msgid "" msgstr "" "Project-Id-Version: Lazarus ide\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 18.06.2019\n" "PO-Revision-Date: 2024-05-06 03:27+0000\n" "Last-Translator: Onur ERÇELEN \n" "Language-Team: Turkish (Turkey)\n" "Language: tr-TR\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Loco-Source-Locale: tr_TR\n" "X-Generator: Loco https://localise.biz/\n" "X-Poedit-SourceCharset: UTF-8\n" "X-Poedit-Flags-xgettext: --add-comments=\"TRANSLATORS: Onur ERÇELEN \"\n" "X-Loco-Parser: loco_parse_po" #: lazarusidestrconsts.cocoamfstbicommand msgid "Command" msgstr "" #: lazarusidestrconsts.cocoamfstbijumpback #, fuzzy msgctxt "lazarusidestrconsts.cocoamfstbijumpback" msgid "Jump Back" msgstr "Geri Atla" #: lazarusidestrconsts.cocoamfstbijumpforward #, fuzzy msgctxt "lazarusidestrconsts.cocoamfstbijumpforward" msgid "Jump Forward" msgstr "İleriye Atla" #: lazarusidestrconsts.cocoamfstbisearch msgid "Search Instantly" msgstr "" #: lazarusidestrconsts.dbgasmwindowlinktarget msgid "Link target line" msgstr "Bağlantı hedef hattı" #: lazarusidestrconsts.dbgasmwindowsourcefunc msgid "Function name" msgstr "Fonksiyon adı" #: lazarusidestrconsts.dbgasmwindowsourceline msgid "Source line" msgstr "Kaynak hattı" #: lazarusidestrconsts.dbgeventbreakaddressbreakpoint #, object-pascal-format msgid "Address Breakpoint %s" msgstr "Adres Kesişim noktası %s" #: lazarusidestrconsts.dbgeventbreakataddress #, object-pascal-format msgid "at $%s" msgstr "$%s adresinde" #: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline #, object-pascal-format msgid "at $%s: from origin %s line %d" msgstr "$%s adresinde: %s satır %d" #: lazarusidestrconsts.dbgeventbreakataddresssourceline #, object-pascal-format msgid "at $%s: %s line %d" msgstr "$%s adresinde: %s satır %d" #: lazarusidestrconsts.dbgeventbreaksourcebreakpoint #, object-pascal-format msgid "Source Breakpoint %s" msgstr "Kaynak Kesme Noktası %s" #: lazarusidestrconsts.dbgeventbreakunknownbreakpoint #, object-pascal-format msgid "Unknown Breakpoint %s" msgstr "Bilinmeyen Kesme Noktası %s" #: lazarusidestrconsts.dbgeventbreakwatchpoint #, object-pascal-format msgid "Watchpoint %s" msgstr "İzleme Noktası %s" #: lazarusidestrconsts.dbgeventunknownwatchpointscopeended #, object-pascal-format msgid "Unknown Watchpoint out of scope %s" msgstr "Bilinmeyen İzleme Noktası kapsam dışında %s" #: lazarusidestrconsts.dbgeventunknownwatchpointtriggered #, object-pascal-format msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\"" msgstr "Bilinmeyen İzleme Noktası tetiklendi %s. Eski değer \"%s\", Yeni Değer \"%s\"" #: lazarusidestrconsts.dbgeventwatchscopeended #, object-pascal-format msgid "Watchpoint for \"%s\" out of scope %s" msgstr "\"%s\" için İzleme Noktası kapsam dışında %s" #: lazarusidestrconsts.dbgeventwatchtriggered #, object-pascal-format msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\"" msgstr "\"%s\" için izleme noktası %s olarak tetiklendi. Eski değer \"%s\", Yeni Değer \"%s\"" #: lazarusidestrconsts.dlfmousepredefinedscheme msgid "Use predefined scheme" msgstr "Öntanımlı düzeni kullan" #: lazarusidestrconsts.dlfmouseresetall msgid "Reset all settings" msgstr "Tüm ayarları sıfırla" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" msgstr "Tüm oluk ayarlarını sıfırla" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" msgstr "Tüm metin ayarlarını sıfırla" #: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint msgid "Add history point" msgstr "Geçmiş noktası ekle" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu msgid "Context Menu" msgstr "İçerik Menüsü" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg msgid "Context Menu (debug)" msgstr "İçerik Menüsü (hata ayıklama)" #: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab msgid "Context Menu (tab)" msgstr "İçerik Menüsü (sekme)" #: lazarusidestrconsts.dlfmousesimplebuttondeclaration msgid "Jumps to implementation" msgstr "İmplementation a atla" #: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock msgid "Jumps to implementation/other block end" msgstr "İmplementation/diğer blok sonuna atla" #: lazarusidestrconsts.dlfmousesimplebuttonhistback msgid "History back" msgstr "Geçmiş geri" #: lazarusidestrconsts.dlfmousesimplebuttonhistforw msgid "History forward" msgstr "Geçmiş İleri" #: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle msgid "Toggle extra Caret" msgstr "Ekstra imleç aç/kapat" #: lazarusidestrconsts.dlfmousesimplebuttonnothing msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing" msgid "Nothing/Default" msgstr "Hiçbir şey/Varsayılan" #: lazarusidestrconsts.dlfmousesimplebuttonpaste msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste" msgid "Paste" msgstr "Yapıştır" #: lazarusidestrconsts.dlfmousesimplebuttonselcontinue #, object-pascal-format msgid "Continue %0:s (Bound to: %1:s)" msgstr "Devam et %0:s (%1:s bağlı)" #: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain #, object-pascal-format msgid "Continue %0:s" msgstr "Devam et %0:s" #: lazarusidestrconsts.dlfmousesimplebuttonselect msgid "Select text" msgstr "Metni seçin" #: lazarusidestrconsts.dlfmousesimplebuttonselectbyline msgid "Select text (lines)" msgstr "Metni seçin (satırlar)" #: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken msgid "Select text (tokens)" msgstr "Metni seçin (jetonlar)" #: lazarusidestrconsts.dlfmousesimplebuttonselectbyword msgid "Select text (words)" msgstr "Metni seçin (kelimeler)" #: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn msgid "Select text (Column mode)" msgstr "Metni seçin (Sütun modu)" #: lazarusidestrconsts.dlfmousesimplebuttonselectline msgid "Select text (Line mode)" msgstr "Metni seçin (Hat modu)" #: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark msgid "Set free bookmark" msgstr "Serbest yer imi ayarla" #: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull msgid "Select current Line (Full)" msgstr "Geçerli Satırı Seç (Tam)" #: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart msgid "Select current Line (Text)" msgstr "Geçerli Satırı Seç (Metin)" #: lazarusidestrconsts.dlfmousesimplebuttonsetpara msgid "Select current Paragraph" msgstr "Geçerli Paragraf Seç" #: lazarusidestrconsts.dlfmousesimplebuttonsetword msgid "Select current Word" msgstr "Geçerli Kelimeyi Seç" #: lazarusidestrconsts.dlfmousesimplebuttonzoomreset msgid "Reset zoom" msgstr "Yakınlaştırmayı sıfırla" #: lazarusidestrconsts.dlfmousesimplediff msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" msgstr "Bu sayfa mevcut ayarlarınızı temsil etmez. Gelişmiş sayfasına bakın. Gelişmiş değişiklikleri sıfırlamak için bu sayfayı kullanın" #: lazarusidestrconsts.dlfmousesimplegenericsect msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" msgid "General" msgstr "Genel" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on mouse down" msgstr "Standart, Fare aşağı indirildiğinde tüm eylemler (kesme noktası, katlama)" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" msgstr "Genişletilmiş, Eylemler (kesme noktası, katlama) fareyle yukarı doğru. Seçim fare ile aşağıya doğru ve fare hareketi" #: lazarusidestrconsts.dlfmousesimplegutterleftupright msgid "Extended, Actions, right gutter half only" msgstr "Genişletilmiş, Eylemler, yalnızca sağ oluk yarısı" #: lazarusidestrconsts.dlfmousesimplegutterlines msgid "Use line numbers to select lines" msgstr "Satırları seçmek için satır numaralarını kullanın" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" msgid "Gutter" msgstr "Oluk" #: lazarusidestrconsts.dlfmousesimplerightmovecaret msgid "Right button click includes caret move" msgstr "Sağ düğme tıklaması, imleci taşır" #: lazarusidestrconsts.dlfmousesimpletextsect msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" msgid "Text" msgstr "Metin" #: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel msgid "Alt-Ctrl Button" msgstr "Alt-Ctrl Buton" #: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel msgid "Alt-Ctrl Wheel" msgstr "Alt-Ctrl Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectaltlabel msgid "Alt Button" msgstr "Alt Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel msgid "Alt Wheel" msgstr "Alt Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectctrllabel msgid "Ctrl Button" msgstr "Ctrl Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel msgid "Ctrl Wheel" msgstr "Ctrl Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectdrag msgid "Drag selection (copy/paste)" msgstr "Seçimi sürükleyin (kopyala / yapıştır)" #: lazarusidestrconsts.dlfmousesimpletextsectextra1label msgid "Extra-1 Button" msgstr "Ekstra-1 Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectextra2label msgid "Extra-2 Button" msgstr "Ekstra 2 Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel msgid "Alt Double" msgstr "Alt Çift tıkla" #: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel msgid "Ctrl Double" msgstr "Ctrl Çift tıkla" #: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" msgid "Double" msgstr "Çift tıkla" #: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel msgid "Shift Double" msgstr "Shift Çift tıkla" #: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" msgid "Quad" msgstr "Dörtlü" #: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel" msgid "Triple" msgstr "Üçlü" #: lazarusidestrconsts.dlfmousesimpletextsectmidlabel msgid "Middle Button" msgstr "Orta Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectpagebtn msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn" msgid "Middle" msgstr "Orta" #: lazarusidestrconsts.dlfmousesimpletextsectpageextra1 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1" msgid "Extra 1" msgstr "Ekstra 1" #: lazarusidestrconsts.dlfmousesimpletextsectpageextra2 msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2" msgid "Extra 2" msgstr "Ekstra 2" #: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel msgid "Horizontal-Wheel" msgstr "Yatay tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectpagelmod msgid "Left 1" msgstr "Sol 1" #: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti msgid "Left 2" msgstr "Sol 2" #: lazarusidestrconsts.dlfmousesimpletextsectpageright msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright" msgid "Right" msgstr "Sağ" #: lazarusidestrconsts.dlfmousesimpletextsectpagewheel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel" msgid "Wheel" msgstr "Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectrightlabel msgid "Right Button" msgstr "Sağ Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel msgid "Shift-Alt-Ctrl Button" msgstr "Shift-Alt-Ctrl Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel msgid "Shift-Alt-Ctrl" msgstr "Shift-Alt-Ctrl" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel msgid "Shift-Alt Button" msgstr "ÜstKrkt-Alt Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel msgid "Shift-Alt Wheel" msgstr "ÜstKrkt-Alt Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel msgid "Shift-Ctrl Button" msgstr "Shift-Ctrl Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel msgid "Shift-Ctrl Wheel" msgstr "Üst Karakter-Ctrl Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel msgid "Shift Button" msgstr "Üst Karakter Düğme" #: lazarusidestrconsts.dlfmousesimpletextsectwheellabel msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel" msgid "Wheel" msgstr "Tekerlek" #: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel msgid "Shift Wheel" msgstr "Tekerlek kaydırması" #: lazarusidestrconsts.dlfmousesimplewarning msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" msgstr "Kaydedilmemiş değişiklikleriniz var. Bu sayfayı kullanmak gelişmiş sayfada yapılan değişiklikleri geri alacaktır" #: lazarusidestrconsts.dlfmousesimplewheelhsrolldef msgid "Scroll horizontal (System speed)" msgstr "Yatay kaydır (Sistem hızı)" #: lazarusidestrconsts.dlfmousesimplewheelhsrollline msgid "Scroll horizontal (Single line)" msgstr "Yatay kaydır (Tek satır)" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpage msgid "Scroll horizontal (Page)" msgstr "Yatay kaydır (Sayfa)" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf msgid "Scroll horizontal (Half page)" msgstr "Yatay kaydır (yarım sayfa)" #: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless msgid "Scroll horizontal (Page, less one line)" msgstr "Yatay kaydır (Sayfa, daha az bir satır)" #: lazarusidestrconsts.dlfmousesimplewheelnothing msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing" msgid "Nothing/Default" msgstr "Hiçbir şey / Varsayılan" #: lazarusidestrconsts.dlfmousesimplewheelsrolldef msgid "Scroll (System speed)" msgstr "Kaydırma (Sistem hızı)" #: lazarusidestrconsts.dlfmousesimplewheelsrollline msgid "Scroll (Single line)" msgstr "Kaydır (Tek satır)" #: lazarusidestrconsts.dlfmousesimplewheelsrollpage msgid "Scroll (Page)" msgstr "Kaydırma (Sayfa)" #: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf msgid "Scroll (Half page)" msgstr "Kaydırma (Yarım sayfa)" #: lazarusidestrconsts.dlfmousesimplewheelsrollpageless msgid "Scroll (Page, less one line)" msgstr "Kaydırma (Sayfa, daha az bir satır)" #: lazarusidestrconsts.dlfmousesimplewheelzoom msgid "Zoom" msgstr "Yakınlaştırma" #: lazarusidestrconsts.dlfnopredefinedscheme msgid "< None >" msgstr "" #: lazarusidestrconsts.dlfreadonlycolor msgctxt "lazarusidestrconsts.dlfreadonlycolor" msgid "Read Only" msgstr "Salt okunur" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" msgstr "İlk harf büyük, diğerleri küçük" #: lazarusidestrconsts.dlgactivedesktop msgid "active" msgstr "aktif" #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "Atama operatörü ekle :=" #: lazarusidestrconsts.dlgaddhiattrbracketmatch msgid "Brackets highlight" msgstr "Parantezleri vurgula" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtree msgid "Code folding tree" msgstr "Kod katlama ağacı" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur msgid "Code folding (current)" msgstr "Kod katlama (güncel)" #: lazarusidestrconsts.dlgaddhiattrdefault msgid "Default Text" msgstr "Varsayılan Metin" #: lazarusidestrconsts.dlgaddhiattrdefaultwindow msgid "Default Text / Window" msgstr "Varsayılan Metin/Pencere" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" msgstr "Kesme noktasını devre dışı bırak" #: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint msgid "Enabled breakpoint" msgstr "Kesme noktasını aktif et" #: lazarusidestrconsts.dlgaddhiattrerrorline msgid "Error line" msgstr "Hata satırı" #: lazarusidestrconsts.dlgaddhiattrexecutionpoint msgid "Execution point" msgstr "Yürütme noktası" #: lazarusidestrconsts.dlgaddhiattrfoldedcode msgid "Folded code marker" msgstr "Katlanmış kod işaretleyici" #: lazarusidestrconsts.dlgaddhiattrfoldedcodeline msgid "Fold start-line" msgstr "Katlama başlangıç çizgisi" #: lazarusidestrconsts.dlgaddhiattrgroupdefault msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" msgid "Global" msgstr "Küresel" #: lazarusidestrconsts.dlgaddhiattrgroupgutter msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" msgid "Gutter" msgstr "Oluk" #: lazarusidestrconsts.dlgaddhiattrgroupifdef msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef" msgid "IfDef" msgstr "Ifdef" #: lazarusidestrconsts.dlgaddhiattrgroupline msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" msgid "Line" msgstr "Satır" #: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors msgid "Outline Colors" msgstr "Anahat Renkleri" #: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit msgid "Syncron Edit" msgstr "Senkron Düzenle" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" msgstr "Şablon Düzenle" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" msgid "Text" msgstr "Metin" #: lazarusidestrconsts.dlgaddhiattrgutterseparator msgid "Gutter Separator" msgstr "Oluk Ayırıcı" #: lazarusidestrconsts.dlgaddhiattrhiddencodeline msgid "Hide start-line" msgstr "Başlangıç çizgisini gizle" #: lazarusidestrconsts.dlgaddhiattrhighlightall