisuidtype msgid "Type:" msgstr "Tipus:" #: lazarusidestrconsts.lisuidyes msgid "yes" msgstr "sí" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "Mostra els valors" #: lazarusidestrconsts.lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "No es pot convertir afluent binari a text" #: lazarusidestrconsts.lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "No es pot copiar els components al porta-retalls" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile #, object-pascal-format, fuzzy, badformat #| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." msgstr "No es pot afegir el comentari de capçalera del recurs al fitxer del recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably #, object-pascal-format, fuzzy, badformat #| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." msgstr "No es pot afegir el recurs T%s:FORMDATA al fitxer de recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread #, object-pascal-format msgid "Unable to add the dependency %s because the package %s has already a dependency %s" msgstr "" #: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea #, object-pascal-format msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s" msgstr "" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith #, object-pascal-format, fuzzy #| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgid "Unable to add %s to project because there is already a unit with the same name in the Project." msgstr "No es pot afegir %s al projecte, ja hi ha una unitat amb el mateix nom al projecte." #: lazarusidestrconsts.lisunabletobackupfileto #, object-pascal-format, fuzzy, badformat #| msgid "Unable to backup file %s%s%s to %s%s%s!" msgid "Unable to backup file \"%s\" to \"%s\"!" msgstr "No es pot fer copia de seguretat del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts.lisunabletochangeclassofto #, object-pascal-format msgid "%s%sUnable to change class of %s to %s" msgstr "%s%sIncapaç canviar la classe de %s a %s" #: lazarusidestrconsts.lisunabletochangeprojectscaledinsource #, object-pascal-format msgid "Unable to change project scaled in source.%s%s" msgstr "" #: lazarusidestrconsts.lisunabletochangeprojecttitleinsource #, object-pascal-format msgid "Unable to change project title in source.%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "No es pot netejar el directori destinació" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions #, object-pascal-format, fuzzy, badformat #| msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgid "Unable to clean up \"%s\".%sPlease check permissions." msgstr "No es pot netejar %s%s%s.%sSi us plau, comproveu els permisos." #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat #, object-pascal-format msgid "Unable to convert component text into binary format:%s%s" msgstr "No es pot convertir el component de text a format binari:%s%s" #: lazarusidestrconsts.lisunabletoconvertfileerror #, object-pascal-format, fuzzy, badformat #| msgid "Unable to convert file %s%s%s%sError: %s" msgid "Unable to convert file \"%s\"%sError: %s" msgstr "No es pot convetir el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream #, object-pascal-format, fuzzy, badformat #| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" msgstr "No es poden convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" #: lazarusidestrconsts.lisunabletoconverttoencoding #, object-pascal-format msgid "Unable to convert to encoding \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto msgid "Unable to create new file because there is already a directory with this name." msgstr "" #: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "" #: lazarusidestrconsts.lisunabletodeleteambiguousfile #, object-pascal-format msgid "Unable to delete ambiguous file \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletoexecute #, object-pascal-format msgid "unable to execute: %s" msgstr "" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts.lisunabletofindavalidclassnamein #, object-pascal-format, fuzzy, badformat #| msgid "Unable to find a valid classname in %s%s%s" msgid "Unable to find a valid classname in \"%s\"" msgstr "No es pot trobar un nom de classe vàlid a %s%s%s" #: lazarusidestrconsts.lisunabletofindfile #, object-pascal-format, fuzzy, badformat #| msgid "Unable to find file %s%s%s." msgid "Unable to find file \"%s\"." msgstr "No es pot trobar el fitxer %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption #, object-pascal-format msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" msgstr "" #: lazarusidestrconsts.lisunabletofindinlfmstream #, object-pascal-format msgid "Unable to find %s in LFM Stream." msgstr "" #: lazarusidestrconsts.lisunabletofindmethod msgid "Unable to find method." msgstr "" #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile #, object-pascal-format msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar #, object-pascal-format msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" msgstr "" #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "" #: lazarusidestrconsts.lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "" #: lazarusidestrconsts.lisunabletoloadfile2 #, object-pascal-format msgid "unable to load file %s: %s" msgstr "" #: lazarusidestrconsts.lisunabletoloadpackage #, object-pascal-format msgid "Unable to load package \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits #, object-pascal-format msgid "Unable to load the component class \"%s\" because it depends on itself." msgstr "" #: lazarusidestrconsts.lisunabletoopen #, object-pascal-format msgid "Unable to open \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades #, object-pascal-format msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "" #: lazarusidestrconsts.lisunabletoread #, object-pascal-format msgid "Unable to read %s" msgstr "" #: lazarusidestrconsts.lisunabletoreadprocessexitstatus msgid "unable to read process ExitStatus" msgstr "" #: lazarusidestrconsts.lisunabletoremoveoldbackupfile #, object-pascal-format, fuzzy, badformat #| msgid "Unable to remove old backup file %s%s%s!" msgid "Unable to remove old backup file \"%s\"!" msgstr "No es pot eliminar el fitxer de resguard antic %s%s%s!" #: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource #, object-pascal-format msgid "Unable to remove project scaled from source.%s%s" msgstr "" #: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource #, object-pascal-format msgid "Unable to remove project title from source.%s%s" msgstr "" #: lazarusidestrconsts.lisunabletorenameambiguousfileto #, object-pascal-format msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "No es pot canviar el nom de la forma en el codi font" #: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "No es pot canviar el nom del mètode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "No es pot canviar el nom de la variable en el codi font." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" msgstr "" #: lazarusidestrconsts.lisunabletorun2 #, object-pascal-format msgid "Unable to run \"%s\"" msgstr "" #: lazarusidestrconsts.lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "" #: lazarusidestrconsts.lisunabletoshowmethod msgid "Unable to show method." msgstr "" #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "No es poden afluir els components seleccionats" #: lazarusidestrconsts.lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "" #: lazarusidestrconsts.lisunabletostreamt #, object-pascal-format msgid "Unable to stream %s:T%s." msgstr "No es pot afluir %s:T%s." #: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext #, object-pascal-format msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "No es pot transformar afluent de component binari de %s:T%s a text." #: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "No es pot actualitzar la declaració CreateForm en el codi font del projecte" #: lazarusidestrconsts.lisuncheckall msgid "Uncheck All" msgstr "" #: lazarusidestrconsts.lisundo msgctxt "lazarusidestrconsts.lisundo" msgid "Undo" msgstr "" #: lazarusidestrconsts.lisuninstall #, object-pascal-format msgid "Uninstall %s" msgstr "" #: lazarusidestrconsts.lisuninstallfail msgid "Uninstall failed" msgstr "" #: lazarusidestrconsts.lisuninstallimpossible msgid "Uninstall impossible" msgstr "" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" msgstr "Desinstal·la la selecció" #: lazarusidestrconsts.lisuninstallthemtoo msgid "Uninstall them too" msgstr "" #: lazarusidestrconsts.lisunithaschangedsave #, object-pascal-format msgid "Unit \"%s\" has changed. Save?" msgstr "" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "Ja existeix l'identificador de la unitat" #: lazarusidestrconsts.lisunitinpackage #, object-pascal-format msgid "%s unit %s in package %s" msgstr "" #: lazarusidestrconsts.lisunitmustsavebeforeinherit #, object-pascal-format msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?" msgstr "" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "El nom de la unitat ja és al projecte" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "" #: lazarusidestrconsts.lisunitnamecontains msgid "Unit name contains ..." msgstr "" #: lazarusidestrconsts.lisunitnotfound #, object-pascal-format msgid "unit %s not found" msgstr "" #: lazarusidestrconsts.lisunitnotfoundatnewposition #, object-pascal-format msgid "unit %s not found at new position \"%s\"" msgstr "" #: lazarusidestrconsts.lisunitnotfoundinfile #, object-pascal-format msgid "A unit not found in file %s" msgstr "" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" msgstr "Directori sortida de la unitat" #: lazarusidestrconsts.lisunitpath msgid "unit path" msgstr "trajectòria de les unitats" #: lazarusidestrconsts.lisunitpaths msgid "Unit paths" msgstr "" #: lazarusidestrconsts.lisunitrequirespackage #, object-pascal-format msgid "unit %s requires package %s" msgstr "" #: lazarusidestrconsts.lisunitsnotfoundinfile #, object-pascal-format msgid "Units not found in file %s" msgstr "" #: lazarusidestrconsts.lisunusedunitsof #, object-pascal-format msgid "Unused units of %s" msgstr "" #: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." msgstr "" #: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa msgid "Unusual pas2js compiler file name. Usually it starts with pas2js." msgstr "" #: lazarusidestrconsts.lisup msgctxt "lazarusidestrconsts.lisup" msgid "Up" msgstr "Amunt" #: lazarusidestrconsts.lisupdateapplicationcreateform msgid "Update Application.CreateForm statements in main unit" msgstr "" #: lazarusidestrconsts.lisupdateapplicationscaledstatement msgid "Update Application.Scaled statement in main unit" msgstr "" #: lazarusidestrconsts.lisupdateapplicationtitlestatement msgid "Update Application.Title statement in main unit" msgstr "" #: lazarusidestrconsts.lisupdateinfo msgid "Update info" msgstr "" #: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha msgid "Update other procedure signatures when only letter case has changed" msgstr "" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" msgstr "" #: lazarusidestrconsts.lisupgrade msgid "Upgrade" msgstr "" #: lazarusidestrconsts.lisupgradeconfiguration msgid "Upgrade configuration" msgstr "" #: lazarusidestrconsts.lisuppercasestring msgid "uppercase string" msgstr "" #: lazarusidestrconsts.lisuppercasestringgivenasparameter msgid "Uppercase string given as parameter." msgstr "" #: lazarusidestrconsts.lisurlonwikithebaseurlis #, object-pascal-format msgid "URL on wiki (the base url is %s)" msgstr "" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" msgstr "" #: lazarusidestrconsts.lisuse msgid "Use" msgstr "" #: lazarusidestrconsts.lisuseansistrings #, fuzzy msgctxt "lazarusidestrconsts.lisuseansistrings" msgid "Use Ansistrings" msgstr "Utilitza Ansi Strings" #: lazarusidestrconsts.lisusecheckboxforbooleanvalues msgid "Use CheckBox for Boolean values" msgstr "" #: lazarusidestrconsts.lisusecommentsincustomoptions msgid "Use comments in custom options" msgstr "" #: lazarusidestrconsts.lisusedby #, object-pascal-format msgid " used by %s" msgstr "" #: lazarusidestrconsts.lisusedesigntimepackages msgid "Use design time packages" msgstr "" #: lazarusidestrconsts.lisusedforautocreatedforms msgid "Used for auto-created forms." msgstr "" #: lazarusidestrconsts.lisusefilterforextrafiles msgid "Use filter to include extra files" msgstr "" #: lazarusidestrconsts.lisuseidentifier msgid "Use identifier" msgstr "" #: lazarusidestrconsts.lisuseidentifierinat #, object-pascal-format msgid "Use identifier %s in %s at %s" msgstr "" #: lazarusidestrconsts.lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "" #: lazarusidestrconsts.lisusepackageinpackage #, object-pascal-format msgid "Use package %s in package %s" msgstr "" #: lazarusidestrconsts.lisusepackageinpackage2 msgid "Use package in package" msgstr "" #: lazarusidestrconsts.lisusepackageinproject #, object-pascal-format msgid "Use package %s in project" msgstr "" #: lazarusidestrconsts.lisusepackageinproject2 msgid "Use package in project" msgstr "" #: lazarusidestrconsts.lisuserdefinedmarkupkeyadd #, object-pascal-format msgid "Add to list \"%s\"" msgstr "" #: lazarusidestrconsts.lisuserdefinedmarkupkeygroup msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup" msgid "User defined text markup" msgstr "" #: lazarusidestrconsts.lisuserdefinedmarkupkeyremove #, object-pascal-format msgid "Remove from list \"%s\"" msgstr "" #: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle #, object-pascal-format msgid "Toggle on list \"%s\"" msgstr "" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" msgstr "" #: lazarusidestrconsts.lisuseunit msgctxt "lazarusidestrconsts.lisuseunit" msgid "Add Unit to Uses Section" msgstr "" #: lazarusidestrconsts.lisuseunitinunit #, object-pascal-format msgid "Use unit %s in unit %s" msgstr "" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" msgstr "" #: lazarusidestrconsts.lisvalue msgctxt "lazarusidestrconsts.lisvalue" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.lisvalue2 #, object-pascal-format msgid "Value%s" msgstr "" #: lazarusidestrconsts.lisvalue3 msgid "Value: " msgstr "" #: lazarusidestrconsts.lisvalues msgid "Values" msgstr "" #: lazarusidestrconsts.lisvaluesthatarechangedfromdefault msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector." msgstr "" #: lazarusidestrconsts.lisvariable msgctxt "lazarusidestrconsts.lisvariable" msgid "Variable" msgstr "Variable" #: lazarusidestrconsts.lisverbose msgctxt "lazarusidestrconsts.lisverbose" msgid "Verbose" msgstr "" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" msgstr "" #: lazarusidestrconsts.lisversion msgid "Version" msgstr "Versió" #: lazarusidestrconsts.lisversionmismatch msgid "Version mismatch" msgstr "" #: lazarusidestrconsts.lisvertical msgid "Vertical" msgstr "Vertical" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" msgstr "" #: lazarusidestrconsts.lisveryverbose msgid "Very Verbose" msgstr "" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Vore font (.lfm)" #: lazarusidestrconsts.liswarning msgid "Warning: " msgstr "" #: lazarusidestrconsts.liswarnings #, object-pascal-format msgid ", Warnings: %s" msgstr "" #: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas #, object-pascal-format msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." msgstr "" #: lazarusidestrconsts.liswelcometolazaruside #, object-pascal-format msgid "Welcome to Lazarus IDE %s" msgstr "" #: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve #, object-pascal-format msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" msgstr "" #: lazarusidestrconsts.liswhatneedsbuilding msgid "What needs building" msgstr "" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references" msgstr "" #: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew msgid "When enabled the current options are saved to the template which is used when creating new projects" msgstr "" #: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed msgid "When there is only one possible completion item use it immediately, without showing the completion box" msgstr "" #: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein msgid "When the source editor cursor moves, show the current node in the code explorer" msgstr "" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedform msgid "Window menu shows designed form's name instead of caption" msgstr "" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint msgid "Useful especially if the caption is left empty." msgstr "" #: lazarusidestrconsts.liswindowstaysontop msgid "Window stays on top" msgstr "" #: lazarusidestrconsts.liswithincludes2 msgid ", with includes " msgstr "" #: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw msgid "Without a proper compiler the code browsing and compiling will be disappointing." msgstr "" #: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing msgid "Without a proper debugger, debugging will be disappointing." msgstr "" #: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn msgid "Without a proper Lazarus directory you will get a lot of warnings." msgstr "" #: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." msgstr "" #: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio msgid "Without the proper FPC sources code browsing and completion will be very limited." msgstr "" #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" msgstr "" #: lazarusidestrconsts.liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Paraula del cursor en l'editor actual" #: lazarusidestrconsts.lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "" #: lazarusidestrconsts.lisworkingdirectoryforrun msgid "Working directory for run" msgstr "" #: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters msgid "Write config instead of command line parameters" msgstr "" #: lazarusidestrconsts.liswritepackageinfofailed msgid "Writing the package info file failed." msgstr "" #: lazarusidestrconsts.liswriteprojectinfofailed msgid "Writing the project info file failed." msgstr "" #: lazarusidestrconsts.liswritewhatpackagefilesares msgid "Write what package files are searched and found." msgstr "" #: lazarusidestrconsts.liswrongversionin #, object-pascal-format msgid "wrong version in %s: %s" msgstr "" #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed msgid "You can disable this for individual forms via the package editor" msgstr "" #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu msgid "You can disable this for individual forms via the popup menu in the project inspector" msgstr "" #: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" msgstr "" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling #, fuzzy #| msgid "You can not build lazarus while debugging or compiling." msgid "You cannot build Lazarus while debugging or compiling." msgstr "No podeu muntar el lazarus mentre s'està depurant o compilant." #: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling msgid "You cannot change the build mode while compiling." msgstr "" #: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter msgid "You can select items by simply pressing underscored letters" msgstr "" #: lazarusidestrconsts.lis_all_ #, fuzzy msgctxt "lazarusidestrconsts.lis_all_" msgid "" msgstr "" #: lazarusidestrconsts.locwndsrceditor msgctxt "lazarusidestrconsts.locwndsrceditor" msgid "Source Editor" msgstr "Editor del codi font" #: lazarusidestrconsts.lrsplddeleteselected msgid "Delete selected" msgstr "" #: lazarusidestrconsts.lrspldinvalid msgid "invalid" msgstr "" #: lazarusidestrconsts.lrspldlpkfileinvalid #, object-pascal-format msgid "lpk file invalid (%s)" msgstr "" #: lazarusidestrconsts.lrspldlpkfilevalid #, object-pascal-format msgid "lpk file valid (%s)" msgstr "" #: lazarusidestrconsts.lrspldunabletodeletefile #, object-pascal-format msgid "Unable to delete file \"%s\"" msgstr "" #: lazarusidestrconsts.lrspldvalid msgid "valid" msgstr "" #: lazarusidestrconsts.lrsrescanlplfiles msgid "Rescan lpl files" msgstr "" #: lazarusidestrconsts.lvlgraphaddhorizontalspacing msgid "Add horizontal spacing between columns" msgstr "" #: lazarusidestrconsts.lvlgraphaddverticalspacingar msgid "Add vertical spacing around nodes" msgstr "" #: lazarusidestrconsts.lvlgraphextraspacing msgid "Extra spacing (x/y)" msgstr "" #: lazarusidestrconsts.lvlgraphnamesabovenode msgid "Names above node" msgstr "" #: lazarusidestrconsts.lvlgraphoptabsolutelimi msgid "Absolute limit for height of levels" msgstr "" #: lazarusidestrconsts.lvlgraphoptcrossings msgid "Crossings" msgstr "" #: lazarusidestrconsts.lvlgraphoptedgelen msgid "Edge len" msgstr "" #: lazarusidestrconsts.lvlgraphoptedges msgid "Edges" msgstr "" #: lazarusidestrconsts.lvlgraphoptinfo msgid "Info" msgstr "" #: lazarusidestrconsts.lvlgraphoptlevels msgctxt "lazarusidestrconsts.lvlgraphoptlevels" msgid "Levels" msgstr "" #: lazarusidestrconsts.lvlgraphoptlimitheightoflvl msgid "Limit height of Levels" msgstr "" #: lazarusidestrconsts.lvlgraphoptlimitrelativ #, object-pascal-format msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))" msgstr "" #: lazarusidestrconsts.lvlgraphoptsplitpoints msgid "Splitpoints" msgstr "" #: lazarusidestrconsts.lvlgraphreducebackedges msgid "Reduce backedges" msgstr "" #: lazarusidestrconsts.lvlgraphshapecalculatelay msgid "Calculate layout from high-edge" msgstr "" #: lazarusidestrconsts.lvlgraphshapecurved msgid "Curved" msgstr "" #: lazarusidestrconsts.lvlgraphshapeedgesshape msgid "Edges shape" msgstr "" #: lazarusidestrconsts.lvlgraphshapeedgessplitmo msgid "Edges split mode" msgstr "" #: lazarusidestrconsts.lvlgraphshapeminimizeedge msgid "Minimize edges len" msgstr "" #: lazarusidestrconsts.lvlgraphshapenodes msgid "Nodes" msgstr "" #: lazarusidestrconsts.lvlgraphshapestraight msgid "Straight" msgstr "" #: lazarusidestrconsts.lvlgraphsplitmergeathighe msgid "Merge at highest" msgstr "" #: lazarusidestrconsts.lvlgraphsplitmergeatsourc msgid "Merge at source" msgstr "" #: lazarusidestrconsts.lvlgraphsplitmergeattarge msgid "Merge at target" msgstr "" #: lazarusidestrconsts.lvlgraphsplitnone #, fuzzy msgctxt "lazarusidestrconsts.lvlgraphsplitnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.lvlgraphsplitseparate msgid "Separate" msgstr "" #: lazarusidestrconsts.lvlgraphstraightengraph msgid "Straighten graph" msgstr "" #: lazarusidestrconsts.optdispgutterchanges msgid "Changes" msgstr "" #: lazarusidestrconsts.optdispgutterfolding msgid "Folding" msgstr "" #: lazarusidestrconsts.optdispguttermarks msgid "Marks" msgstr "" #: lazarusidestrconsts.optdispgutternocurrentlinecolor msgid "No current line color" msgstr "" #: lazarusidestrconsts.optdispgutterseparator msgid "Separator" msgstr "" #: lazarusidestrconsts.optdispgutterusecurrentlinecolor msgid "Use current line color" msgstr "" #: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor msgid "Use current line number color" msgstr "" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" msgstr "" #: lazarusidestrconsts.rsaddnewterm msgid "Add new term" msgstr "" #: lazarusidestrconsts.rsattributes msgid "Attributes" msgstr "" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint msgid "Increased every time the project is compiled." msgstr "" #: lazarusidestrconsts.rsbuild msgid "&Build:" msgstr "" #: lazarusidestrconsts.rscharacterset msgid "Character set:" msgstr "" #: lazarusidestrconsts.rscloseall msgid "Close all pages" msgstr "" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page (Ctrl+F4)∥(Ctrl+W)" msgstr "" #: lazarusidestrconsts.rscloseleft msgid "Close page(s) on the left" msgstr "" #: lazarusidestrconsts.rscloseothers msgid "Close other page(s)" msgstr "" #: lazarusidestrconsts.rscloseright msgid "Close page(s) on the right" msgstr "" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" msgstr "" #: lazarusidestrconsts.rscreatenewdefine msgid "Create new define" msgstr "" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" msgstr "" #: lazarusidestrconsts.rsfilterthelistwithstring msgid "Filter the lines in list with a string (Ctrl+F)" msgstr "" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found but not listed here: " msgstr "" #: lazarusidestrconsts.rsi18nexcluded msgid "Excluded" msgstr "" #: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild msgid "Force update PO files on next build" msgstr "" #: lazarusidestrconsts.rsi18nidentifiers msgid "Identifiers:" msgstr "" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" msgstr "" #: lazarusidestrconsts.rsi18noriginals msgid "Originals:" msgstr "" #: lazarusidestrconsts.rsincludeversioninfohint msgid "Version info is stored if the executable format supports it." msgstr "" #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include version info in executable" msgstr "" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" msgstr "" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" msgstr "" #: lazarusidestrconsts.rsmajorversion msgid "&Major version:" msgstr "" #: lazarusidestrconsts.rsminorversion msgid "Mi&nor version:" msgstr "" #: lazarusidestrconsts.rsnewsearchwithsamecriteria msgid "New search with same criteria (Ctrl+N)" msgstr "" #: lazarusidestrconsts.rsotherinfo msgid "Other info" msgstr "" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" msgstr "" #: lazarusidestrconsts.rsrefreshthesearch msgid "Refresh the search (F5)" msgstr "" #: lazarusidestrconsts.rsresource msgid "Resource" msgstr "" #: lazarusidestrconsts.rsresourceclear msgid "Delete all resources?" msgstr "" #: lazarusidestrconsts.rsresourcefilename msgctxt "lazarusidestrconsts.rsresourcefilename" msgid "File name" msgstr "" #: lazarusidestrconsts.rsresourcetype msgctxt "lazarusidestrconsts.rsresourcetype" msgid "Type" msgstr "Tipus" #: lazarusidestrconsts.rsrevision msgid "&Revision:" msgstr "" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" msgstr "" #: lazarusidestrconsts.rsshowabspath msgid "Absolute path" msgstr "" #: lazarusidestrconsts.rsshowfilename msgctxt "lazarusidestrconsts.rsshowfilename" msgid "File name" msgstr "" #: lazarusidestrconsts.rsshowpathmode msgid "Path display mode (Ctrl+P)" msgstr "" #: lazarusidestrconsts.rsshowrelpath msgid "Relative path" msgstr "" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" msgstr "" #: lazarusidestrconsts.showoptions msgid "Show options" msgstr "" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" msgstr "Ordres del menú de l'ajuda" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" msgstr "Ordres de les instruccions" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" msgstr "Ordres de les eines del codi" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" msgstr "" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" msgstr "Ordres de moviment del cursor" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" msgstr "Ordres d'edició del text" #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" msgstr "Ordres de menús dels fitxers" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" msgstr "" #: lazarusidestrconsts.srkmcatmacrorecording msgctxt "lazarusidestrconsts.srkmcatmacrorecording" msgid "Macros" msgstr "Macroinstruccions" #: lazarusidestrconsts.srkmcatmarker #, fuzzy #| msgid "Text marker commands" msgid "Text bookmark commands" msgstr "Ordres de marcadors del text" #: lazarusidestrconsts.srkmcatmulticaret msgid "Multi caret commands" msgstr "" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" msgstr "" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" msgstr "Ordres del menú del projecte" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" msgstr "Ordres del menú d'execució" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Ordres de recerca i reemplaçament del text" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" msgstr "Ordres de selecció del text" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "Ordres del llibre del codi font" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditoff msgid "Syncron Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditsel msgid "Syncron Editing (while selecting)" msgstr "" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" msgstr "" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" msgstr "Ordres del menú de les eines" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" msgstr "Mostra les ordres del menú" #: lazarusidestrconsts.srkmcommand msgctxt "lazarusidestrconsts.srkmcommand" msgid "Command:" msgstr "Ordre:" #: lazarusidestrconsts.srkmconflic msgid "Conflict " msgstr "Conflicte" #: lazarusidestrconsts.srkmecabortbuild msgid "abort build" msgstr "avorta el muntatje" #: lazarusidestrconsts.srkmecabstractmethods msgid "Abstract Methods ..." msgstr "" #: lazarusidestrconsts.srkmecaddbpaddress msgid "add address breakpoint" msgstr "" #: lazarusidestrconsts.srkmecaddbpsource msgid "add source breakpoint" msgstr "" #: lazarusidestrconsts.srkmecaddbpwatchpoint msgid "add data/watchpoint" msgstr "" #: lazarusidestrconsts.srkmecaddjumppoint #, fuzzy #| msgid "Add jump point" msgid "Add Jump Point" msgstr "Afegeix un punt de salt" #: lazarusidestrconsts.srkmecaddwatch msgid "add watch" msgstr "afegeix un control" #: lazarusidestrconsts.srkmecattach msgid "Attach to program" msgstr "" #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" msgstr "Completa la plantilla del codi" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" msgstr "" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" msgstr "" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" msgstr "" #: lazarusidestrconsts.srkmecblockgotoend msgid "Goto Block end" msgstr "" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" msgstr "" #: lazarusidestrconsts.srkmecblockindent #, fuzzy #| msgid "Indent block" msgid "Indent line/block" msgstr "Sagna el bloc" #: lazarusidestrconsts.srkmecblockindentmove msgid "Indent line/block (move columns)" msgstr "" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" msgstr "" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" msgstr "" #: lazarusidestrconsts.srkmecblocksetend msgid "Set block end" msgstr "" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" msgstr "" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" msgstr "" #: lazarusidestrconsts.srkmecblockunindent #, fuzzy #| msgid "Unindent block" msgid "Unindent line/block" msgstr "Dessagna el bloc" #: lazarusidestrconsts.srkmecblockunindentmove msgid "Unindent line/block (move columns)" msgstr "" #: lazarusidestrconsts.srkmecbreakpointproperties msgid "show breakpoint properties" msgstr "" #: lazarusidestrconsts.srkmecbuild msgid "build program/project" msgstr "munta el programa/projecte" #: lazarusidestrconsts.srkmecbuildfile msgid "build file" msgstr "munta el fitxer" #: lazarusidestrconsts.srkmecbuildlazarus #, fuzzy #| msgid "Build lazarus" msgid "Build Lazarus" msgstr "Munta el Lazarus" #: lazarusidestrconsts.srkmecbuildmanymodes msgid "build many modes" msgstr "" #: lazarusidestrconsts.srkmecchar msgid "Char" msgstr "Caràcter" #: lazarusidestrconsts.srkmeccleanupandbuild msgid "clean up and build" msgstr "" #: lazarusidestrconsts.srkmecclearall msgid "Delete whole text" msgstr "Elimina tot el text" #: lazarusidestrconsts.srkmecclearallbookmark msgid "Clear all Bookmarks" msgstr "" #: lazarusidestrconsts.srkmecclearbookmarkforfile msgid "Clear Bookmarks for current file" msgstr "" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" msgstr "" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" msgstr "" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" msgstr "" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" msgstr "" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" msgstr "" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" msgstr "" #: lazarusidestrconsts.srkmeccolsellinetextstart msgid "Column Select to text start in line" msgstr "" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" msgstr "" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" msgstr "" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" msgstr "" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" msgstr "" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" msgstr "" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" msgstr "" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" msgstr "" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" msgstr "" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" msgstr "Mode de selecció de columna" #: lazarusidestrconsts.srkmeccompile msgid "compile program/project" msgstr "" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" msgstr "fitxer de configuració del muntatje" #: lazarusidestrconsts.srkmeccopy #, fuzzy #| msgid "Copy selection to clipboard" msgctxt "lazarusidestrconsts.srkmeccopy" msgid "Copy" msgstr "Copia la selecció al porta-retalls" #: lazarusidestrconsts.srkmeccopyadd msgid "Copy (Add to Clipboard)" msgstr "" #: lazarusidestrconsts.srkmeccopyaddcurrentline msgid "Copy current line (Add to Clipboard)" msgstr "" #: lazarusidestrconsts.srkmeccopycurrentline msgid "Copy current line" msgstr "" #: lazarusidestrconsts.srkmeccopyeditornewwindow msgid "Copy editor to new window" msgstr "" #: lazarusidestrconsts.srkmeccopyeditornextwindow msgid "Copy editor to next free window" msgstr "" #: lazarusidestrconsts.srkmeccopyeditorprevwindow msgid "Copy editor to prior free window" msgstr "" #: lazarusidestrconsts.srkmeccut #, fuzzy #| msgid "Cut selection to clipboard" msgctxt "lazarusidestrconsts.srkmeccut" msgid "Cut" msgstr "Retalla la selecció al porta-retalls" #: lazarusidestrconsts.srkmeccutadd msgid "Cut (Add to Clipboard)" msgstr "" #: lazarusidestrconsts.srkmeccutaddcurrentline msgid "Cut current line (Add to Clipboard)" msgstr "" #: lazarusidestrconsts.srkmeccutcurrentline msgid "Cut current line" msgstr "" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" msgstr "Elimina fins al començament de la línia" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" msgstr "Elimina el caràcter al cursor" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" msgstr "Elimina fins al final de la línia" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" msgstr "Elimina l'últim caràcter" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" msgstr "Elimina fins el principi de la paraula" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" msgstr "Elimina la línia actual" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" msgstr "Elimina fins al final de la paraula" #: lazarusidestrconsts.srkmecdetach