msgid "Incremental others" msgstr "Artımlı diğerleri" #: lazarusidestrconsts.dlgaddhiattrhighlightprefix msgid "Highlight prefix" msgstr "Öneki vurgula" #: lazarusidestrconsts.dlgaddhiattrhighlightword msgid "Highlight current word" msgstr "Geçerli kelimeyi vurgula" #: lazarusidestrconsts.dlgaddhiattrincrementalsearch msgid "Incremental search" msgstr "Artımlı arama" #: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint msgid "Invalid breakpoint" msgstr "Geçersiz kesme noktası" #: lazarusidestrconsts.dlgaddhiattrlinehighlight msgid "Current line highlight" msgstr "Geçerli satır vurgula" #: lazarusidestrconsts.dlgaddhiattrlinenumber msgid "Line number" msgstr "Satır numarası" #: lazarusidestrconsts.dlgaddhiattrmodifiedline msgid "Modified line" msgstr "Değiştirilmiş satır" #: lazarusidestrconsts.dlgaddhiattrmouselink msgid "Mouse link" msgstr "Fare bağlantısı" #: lazarusidestrconsts.dlgaddhiattroutlinelevel10color msgid "Level 10" msgstr "Seviye 10" #: lazarusidestrconsts.dlgaddhiattroutlinelevel1color msgid "Level 1" msgstr "Seviye 1" #: lazarusidestrconsts.dlgaddhiattroutlinelevel2color msgid "Level 2" msgstr "Seviye 2" #: lazarusidestrconsts.dlgaddhiattroutlinelevel3color msgid "Level 3" msgstr "Seviye 3" #: lazarusidestrconsts.dlgaddhiattroutlinelevel4color msgid "Level 4" msgstr "Seviye 4" #: lazarusidestrconsts.dlgaddhiattroutlinelevel5color msgid "Level 5" msgstr "Seviye 5" #: lazarusidestrconsts.dlgaddhiattroutlinelevel6color msgid "Level 6" msgstr "Seviye 6" #: lazarusidestrconsts.dlgaddhiattroutlinelevel7color msgid "Level 7" msgstr "Seviye 7" #: lazarusidestrconsts.dlgaddhiattroutlinelevel8color msgid "Level 8" msgstr "Seviye 8" #: lazarusidestrconsts.dlgaddhiattroutlinelevel9color msgid "Level 9" msgstr "Seviye 9" #: lazarusidestrconsts.dlgaddhiattrrecentlyused msgid "Recently used item" msgstr "Son kullanılan öğe" #: lazarusidestrconsts.dlgaddhiattrsyncroeditarea msgid "Selected Area" msgstr "Seçilen Alan" #: lazarusidestrconsts.dlgaddhiattrsyncroeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" msgid "Active Cell" msgstr "Aktif Hücre" #: lazarusidestrconsts.dlgaddhiattrsyncroeditother msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" msgid "Other Cells" msgstr "Diğer Hücreler" #: lazarusidestrconsts.dlgaddhiattrsyncroeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" msgid "Syncronized Cells" msgstr "Senkronize Hücreler" #: lazarusidestrconsts.dlgaddhiattrtemplateeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" msgid "Active Cell" msgstr "Aktif Hücre" #: lazarusidestrconsts.dlgaddhiattrtemplateeditother msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" msgid "Other Cells" msgstr "Diğer Hücreler" #: lazarusidestrconsts.dlgaddhiattrtemplateeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" msgid "Syncronized Cells" msgstr "Senkronize Hücreler" #: lazarusidestrconsts.dlgaddhiattrtextblock msgid "Text block" msgstr "Metin bloğu" #: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint msgid "Unknown breakpoint" msgstr "Bilinmeyen kesme noktası" #: lazarusidestrconsts.dlgaddhiattrwindowborder msgid "Window border" msgstr "Pencere kenarı" #: lazarusidestrconsts.dlgaddhiattrwordgroup msgid "Word-Brackets" msgstr "Kelime-Parantezler" #: lazarusidestrconsts.dlgaddhispecialvisiblechars msgid "Visualized Special Chars" msgstr "Görselleştirilen Özel Karekterler" #: lazarusidestrconsts.dlgaddnewmode msgid "Add new mode" msgstr "Yeni mod ekle" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" msgstr "Noktalı virgül ekle" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Önündeki yorum nedeniyle üst çizgiyi ayarla" #: lazarusidestrconsts.dlgalphabetically msgid "Alphabetically" msgstr "Alfabetik" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always keep caret in visible area of editor" msgstr "İmleci daima editörün görünür alanında tut" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" msgstr "Belirsiz dosya eylemi:" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" msgstr "Derleme uyarıları" #: lazarusidestrconsts.dlganiconforerrorwarninghintisshown msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case." msgstr "Bir mesajın önünde hata/uyarı/ipucu simgesi gösterilir. Aynı simge kaynak editörü oluklarında her durumda gösterir." #: lazarusidestrconsts.dlgansicommenttab msgid "Ansi (* *)" msgstr "Ansi (* *)" #: lazarusidestrconsts.dlgapplicationsettings msgid "Application settings" msgstr "Uygulama ayarları" #: lazarusidestrconsts.dlgassertcode msgid "Include assertion code" msgstr "Onay kodunu dahil et" #: lazarusidestrconsts.dlgassociateddebugdesktop #, object-pascal-format msgid "Associated debug desktop for \"%s\"" msgstr "İlişkili hata ayıklama masaüstü \"%s\"" #: lazarusidestrconsts.dlgassociateddebugdesktophint msgid "If you select the desktop, the associated debug desktop will be selected as well." msgstr "Masaüstünü seçerseniz, ilişkili hata ayıklama masaüstü de seçilecektir." #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" msgstr "Otomatik oluşturulacak formlar:" #: lazarusidestrconsts.dlgautocreateformshint msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically." msgstr "Ana .lpr birimi, her formu Application.CreateForm () ile oluşturur ve otomatik olarak serbest (free eder) bırakılır." #: lazarusidestrconsts.dlgautocreatenewforms msgid "Auto-create new forms" msgstr "Otomatik oluşturulacak yeni formlar" #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" msgstr "Dosyayı otomatik sil" #: lazarusidestrconsts.dlgautodisplayfuncproto msgid "Auto Display Function Prototypes" msgstr "Otomatik Görüntüle Fonksiyon Prototipleri" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse pointer when typing" msgstr "Yazarken fareyi gizle" #: lazarusidestrconsts.dlgautoindent msgctxt "lazarusidestrconsts.dlgautoindent" msgid "Auto indent" msgstr "Otomatik girinti" #: lazarusidestrconsts.dlgautoindentlink msgid "(Set up smart indent)" msgstr "(Akıllı girinti oluştur)" #: lazarusidestrconsts.dlgautoindenttype msgctxt "lazarusidestrconsts.dlgautoindenttype" msgid "Auto indent" msgstr "Otomatik girinti" #: lazarusidestrconsts.dlgautoremoveemptymethods msgid "Auto remove empty methods" msgstr "Boş yöntemleri otomatik olarak kaldır" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" msgstr "Dosyayı küçük harfle otomatik olarak yeniden adlandır" #: lazarusidestrconsts.dlgautosaveactivedesktop msgid "Auto save active desktop" msgstr "Aktif masaüstünü otomatik kaydet" #: lazarusidestrconsts.dlgautosaveactivedesktophint msgid "" "Save active desktop on IDE close\n" "Save debug desktop on IDE close and debug end" msgstr "" "IDE'ye aktif masaüstünü kaydet kapat\n" "IDE kapanışında ve hata ayıklama sonunda hata ayıklama masaüstünü kaydedin" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" msgstr "Mevcut Formlar:" #: lazarusidestrconsts.dlgavailableformshint msgid "These forms must be created and freed in the program code." msgstr "Bu formlar program kodunda oluşturulmalı ve serbest bırakılmalıdır." #: lazarusidestrconsts.dlgavoidunnecessaryjumps msgid "Avoid unnecessary jumps" msgstr "Gereksiz atlamalardan kaçının" #: lazarusidestrconsts.dlgbackcolor msgid "Background" msgstr "Arkaplan" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(Alt dizin yok)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "Aynı ad (alt dizinde)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" msgstr "Yöntemlerin arkasında" #: lazarusidestrconsts.dlgblockgroupoptions msgctxt "lazarusidestrconsts.dlgblockgroupoptions" msgid "Selection" msgstr "Seçim" #: lazarusidestrconsts.dlgblockindent msgid "Block indent (spaces)" msgstr "Blok girintisi (boşluklar)" #: lazarusidestrconsts.dlgblockindentkeys msgid "Block indent" msgstr "Blok girintisi" #: lazarusidestrconsts.dlgblockindentlink msgid "(edit keys)" msgstr "(Tuşları düzenle)" #: lazarusidestrconsts.dlgblockindenttypecopy msgid "Space/tab as prev Line" msgstr "Önceki Satır olarak boşluk/sekme" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" msgstr "Sadece Pozisyon" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" msgstr "Boşluklar" #: lazarusidestrconsts.dlgblockindenttypetabonly msgid "Tabs, cut off" msgstr "Sekmeler, kesilmiş" #: lazarusidestrconsts.dlgblockindenttypetabspace msgid "Tabs, then spaces" msgstr "Sekmeler, ardından boşluklar" #: lazarusidestrconsts.dlgblocktabindent msgid "Block indent (tabs)" msgstr "Blok girintisi (sekmeler)" #: lazarusidestrconsts.dlgbookmarksetscroll msgid "Restore scroll position for bookmarks" msgstr "" #: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0." msgstr "Kenar alanı Anchor editöründe ayarlanabilir. Boşluk > 0 ise renkli bir çizgi gösterilir." #: lazarusidestrconsts.dlgborderspacingcolor msgid "BorderSpacing frame" msgstr "Kenarlık Aralığı çerçevesi" #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" msgstr "Parantezi vurgula" #: lazarusidestrconsts.dlgbracketmatchgroup msgid "Matching bracket and quote pairs" msgstr "Eşleşen parantez ve alıntı çiftleri" #: lazarusidestrconsts.dlgcannotusedockedundockeddesktop msgid "You cannot use docked desktop in undocked environment and vice versa." msgstr "Yerleştirilmiş masaüstünü yerleştirilmemiş ortamda kullanamazsınız veya tam tersi." #: lazarusidestrconsts.dlgcaretbackcolor msgid "Secondary carets (multi-caret mode)" msgstr "İkincil imleç (çoklu imleç modu)" #: lazarusidestrconsts.dlgcaretcolor msgctxt "lazarusidestrconsts.dlgcaretcolor" msgid "Caret (Text-Cursor)" msgstr "İmleç (Metin İmleci)" #: lazarusidestrconsts.dlgcaretcolorinfo msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB." msgstr "İmleç rengi, imlecin altındaki metin ve arka plan renklerine bağlıdır. Her pikselin RGB'si bitsel olarak ters çevrilir ve seçilen rengin RGB'si ile XOR'lanır." #: lazarusidestrconsts.dlgcaretforecolor msgid "Main or primary caret" msgstr "Ana veya birincil imleç" #: lazarusidestrconsts.dlgcaretgroupoptions msgid "Caret (Text Cursor)" msgstr "İmleç (Metin İmleç)" #: lazarusidestrconsts.dlgcaretscrollgroupoptions msgid "Caret (Text Cursor) past end of line" msgstr "İmleç (Metin İmleci) satırın sonundan sonra" #: lazarusidestrconsts.dlgcasesensitive msgid "&Case sensitive" msgstr "&Harfe duyarlı" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" msgstr "Derleyici seçenekleri kontrol ediliyor" #: lazarusidestrconsts.dlgccoorphanedfilefound #, object-pascal-format msgid "orphaned file found: %s" msgstr "artık dosya bulundu: %s" #: lazarusidestrconsts.dlgccoresults msgid "Results" msgstr "Sonuçlar" #: lazarusidestrconsts.dlgccotest msgid "Test" msgstr "Test" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "Test: Derleyici denetleniyor ..." #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "Test: Derleyici yapılandırması denetleniyor ..." #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "Test: Derleyici tarihi denetleniyor ..." #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "Test: Boş bir dosya derleniyor ..." #: lazarusidestrconsts.dlgccotestrtlunits msgid "Test: Checking RTL units ..." msgstr "Test: RTL birimlerini kontrol ediyor ..." #: lazarusidestrconsts.dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "Test: fpc ppu arama yollarındaki kaynakları kontrol ediliyor ..." #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "Test: Boş bir dosya derleniyor" #: lazarusidestrconsts.dlgccousingconfigfile #, object-pascal-format msgid "using config file %s" msgstr "kullanılan %s yapılandırma dosyası" #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" msgstr "Sınıfsal düzen" #: lazarusidestrconsts.dlgcdtlast msgid "Last" msgstr "Son" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" msgstr "küçük" #: lazarusidestrconsts.dlgcdtpreview msgid "Preview (max line length = 1)" msgstr "Önizleme (maks. Satır uzunluğu = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" msgstr "Okunan önek" #: lazarusidestrconsts.dlgcdtstoredpostfix msgid "Stored postfix" msgstr "Saklanan sonek" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" msgstr "BÜYÜK" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" msgstr "Değişken önek" #: lazarusidestrconsts.dlgcdtwriteprefix msgid "Write prefix" msgstr "Yazma öneki" #: lazarusidestrconsts.dlgcharcasefileact msgid "Save As - auto rename Pascal files lower case" msgstr "Farklı Kaydet - otomatik olarak Pascal dosyalarını küçük harflerle yeniden adlandır" #: lazarusidestrconsts.dlgcheckandautosavefiles msgid "Check and Auto Save Files" msgstr "Dosyaları Kontrol Et ve Otomatik Kaydet" #: lazarusidestrconsts.dlgcheckpackagesonformcreate msgid "Check packages on form create" msgstr "Form oluşturulurken paketleri kontrol et" #: lazarusidestrconsts.dlgcheckpackagesonformcreatehint msgid "The form may require a package to work. Install such a package automatically." msgstr "Formun çalışması için bir paket gerekebilir. Böyle bir paketi otomatik olarak yükleyin." #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Kod şablon dosyası (* .dci) seç" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "Not defterinde kapat düğmelerini göster" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" msgstr "Renk şeması" #: lazarusidestrconsts.dlgcmacro msgid "C style macros (global)" msgstr "C stili makrolar (global)" #: lazarusidestrconsts.dlgcoansistr msgctxt "lazarusidestrconsts.dlgcoansistr" msgid "Use Ansistrings" msgstr "Ansistrings kullanın" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style" msgstr "Assembler stili" #: lazarusidestrconsts.dlgcocfgcmpmessages msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" msgid "Messages" msgstr "Mesajlar" #: lazarusidestrconsts.dlgcochecksandassertion msgid "Checks and assertion" msgstr "Kontroller ve onay" #: lazarusidestrconsts.dlgcocompilercommands msgid "Compiler Commands" msgstr "Derleyici Komutları" #: lazarusidestrconsts.dlgcocops msgid "C style operators (*=, +=, /= and -=)" msgstr "C stil operatörleri (* =, + =, / = ve - =)" #: lazarusidestrconsts.dlgcocreatemakefile msgctxt "lazarusidestrconsts.dlgcocreatemakefile" msgid "Create Makefile" msgstr "Makefile Oluştur" #: lazarusidestrconsts.dlgcodebugging msgid "Debugging" msgstr "Hata Ayıklama" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Hata ayıklayıcı yolunun eklenmesi (yok):" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" msgstr "Kod Oluşturma" #: lazarusidestrconsts.dlgcodefoldenableboth msgid "Both" msgstr "Her ikisi de" #: lazarusidestrconsts.dlgcodefoldenablefold msgid "Fold" msgstr "Katla" #: lazarusidestrconsts.dlgcodefoldenablehide msgid "Hide" msgstr "Gizle" #: lazarusidestrconsts.dlgcodefoldpopuporder msgid "Reverse fold-order in Popup" msgstr "Açılır pencerede katlama sırasını tersine çevir" #: lazarusidestrconsts.dlgcogdb msgid "Generate info for the debugger (slower / increases exe-size)" msgstr "Hata ayıklayıcı için bilgi oluşturun (daha yavaş / exe boyutunu artırır)" #: lazarusidestrconsts.dlgcoheaptrc msgid "Use Heaptrc unit (check for mem-leaks)" msgstr "Heaptrc birimini kullanın (mem-leak'leri kontrol edin)" #: lazarusidestrconsts.dlgcoincfiles msgid "Include files (-Fi):" msgstr "Dosyaları ekle (-Fi):" #: lazarusidestrconsts.dlgcoinfoforgdb msgid "Debugger info" msgstr "Hata ayıklayıcı bilgisi" #: lazarusidestrconsts.dlgcolibraries msgid "Libraries (-Fl):" msgstr "Kütüphaneler (-Fl):" #: lazarusidestrconsts.dlgcolinking msgid "Linking" msgstr "Bağlanıyor" #: lazarusidestrconsts.dlgcoloadsavehint msgid "Compiler options can be saved to an XML file." msgstr "Derleyici seçenekleri bir XML dosyasına kaydedilebilir." #: lazarusidestrconsts.dlgcolorlink msgid "(Edit Color)" msgstr "(Renk Düzenle)" #: lazarusidestrconsts.dlgcolornotmodified msgid "Not modified" msgstr "Değiştirilmedi" #: lazarusidestrconsts.dlgcolors msgid "Colors" msgstr "Renkler" #: lazarusidestrconsts.dlgcolorstml msgid "TML Setup" msgstr "TML Kurulumu" #: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile #, object-pascal-format msgid "Sample text file not found: %1:s" msgstr "Örnek metin dosyası bulunamadı: %1:s" #: lazarusidestrconsts.dlgcolorstmlerror msgid "Error:" msgstr "Hata:" #: lazarusidestrconsts.dlgcolorstmlfromfile msgid "File:" msgstr "Dosya:" #: lazarusidestrconsts.dlgcolorstmlinfo #, object-pascal-format msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed." msgstr "Aşağıda %1:s klasöründe bulunan Vurgulayıcı (Textmate) listesi bulunmaktadır.