msgid "Detach from program" msgstr "" #: lazarusidestrconsts.srkmecdiff msgctxt "lazarusidestrconsts.srkmecdiff" msgid "Diff" msgstr "Mostra les diferències" #: lazarusidestrconsts.srkmecdown msgid "Move cursor down" msgstr "" #: lazarusidestrconsts.srkmecduplicateline msgid "Duplicate line (or lines in selection)" msgstr "" #: lazarusidestrconsts.srkmecduplicateselection msgid "Duplicate selection" msgstr "" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "Mou el cursor al final de tot" #: lazarusidestrconsts.srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "Mou el cursor al principi de tot" #: lazarusidestrconsts.srkmecemptymethods msgid "Empty Methods ..." msgstr "" #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" msgstr "" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" msgstr "avalua/modifica" #: lazarusidestrconsts.srkmecextractproc #, fuzzy #| msgid "Extract procedure" msgctxt "lazarusidestrconsts.srkmecextractproc" msgid "Extract Procedure" msgstr "Extrau el procediment" #: lazarusidestrconsts.srkmecexttool #, object-pascal-format msgid "External tool %d" msgstr "Eina externa %d" #: lazarusidestrconsts.srkmecexttoolsettings msgid "External tools settings" msgstr "Paràmetres de les eines externes" #: lazarusidestrconsts.srkmecfind #, fuzzy #| msgid "Find text" msgid "Find Text" msgstr "Cerca el text" #: lazarusidestrconsts.srkmecfindblockotherend msgid "Find block other end" msgstr "Cerca l'altre cap del bloc" #: lazarusidestrconsts.srkmecfindblockstart msgid "Find block start" msgstr "Cerca l'inici del bloc" #: lazarusidestrconsts.srkmecfinddeclaration #, fuzzy #| msgid "Find declaration" msgid "Find Declaration" msgstr "Cerca la declaració" #: lazarusidestrconsts.srkmecfindidentifierrefs #, fuzzy #| msgid "Find identifier references" msgid "Find Identifier References" msgstr "Cerca les referències de l'identificador" #: lazarusidestrconsts.srkmecfindinfiles #, fuzzy #| msgid "Find in files" msgid "Find in Files" msgstr "Cerca en els fitxers" #: lazarusidestrconsts.srkmecfindnext #, fuzzy #| msgid "Find next" msgctxt "lazarusidestrconsts.srkmecfindnext" msgid "Find Next" msgstr "Cerca el següent" #: lazarusidestrconsts.srkmecfindnextwordoccurrence #, fuzzy #| msgid "Find next word occurrence" msgid "Find Next Word Occurrence" msgstr "Cerca següent ocurrència de la paraula" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find Overloads" msgstr "" #: lazarusidestrconsts.srkmecfindoverloadscapt msgid "Find Overloads ..." msgstr "" #: lazarusidestrconsts.srkmecfindprevious #, fuzzy #| msgid "Find previous" msgid "Find Previous" msgstr "Cerca l'anterior" #: lazarusidestrconsts.srkmecfindprevwordoccurrence #, fuzzy #| msgid "Find previous word occurrence" msgid "Find Previous Word Occurrence" msgstr "Cerca ocurrència prèvia de la paraula" #: lazarusidestrconsts.srkmecfindproceduredefinition #, fuzzy #| msgid "Find procedure definiton" msgid "Find Procedure Definiton" msgstr "Cerca la definició del procediment" #: lazarusidestrconsts.srkmecfindproceduremethod #, fuzzy #| msgid "Find procedure method" msgid "Find Procedure Method" msgstr "Cerca el mètode del procediment" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecfoldlevel #, object-pascal-format msgid "Fold to Level %d" msgstr "" #: lazarusidestrconsts.srkmecgotoeditor #, object-pascal-format msgid "Go to editor %d" msgstr "Vés a l'editor %d" #: lazarusidestrconsts.srkmecgotoincludedirective #, fuzzy #| msgid "Go to to include directive of current include file" msgid "Go to include directive of current include file" msgstr "Vés a la directiva include del fitxer inclòs actual" #: lazarusidestrconsts.srkmecgotolinenumber #, fuzzy #| msgid "Go to line number" msgid "Go to Line Number" msgstr "Vés a la línia número" #: lazarusidestrconsts.srkmecgotomarker #, object-pascal-format, fuzzy #| msgid "Go to Marker %d" msgid "Go to bookmark %d" msgstr "Vés al marcador %d" #: lazarusidestrconsts.srkmecgotoxy msgid "Goto XY" msgstr "Vés a XY" #: lazarusidestrconsts.srkmecguessmisplacedifdef #, fuzzy #| msgid "Guess misplaced $IFDEF" msgid "Guess Misplaced $IFDEF" msgstr "Suposa $IFDEF inexistent" #: lazarusidestrconsts.srkmechalfwordleft msgid "Move cursor part-word left (e.g. CamelCase)" msgstr "" #: lazarusidestrconsts.srkmechalfwordright msgid "Move cursor part-word right (e.g. CamelCase)" msgstr "" #: lazarusidestrconsts.srkmecimestr msgid "Ime Str" msgstr "Ime Str" #: lazarusidestrconsts.srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "Insereix entrada de registres de canvis" #: lazarusidestrconsts.srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "Insereix desde el mapa de caràcters" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "Insereix paraula clau CVS Author" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "Insereix paraula clau CVS Date" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "Insereix paraula clau CVS Header" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "Insereix paraula clau CVS ID" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "Insereix paraula clau CVS Log" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "Insereix paraula clau CVS Name" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "Insereix paraula clau CVS Revision" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "Insereix paraula clau CVS Source" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" msgstr "Insereix data i hora actuals" #: lazarusidestrconsts.srkmecinsertfilename msgid "Insert Full Filename" msgstr "" #: lazarusidestrconsts.srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "Insereix comentari GPL" #: lazarusidestrconsts.srkmecinsertgplnoticetranslated msgid "Insert GPL notice (translated)" msgstr "" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" msgstr "" #: lazarusidestrconsts.srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "Insereix comentari LGPL" #: lazarusidestrconsts.srkmecinsertlgplnoticetranlated msgid "Insert LGPL notice (translated)" msgstr "" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" msgstr "Interromp la línia, deixa el cursor" #: lazarusidestrconsts.srkmecinsertmitnotice msgid "Insert MIT notice" msgstr "" #: lazarusidestrconsts.srkmecinsertmitnoticetranslated msgid "Insert MIT notice (translated)" msgstr "" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" msgstr "Mode inserir" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated msgid "Insert modified LGPL notice (translated)" msgstr "" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" msgstr "Insereix nom d'usuari actual" #: lazarusidestrconsts.srkmecinspect msgid "inspect" msgstr "inspeccionar" #: lazarusidestrconsts.srkmecinvertassignment #, fuzzy #| msgid "Invert assignment" msgctxt "lazarusidestrconsts.srkmecinvertassignment" msgid "Invert Assignment" msgstr "Inverteix l'assignació" #: lazarusidestrconsts.srkmeckeymapleft #, fuzzy msgctxt "lazarusidestrconsts.srkmeckeymapleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.srkmeckeymapright #, fuzzy msgctxt "lazarusidestrconsts.srkmeckeymapright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.srkmecleft msgid "Move cursor left" msgstr "" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" msgstr "Interromp la línia i mou el cursor" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" msgstr "Mou el cursor al final de la línia" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" msgstr "Mode de selecció de línia" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" msgstr "Mou el cursor al principi de la línia" #: lazarusidestrconsts.srkmeclinetextstart msgid "Move cursor to text start in line" msgstr "" #: lazarusidestrconsts.srkmeclockeditor msgid "Lock Editor" msgstr "" #: lazarusidestrconsts.srkmecmakeresourcestring #, fuzzy #| msgid "Make resource string" msgid "Make Resource String" msgstr "Fes cadena del recurs" #: lazarusidestrconsts.srkmecmatchbracket msgid "Go to matching bracket" msgstr "Vés al claudàtor coincident" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" msgstr "Mou l'editor a l'esquerra" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "" #: lazarusidestrconsts.srkmecmoveeditornewwindow msgid "Move editor to new window" msgstr "" #: lazarusidestrconsts.srkmecmoveeditornextwindow msgid "Move editor to next free window" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorprevwindow msgid "Move editor to prior free window" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" msgstr "Mou l'editor a la dreta" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "" #: lazarusidestrconsts.srkmecmovelinedown msgid "Move line down" msgstr "" #: lazarusidestrconsts.srkmecmovelineup msgid "Move line up" msgstr "" #: lazarusidestrconsts.srkmecmoveselectdown msgid "Move selection down" msgstr "" #: lazarusidestrconsts.srkmecmoveselectleft msgid "Move selection left" msgstr "" #: lazarusidestrconsts.srkmecmoveselectright msgid "Move selection right" msgstr "" #: lazarusidestrconsts.srkmecmoveselectup msgid "Move selection up" msgstr "" #: lazarusidestrconsts.srkmecmultipaste msgctxt "lazarusidestrconsts.srkmecmultipaste" msgid "MultiPaste" msgstr "" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" msgstr "Següent Marcador" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" msgstr "Vés al següent editor" #: lazarusidestrconsts.srkmecnexteditorinhistory msgid "Go to next editor in history" msgstr "" #: lazarusidestrconsts.srkmecnextsharededitor msgid "Go to next editor with same Source" msgstr "" #: lazarusidestrconsts.srkmecnextwindow msgid "Go to next window" msgstr "" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" msgstr "Mode de selecció normal" #: lazarusidestrconsts.srkmecopenfileatcursor #, fuzzy #| msgid "Open file at cursor" msgid "Open File at Cursor" msgstr "Obre el fitxer al cursor" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" msgstr "Mode substituir" #: lazarusidestrconsts.srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "Mou el cursor al final de la pàgina" #: lazarusidestrconsts.srkmecpagedown msgid "Move cursor down one page" msgstr "Mou el cursor una pàgina avall" #: lazarusidestrconsts.srkmecpageleft msgid "Move cursor left one page" msgstr "Mou el cursor una pàgina a l'esquerra" #: lazarusidestrconsts.srkmecpageright msgid "Move cursor right one page" msgstr "Mou el cursor una pàgina a la dreta" #: lazarusidestrconsts.srkmecpagetop msgid "Move cursor to top of page" msgstr "Mou el cursor a l'inici de la pàgina" #: lazarusidestrconsts.srkmecpageup msgid "Move cursor up one page" msgstr "Mou el cursor una pàgina amunt" #: lazarusidestrconsts.srkmecpaste #, fuzzy #| msgid "Paste clipboard to current position" msgctxt "lazarusidestrconsts.srkmecpaste" msgid "Paste" msgstr "Enganxa el porta-retalls a la posició actual" #: lazarusidestrconsts.srkmecpasteascolumns msgid "Paste (as Columns)" msgstr "" #: lazarusidestrconsts.srkmecpause msgid "pause program" msgstr "pausa el programa" #: lazarusidestrconsts.srkmecpluginmulticaretclearall msgid "Clear all extra carets" msgstr "" #: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove msgid "Cursor keys clear all extra carets" msgstr "" #: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall msgid "Cursor keys move all extra carets" msgstr "" #: lazarusidestrconsts.srkmecpluginmulticaretsetcaret msgid "Add extra caret" msgstr "" #: lazarusidestrconsts.srkmecpluginmulticarettogglecaret msgid "Toggle extra caret" msgstr "" #: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret msgid "Remove extra caret" msgstr "" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" msgstr "Marcador Previ" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" msgstr "Vés a l'editor anterior" #: lazarusidestrconsts.srkmecpreveditorinhistory msgid "Go to previous editor in history" msgstr "" #: lazarusidestrconsts.srkmecprevsharededitor msgid "Go to prior editor with same Source" msgstr "" #: lazarusidestrconsts.srkmecprevwindow msgid "Go to prior window" msgstr "" #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" msgstr "Compila ràpidament, no enllaçes" #: lazarusidestrconsts.srkmecremovebreakpoint #, fuzzy #| msgid "remove break point" msgid "remove breakpoint" msgstr "elimina el punt de ruptura" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove Empty Methods" msgstr "" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove Unused Units" msgstr "" #: lazarusidestrconsts.srkmecrenameidentifier #, fuzzy #| msgid "Rename identifier" msgid "Rename Identifier" msgstr "Canvia el nom de l'identificador" #: lazarusidestrconsts.srkmecreplace #, fuzzy #| msgid "Replace text" msgid "Replace Text" msgstr "Substitueix el text" #: lazarusidestrconsts.srkmecreportingbug msgctxt "lazarusidestrconsts.srkmecreportingbug" msgid "Reporting a bug" msgstr "" #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" msgstr "reinicia el depurador" #: lazarusidestrconsts.srkmecright msgid "Move cursor right" msgstr "" #: lazarusidestrconsts.srkmecrun msgid "run program" msgstr "executa el programa" #: lazarusidestrconsts.srkmecrunfile msgid "run file" msgstr "executa el fitxer" #: lazarusidestrconsts.srkmecrunparameters msgid "run parameters" msgstr "executa els paràmetres" #: lazarusidestrconsts.srkmecrunwithdebugging msgid "run with debugging" msgstr "" #: lazarusidestrconsts.srkmecrunwithoutdebugging msgid "run without debugging" msgstr "" #: lazarusidestrconsts.srkmecscrolldown msgid "Scroll down one line" msgstr "Desplaça una línia avall" #: lazarusidestrconsts.srkmecscrollleft msgid "Scroll left one char" msgstr "Desplaça un caràcter a l'esquerra" #: lazarusidestrconsts.srkmecscrollright msgid "Scroll right one char" msgstr "Desplaça un caràcter a la dreta" #: lazarusidestrconsts.srkmecscrollup msgid "Scroll up one line" msgstr "Desplaça una línia amunt" #: lazarusidestrconsts.srkmecseldown msgid "Select Down" msgstr "Selecciona avall" #: lazarusidestrconsts.srkmecselectall msgctxt "lazarusidestrconsts.srkmecselectall" msgid "Select All" msgstr "Selecciona-ho tot" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Converteix els tabuladors en espais en la selecció" #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" msgstr "Selecciona fins al final" #: lazarusidestrconsts.srkmecseleditortop msgid "Select to absolute beginning" msgstr "Selecciona fins al començament" #: lazarusidestrconsts.srkmecselgotoxy msgid "Select Goto XY" msgstr "Selecciona anar a XY" #: lazarusidestrconsts.srkmecselhalfwordleft msgid "Select part-word left (e.g. CamelCase)" msgstr "" #: lazarusidestrconsts.srkmecselhalfwordright msgid "Select part-word right (e.g. CamelCase)" msgstr "" #: lazarusidestrconsts.srkmecselleft #, fuzzy #| msgid "SelLeft" msgid "Select Left" msgstr "Alinea a l'esquerra" #: lazarusidestrconsts.srkmecsellineend msgctxt "lazarusidestrconsts.srkmecsellineend" msgid "Select Line End" msgstr "Selecciona al final de la línia" #: lazarusidestrconsts.srkmecsellinestart msgctxt "lazarusidestrconsts.srkmecsellinestart" msgid "Select Line Start" msgstr "Selecciona al començament de la línia" #: lazarusidestrconsts.srkmecsellinetextstart msgid "Select to text start in line" msgstr "" #: lazarusidestrconsts.srkmecselpagebottom msgctxt "lazarusidestrconsts.srkmecselpagebottom" msgid "Select Page Bottom" msgstr "Selecciona la pàgina inferior" #: lazarusidestrconsts.srkmecselpagedown msgid "Select Page Down" msgstr "Selecciona la pàgina de sota" #: lazarusidestrconsts.srkmecselpageleft msgid "Select Page Left" msgstr "Selecciona la pàgina de l'esquerra" #: lazarusidestrconsts.srkmecselpageright msgid "Select Page Right" msgstr "Selecciona la pàgina de la dreta" #: lazarusidestrconsts.srkmecselpagetop msgctxt "lazarusidestrconsts.srkmecselpagetop" msgid "Select Page Top" msgstr "Selecciona la pàgina superior" #: lazarusidestrconsts.srkmecselpageup msgid "Select Page Up" msgstr "Selecciona la pàgina d'amunt" #: lazarusidestrconsts.srkmecselright #, fuzzy #| msgid "SelRight" msgid "Select Right" msgstr "Alinea a la dreta" #: lazarusidestrconsts.srkmecselsmartwordleft msgid "Smart select word left (start/end of word)" msgstr "" #: lazarusidestrconsts.srkmecselsmartwordright msgid "Smart select word right (start/end of word)" msgstr "" #: lazarusidestrconsts.srkmecselsticky msgid "Start sticky selecting" msgstr "" #: lazarusidestrconsts.srkmecselstickycol msgid "Start sticky selecting (Columns)" msgstr "" #: lazarusidestrconsts.srkmecselstickyline msgid "Start sticky selecting (Line)" msgstr "" #: lazarusidestrconsts.srkmecselstickystop msgid "Stop sticky selecting" msgstr "" #: lazarusidestrconsts.srkmecselup msgid "Select Up" msgstr "Selecciona amunt" #: lazarusidestrconsts.srkmecselwordendleft msgid "Select word-end left" msgstr "" #: lazarusidestrconsts.srkmecselwordendright msgid "Select word-end right" msgstr "" #: lazarusidestrconsts.srkmecselwordleft msgctxt "lazarusidestrconsts.srkmecselwordleft" msgid "Select Word Left" msgstr "Selecciona una paraula a l'esquerra" #: lazarusidestrconsts.srkmecselwordright msgctxt "lazarusidestrconsts.srkmecselwordright" msgid "Select Word Right" msgstr "Selecciona una paraula a la dreta" #: lazarusidestrconsts.srkmecsetfreebookmark msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts.srkmecsetmarker #, object-pascal-format, fuzzy #| msgid "Set Marker %d" msgid "Set bookmark %d" msgstr "Posiciona el marcador %d" #: lazarusidestrconsts.srkmecshifttab msgid "Shift Tab" msgstr "Shift Tab" #: lazarusidestrconsts.srkmecshowabstractmethods msgid "Show Abstract Methods" msgstr "" #: lazarusidestrconsts.srkmecshowcodecontext msgid "Show Code Context" msgstr "" #: lazarusidestrconsts.srkmecshowexecutionpoint msgid "show execution point" msgstr "" #: lazarusidestrconsts.srkmecsmartwordleft msgid "Smart move cursor left (start/end of word)" msgstr "" #: lazarusidestrconsts.srkmecsmartwordright msgid "Smart move cursor right (start/end of word)" msgstr "" #: lazarusidestrconsts.srkmecstopprogram msgid "stop program" msgstr "atura el programa" #: lazarusidestrconsts.srkmecsynmacroplay msgid "Play Macro" msgstr "" #: lazarusidestrconsts.srkmecsynmacrorecord msgid "Record Macro" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedaddcell msgid "Add Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase msgid "Add Cell (case-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx msgid "Add Cell (context-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase msgid "Add Cell (context & case-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedcellend msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" msgid "Goto last pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedcellhome msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" msgid "Goto first pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedcellselect msgid "Select Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroeddelcell msgid "Remove current Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedescape msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft msgid "Grow cell on the left" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright msgid "Grow cell on the right" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" msgid "Next Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" msgid "Next Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell" msgid "Next Cell (firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel" msgid "Next Cell (all selected / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" msgid "Previous Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" msgid "Previous Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell" msgid "Previous Cell (firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel" msgid "Previous Cell (all selected / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft msgid "Shrink cell on the left" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright msgid "Shrink cell on the right" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedstart msgid "Start Syncro edit" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedstartcase msgid "Start Syncro edit (case-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedstartctx msgid "Start Syncro edit (context-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase msgid "Start Syncro edit (context & case-sensitive)" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellend msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" msgid "Goto last pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellhome msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" msgid "Goto first pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellselect msgid "Select cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledescape msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledfinish msgid "Finish" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" msgid "Next Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellselrotate msgid "Next Cell (rotate / all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextfirstcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell" msgid "Next Cell (firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate msgid "Next Cell (rotate / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel" msgid "Next Cell (all selected / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate msgid "Next Cell (rotate / all selected / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" msgid "Previous Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevfirstcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell" msgid "Previous Cell (firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel" msgid "Previous Cell (all selected / firsts only)" msgstr "" #: lazarusidestrconsts.srkmecsyntaxcheck #, fuzzy #| msgid "Syntax check" msgid "Syntax Check" msgstr "Comprova la sintaxi" #: lazarusidestrconsts.srkmectoggleassembler msgid "View assembler" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle breakpoint" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpointenabled msgid "enable/disable breakpoint" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" msgstr "Mostra els punts de ruptura" #: lazarusidestrconsts.srkmectogglecallstack msgid "View call stack" msgstr "Mostra la pila de les crides" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" msgstr "" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Mostra l'explorador del codi" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" msgstr "Vore paleta de components" #: lazarusidestrconsts.srkmectoggledebuggerout msgid "View debugger output" msgstr "Mostra la sortida del depurador" #: lazarusidestrconsts.srkmectoggleformunit msgid "Switch between form and unit" msgstr "Commutar entre forma i unitat" #: lazarusidestrconsts.srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" msgid "View IDE speed buttons" msgstr "" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" msgstr "Mostra les variables locals" #: lazarusidestrconsts.srkmectogglemarker #, object-pascal-format msgid "Toggle bookmark %d" msgstr "" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" msgstr "" #: lazarusidestrconsts.srkmectogglememviewer msgctxt "lazarusidestrconsts.srkmectogglememviewer" msgid "View Mem viewer" msgstr "" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" msgstr "Mostra els missatges" #: lazarusidestrconsts.srkmectogglemode msgid "Toggle Mode" msgstr "Canvia el mode" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Mostra l'inspector dels objectes" #: lazarusidestrconsts.srkmectoggleregisters msgid "View registers" msgstr "" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" msgstr "Mostra els resultats de recerca" #: lazarusidestrconsts.srkmectogglesourceeditor msgid "View Source Editor" msgstr "Mostra l'editor del codi font" #: lazarusidestrconsts.srkmectogglewatches msgid "View watches" msgstr "Mostra els controls" #: lazarusidestrconsts.srkmecunfoldall msgctxt "lazarusidestrconsts.srkmecunfoldall" msgid "Unfold all" msgstr "" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" msgstr "ordre de l'editor desconeguda" #: lazarusidestrconsts.srkmecunusedunits msgid "Unused Units ..." msgstr "" #: lazarusidestrconsts.srkmecup msgid "Move cursor up" msgstr "" #: lazarusidestrconsts.srkmecviewanchoreditor msgid "View anchor editor" msgstr "Mostra l'editor de les àncores" #: lazarusidestrconsts.srkmecviewcomponents msgid "View components" msgstr "" #: lazarusidestrconsts.srkmecvieweditormacros msgid "View editor macros" msgstr "" #: lazarusidestrconsts.srkmecviewforms msgid "View forms" msgstr "Mostra les formes" #: lazarusidestrconsts.srkmecviewhistory msgctxt "lazarusidestrconsts.srkmecviewhistory" msgid "View History" msgstr "" #: lazarusidestrconsts.srkmecviewpseudoterminal msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal" msgid "View console in/output" msgstr "" #: lazarusidestrconsts.srkmecviewtaborder msgid "View Tab Order" msgstr "" #: lazarusidestrconsts.srkmecviewthreads msgctxt "lazarusidestrconsts.srkmecviewthreads" msgid "View Threads" msgstr "" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Mostra les dependències de les unitats" #: lazarusidestrconsts.srkmecviewunitinfo msgid "View unit information" msgstr "Mostra l'informació de la unitat" #: lazarusidestrconsts.srkmecviewunits msgid "View units" msgstr "Mostra les unitats" #: lazarusidestrconsts.srkmecwordcompletion #, fuzzy #| msgid "Word completion" msgid "Word Completion" msgstr "Completa la paraula" #: lazarusidestrconsts.srkmecwordendleft msgid "Move cursor word-end left" msgstr "" #: lazarusidestrconsts.srkmecwordendright msgid "Move cursor word-end right" msgstr "" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" msgstr "Mou el cursor una paraula a l'esquerra" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" msgstr "Mou el cursor una paraula a la dreta" #: lazarusidestrconsts.srkmeczoomin msgid "Zoom in" msgstr "" #: lazarusidestrconsts.srkmeczoomout msgid "Zoom out" msgstr "" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" msgstr "" #: lazarusidestrconsts.synfcontinuewithnextmouseupaction msgid "Continue with next mouse up action" msgstr "" #: lazarusidestrconsts.synffoldcomments msgid "Fold comments" msgstr "" #: lazarusidestrconsts.synffoldcommentsinselection msgid "Fold comments in selection" msgstr "" #: lazarusidestrconsts.synffoldinactiveifdef msgid "Fold inactive Ifdef" msgstr "" #: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate msgid "Fold inactive Ifdef (exclude mixed state)" msgstr "" #: lazarusidestrconsts.synffoldinactiveifdefinselection msgid "Fold inactive Ifdef in selection" msgstr "" #: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate msgid "Fold inactive Ifdef in selection (exclude mixed state)" msgstr "" #: lazarusidestrconsts.synfhidecomments msgid "Hide comments" msgstr "" #: lazarusidestrconsts.synfhidecommentsinselection msgid "Hide comments in selection" msgstr "" #: lazarusidestrconsts.synfmatchactionbuttonofmousedown msgid "Match action button of mouse down" msgstr "" #: lazarusidestrconsts.synfmatchactionlineofmousedown msgid "Match action line of mouse down" msgstr "" #: lazarusidestrconsts.synfmatchactionmodifiersofmousedown msgid "Match action modifiers of mouse down" msgstr "" #: lazarusidestrconsts.synfmatchactionposofmousedown msgid "Match action pos of mouse down" msgstr "" #: lazarusidestrconsts.synfsearchallactionofmousedown msgid "Search all action of mouse down" msgstr "" #: lazarusidestrconsts.synfunfoldactiveifdef msgid "Unfold active Ifdef" msgstr "" #: lazarusidestrconsts.synfunfoldactiveifdefinselection msgid "Unfold active Ifdef in selection" msgstr "" #: lazarusidestrconsts.synfunfoldall msgctxt "lazarusidestrconsts.synfunfoldall" msgid "Unfold all" msgstr "" #: lazarusidestrconsts.synfunfoldallifdef msgid "Unfold all Ifdef" msgstr "" #: lazarusidestrconsts.synfunfoldallifdefinselection msgid "Unfold all Ifdef in selection" msgstr "" #: lazarusidestrconsts.synfunfoldallinselection msgid "Unfold all in selection" msgstr "" #: lazarusidestrconsts.synfunfoldcomments msgid "Unfold comments" msgstr "" #: lazarusidestrconsts.synfunfoldcommentsinselection msgid "Unfold comments in selection" msgstr "" #: lazarusidestrconsts.synfunfoldinactiveifdef msgid "Unfold inactive Ifdef" msgstr "" #: lazarusidestrconsts.synfunfoldinactiveifdefinselection msgid "Unfold inactive Ifdef in selection" msgstr "" #: lazarusidestrconsts.uefilerocap msgid "File is readonly" msgstr "El fitxer és només de lectura" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" msgstr "El fitxer \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." msgstr "\" no es pot escriure" #: lazarusidestrconsts.uelocked msgid "Locked" msgstr "" #: lazarusidestrconsts.uemacrorecording msgid "Recording" msgstr "" #: lazarusidestrconsts.uemacrorecordingpaused msgid "Rec-pause" msgstr "" #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Afegeix &Control al cursor" #: lazarusidestrconsts.uemaddwatchpointatcursor msgid "Add Watch&Point At Cursor" msgstr "" #: lazarusidestrconsts.uembookmarknset #, object-pascal-format msgid "Bookmark &%s: %s" msgstr "" #: lazarusidestrconsts.uembookmarknunset #, object-pascal-format msgid "Bookmark &%s" msgstr "" #: lazarusidestrconsts.uembookmarknunsetdisabled #, object-pascal-format msgid "Bookmark %s" msgstr "" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" msgstr "" #: lazarusidestrconsts.uemcloseotherpagesplain msgid "Close All Other Pages" msgstr "" #: lazarusidestrconsts.uemcloseotherpagesright msgid "Close Pages on the &Right" msgstr "" #: lazarusidestrconsts.uemcloseotherpagesrightplain msgid "Close Pages on the Right" msgstr "" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" msgstr "Tan&ca la pàgina" #: lazarusidestrconsts.uemcopyfilename msgid "Copy Filename" msgstr "" #: lazarusidestrconsts.uemcopytonewwindow msgid "Clone to New Window" msgstr "" #: lazarusidestrconsts.uemcopytootherwindow msgid "Clone to Other Window" msgstr "" #: lazarusidestrconsts.uemcopytootherwindownew msgctxt "lazarusidestrconsts.uemcopytootherwindownew" msgid "New Window" msgstr "" #: lazarusidestrconsts.uemdebugword msgctxt "lazarusidestrconsts.uemdebugword" msgid "Debug" msgstr "Depuració" #: lazarusidestrconsts.uemencoding msgid "Encoding" msgstr "" #: lazarusidestrconsts.uemevaluatemodify msgid "&Evaluate/Modify ..." msgstr "" #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" msgstr "&Cerca la declaració" #: lazarusidestrconsts.uemfindinotherwindow msgid "Find in other Window" msgstr "" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" msgstr "&Vés al marcador" #: lazarusidestrconsts.uemgotobookmarks msgid "Goto Bookmark ..." msgstr "" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" msgstr "" #: lazarusidestrconsts.ueminspect #, fuzzy msgctxt "lazarusidestrconsts.ueminspect" msgid "&Inspect ..." msgstr "Inspecciona ..." #: lazarusidestrconsts.ueminvertassignment #, fuzzy msgctxt "lazarusidestrconsts.ueminvertassignment" msgid "Invert Assignment" msgstr "Inverteix l'assignació" #: lazarusidestrconsts.uemlineending msgid "Line Ending" msgstr "" #: lazarusidestrconsts.uemlockpage msgid "&Lock Page" msgstr "" #: lazarusidestrconsts.uemmovepageleft msgid "Move Page Left" msgstr "" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move Page Leftmost" msgstr "" #: lazarusidestrconsts.uemmovepageright msgid "Move Page Right" msgstr "" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move Page Rightmost" msgstr "" #: lazarusidestrconsts.uemmovetonewwindow msgid "Move to New Window" msgstr "" #: lazarusidestrconsts.uemmovetootherwindow msgid "Move to Other Window" msgstr "" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" msgid "New Window" msgstr "" #: lazarusidestrconsts.uemnextbookmark #, fuzzy #| msgid "Goto next Bookmark" msgid "Goto Next Bookmark" msgstr "Ves al següent Marcador" #: lazarusidestrconsts.uemodified msgid "Modified" msgstr "Modificat" #: lazarusidestrconsts.uemopenfileatcursor #, fuzzy #| msgid "&Open file at cursor" msgid "&Open File at Cursor" msgstr "&Obre el fitxer al cursor" #: lazarusidestrconsts.uemprevbookmark #, fuzzy #| msgid "Goto previous Bookmark" msgid "Goto Previous Bookmark" msgstr "Ves al Marcador anterior" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" msgstr "" #: lazarusidestrconsts.uemreadonly msgctxt "lazarusidestrconsts.uemreadonly" msgid "Read Only" msgstr "Només lectura" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" msgstr "Torna a factoritzar" #: lazarusidestrconsts.uemsetfreebookmark #, fuzzy #| msgid "Set a free Bookmark" msgctxt "lazarusidestrconsts.uemsetfreebookmark" msgid "Set a Free Bookmark" msgstr "Estableix un Marcador lliure" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" msgstr "Mostra nombre de línia" #: lazarusidestrconsts.uemsource msgctxt "lazarusidestrconsts.uemsource" msgid "Source" msgstr "" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" msgstr "" #: lazarusidestrconsts.uemtogglebookmarknset #, object-pascal-format msgid "Toggle Bookmark &%s: %s" msgstr "" #: lazarusidestrconsts.uemtogglebookmarknunset #, object-pascal-format msgid "Toggle Bookmark &%s" msgstr "" #: lazarusidestrconsts.uemtogglebookmarks msgid "Toggle Bookmark ..." msgstr "" #: lazarusidestrconsts.uemtogglebreakpoint msgid "Toggle &Breakpoint" msgstr "" #: lazarusidestrconsts.uemviewcallstack msgctxt "lazarusidestrconsts.uemviewcallstack" msgid "View Call Stack" msgstr "Mostra la pila de les crides" #: lazarusidestrconsts.uenotimplcap msgid "Not implemented yet" msgstr "Encara no està implementat" #: lazarusidestrconsts.uepins msgid "INS" msgstr "INS" #: lazarusidestrconsts.uepovr msgid "OVR" msgstr "OVR" #: lazarusidestrconsts.uepreadonly msgid "Readonly" msgstr "Només de lectura" #: lazarusidestrconsts.uepselchars #, object-pascal-format msgid "%d" msgstr "" #: lazarusidestrconsts.uepselcol msgid "COL" msgstr "" #: lazarusidestrconsts.uepselcxchars #, object-pascal-format msgid "%d * %d" msgstr "" #: lazarusidestrconsts.uepselline #, fuzzy #| msgid "Line" msgctxt "lazarusidestrconsts.uepselline" msgid "LINE" msgstr "Línia" #: lazarusidestrconsts.uepselnorm msgid "DEF" msgstr "" #: lazarusidestrconsts.unitdepoptionsforpackage msgid "Options for Package graph" msgstr "" #: lazarusidestrconsts.unitdepoptionsforunit msgid "Options for Unit graph" msgstr "" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" msgstr "Informació de la versió"