%0:sBu liste hatalı dosyaları ve IDE'de henüz etkin olmayan dosyaları içerebilir.%0:sYeni eklenen/değiştirilen dosyaları etkinleştirmek için IDE'yi yeniden başlatın .%0:s\"Yeniden Yükle\" düğmesi, herhangi bir hatanın düzeltilip düzeltilmediğini kontrol ederek aşağıdaki listeyi güncelleyecektir." #: lazarusidestrconsts.dlgcolorstmlmissinginclude #, object-pascal-format msgid "Did not find all includes: %1:s" msgstr "Şunları içerenlerin tümü bulunamadı: %1:s" #: lazarusidestrconsts.dlgcolorstmlnofilesfound msgid "No files found." msgstr "Dosya bulunamadı" #: lazarusidestrconsts.dlgcolorstmlnosampletxt msgid "No sample text configured" msgstr "Örnek metin yapılandırılmadı" #: lazarusidestrconsts.dlgcolorstmlok msgid "OK" msgstr "TAMAM" #: lazarusidestrconsts.dlgcolorstmlrefresh msgid "Reload" msgstr "Tekrar yükle" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "Komut satırı parametreleri (uygulama adı olmadan)" #: lazarusidestrconsts.dlgcommentalignmaxdefault msgid "Max indent for new line if prefix is based on start of comment on first comment line:" msgstr "Önek, ilk yorum satırındaki yorumun başlangıcını temel alıyorsa, yeni satır için maksimum girinti:" #: lazarusidestrconsts.dlgcommentalignmaxtoken msgid "Limit indent to" msgstr "Girintiyi sınırla" #: lazarusidestrconsts.dlgcommentcontinue msgid "Prefix comments on linebreak" msgstr "Linebreak'de önek yorumları" #: lazarusidestrconsts.dlgcommentcontinuematch msgid "Match current line" msgstr "Geçerli satırı eşleştir" #: lazarusidestrconsts.dlgcommentcontinuematchasterisk msgid "Match text including \"*\" of token \"(*\"" msgstr "\"(*\" belirtecinin \"*\" harfini içeren metinle eşleştir" #: lazarusidestrconsts.dlgcommentcontinuematchline msgid "Match whole line" msgstr "Tüm satırı eşleştir" #: lazarusidestrconsts.dlgcommentcontinuematchtext #, object-pascal-format msgid "Match text after token \"%s\"" msgstr "\"%s\" belirtecinden sonraki metni eşleştir" #: lazarusidestrconsts.dlgcommentcontinuematchtoken #, object-pascal-format msgid "Match text including token \"%s\"" msgstr "\"%s\" belirteci içeren metni eşleştir" #: lazarusidestrconsts.dlgcommentcontinueprefix msgid "Prefix new line" msgstr "Önek yeni satır" #: lazarusidestrconsts.dlgcommentcontinueprefixinddefault msgid "Align Prefix at indent of previous line" msgstr "Öneki önceki satırın girintisine hizala" #: lazarusidestrconsts.dlgcommentcontinueprefixindmatch msgid "Align Prefix below start of comment on first comment line" msgstr "İlk yorum satırında yorumun başlangıcının altındaki Öneki Hizala" #: lazarusidestrconsts.dlgcommentcontinueprefixindnone msgid "Do not indent prefix" msgstr "Önek girintisi yapma" #: lazarusidestrconsts.dlgcommentindentgroupoptions msgid "Comments and Strings" msgstr "Yorumlar ve Stringler" #: lazarusidestrconsts.dlgcommentshlashextendalways msgid "Extend if matched or not matched" msgstr "Eşleşirse veya eşleşmezse uzat" #: lazarusidestrconsts.dlgcommentshlashextendalwayssplit msgid "Extend if matched or not matched (not at EOL)" msgstr "Eşleşirse veya eşleşmezse uzat (EOL'de değil)" #: lazarusidestrconsts.dlgcommentshlashextendmatch msgid "Extend if matched" msgstr "Eşleşirse uzat" #: lazarusidestrconsts.dlgcommentshlashextendmatchsplit msgid "Extend if matched and caret in the middle of text (not at EOL)" msgstr "Eşleşirse uzatın ve metnin ortasına imleci koyun (EOL'de değil)" #: lazarusidestrconsts.dlgcompilationandlinking msgid "Compilation and Linking" msgstr "Derleme ve Bağlama" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler messages" msgstr "Derleyici mesajları" #: lazarusidestrconsts.dlgcompilermessages msgid "Compiler messages language file (*.msg)" msgstr "Derleyici ileti dil dosyası (* .msg)" #: lazarusidestrconsts.dlgcompleteproperties msgid "Complete properties" msgstr "Komple özellikleri" #: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected msgid "Component under mouse cursor is first selected, then the popup menu commands work on it." msgstr "Önce fare imlecinin altındaki bileşen seçilir, ardından açılır menü komutları üzerinde çalışır." #: lazarusidestrconsts.dlgconfigandtarget msgid "Config and Target" msgstr "Yapılandırma ve Hedef" #: lazarusidestrconsts.dlgconfigfiles msgid "Config files" msgstr "Yapılandırma dosyaları" #: lazarusidestrconsts.dlgconsolesizenotsupported msgid "Current debugger does not support this." msgstr "Mevcut hata ayıklayıcı bunu desteklemiyor." #: lazarusidestrconsts.dlgcootherdebugginginfo msgid "Other debugging info" msgstr "Diğer hata ayıklama bilgileri" #: lazarusidestrconsts.dlgcooverflow msgid "Overflow" msgstr "Taşma" #: lazarusidestrconsts.dlgcoparsing msgid "Parsing" msgstr "Ayrıştırma" #: lazarusidestrconsts.dlgcopypastekeepfolds msgid "Copy/Paste with fold info" msgstr "Katlama bilgileriyle birlikte kopyala / yapıştır" #: lazarusidestrconsts.dlgcopywordatcursoroncopynone msgid "Copy current word when no selection exists" msgstr "Seçim olmadığında geçerli kelimeyi kopyala" #: lazarusidestrconsts.dlgcorange msgctxt "lazarusidestrconsts.dlgcorange" msgid "Range" msgstr "Aralık" #: lazarusidestrconsts.dlgcorelocatable msgid "Relocatable" msgstr "Taşınabilir" #: lazarusidestrconsts.dlgcosetasdefault msgid "Set compiler options as default" msgstr "Derleyici seçeneklerini varsayılan olarak ayarla" #: lazarusidestrconsts.dlgcoshowoptions msgid "&Show Options" msgstr "&Seçenekleri Göster" #: lazarusidestrconsts.dlgcosmartlinkable msgid "Smart linkable" msgstr "Akıllı bağlanabilir" #: lazarusidestrconsts.dlgcosources msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Diğer kaynaklar (.pp / .pas dosyaları, Sadece IDE tarafından kullanılır derlenemez)" #: lazarusidestrconsts.dlgcostack msgid "Stack" msgstr "Yığın" #: lazarusidestrconsts.dlgcostrip msgid "Strip symbols from executable" msgstr "Sembolleri yürütülebilir dosyadan çıkar" #: lazarusidestrconsts.dlgcosymboltype msgid "Type of debug info" msgstr "Hata ayıklama bilgisi türü" #: lazarusidestrconsts.dlgcosymboltypeauto msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" msgid "Automatic" msgstr "Otomatik" #: lazarusidestrconsts.dlgcosymboltypedwarf2 msgid "Dwarf 2" msgstr "Dwarf 2" #: lazarusidestrconsts.dlgcosymboltypedwarf2set msgid "Dwarf 2 with sets" msgstr "Dwarf 2 ile ayarla" #: lazarusidestrconsts.dlgcosymboltypedwarf3 msgid "Dwarf 3 (beta)" msgstr "Dwarf 3 (beta)" #: lazarusidestrconsts.dlgcosymboltypestabs msgid "Stabs" msgstr "Stabs" #: lazarusidestrconsts.dlgcotrashvariables msgid "Trash variables" msgstr "Çöp değişkenleri" #: lazarusidestrconsts.dlgcounitstyle msgid "Unit style" msgstr "Birim tarzı" #: lazarusidestrconsts.dlgcovalgrind msgid "Generate code for valgrind" msgstr "Valgrind için kod üret" #: lazarusidestrconsts.dlgcoverbosity msgid "Verbosity" msgstr "Ayrıntı" #: lazarusidestrconsts.dlgcppinline msgid "C++ styled INLINE" msgstr "C ++ styled INLINE" #: lazarusidestrconsts.dlgcreatenewrunparameterssettings msgid "Create new Run Parameters settings" msgstr "Yeni Çalıştırma Parametreleri ayarları oluşturun" #: lazarusidestrconsts.dlgcurlycommenttab msgid "Curly { }" msgstr "Kıvırcık { }" #: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow msgid "Currently respected by messages window, jump history and search results." msgstr "Şu anda mesajlar penceresi, atlama geçmişi ve arama sonuçları tarafından saygı duyulur." #: lazarusidestrconsts.dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "İmleç EOL'nin ötesinde" #: lazarusidestrconsts.dlgcursormoveclearsselection msgid "Caret left/right clears selection (no move)" msgstr "Sol/sağ köşe seçimi temizler (hareketsiz)" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Caret skips selection" msgstr "İmleç seçim atlar" #: lazarusidestrconsts.dlgcursorskipstab msgid "Caret skips tabs" msgstr "Imleç sekmeleri atlar" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Kullanıcı tanımlı uzantısı (.pp.xxx)" #: lazarusidestrconsts.dlgdebugdesktop msgid "debug" msgstr "hata ayıkla" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "Editör yolu" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" msgstr "Hata ayıklayıcı türü ve yolu" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" msgstr "Varsayılan düzenleyici yazı tipi" #: lazarusidestrconsts.dlgdefaulttabfont msgid "Default tab font" msgstr "Varsayılan sekme yazı tipi" #: lazarusidestrconsts.dlgdefaultwinpos msgid "Default Window/Console position and size" msgstr "Varsayılan Pencere/Konsol konumu ve boyutu" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" msgstr "Varsayılan değer" #: lazarusidestrconsts.dlgdeletemode msgid "Delete mode" msgstr "Modu sil" #: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption" msgid "Delete" msgstr "Sil" #: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint msgid "Delete selected desktop" msgstr "Seçili masaüstünü Sil" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " msgstr "Şablonu sil " #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " msgstr "Düğmeler - " #: lazarusidestrconsts.dlgdesktophints msgid "Hints" msgstr "İpuçları" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " msgstr "Menüler - " #: lazarusidestrconsts.dlgdesktopname msgid "Desktop name" msgstr "Masaüstü adı" #: lazarusidestrconsts.dlgdesktopsexported #, object-pascal-format msgid "%d desktop(s) successfully exported to \"%s\"" msgstr "%d masaüstü \"%s\" e başarıyla dışa aktarıldı" #: lazarusidestrconsts.dlgdesktopsimported #, object-pascal-format msgid "%d desktop(s) successfully imported from \"%s\"" msgstr "%d masaüstü \"%s\" den başarıyla içe aktarıldı." #: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor msgid "Different values background" msgstr "Farklı değerler arkaplan" #: lazarusidestrconsts.dlgdirection msgid "Direction" msgstr "Yön" #: lazarusidestrconsts.dlgdisableantialiasing msgid "Disable anti-aliasing" msgstr "Kenar yumuşatmayı devre dışı bırak" #: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep msgid "Distance between grid points is the smallest step when moving a control." msgstr "Izgara noktaları arasındaki mesafe, bir denetimi taşırken en küçük adımdır." #: lazarusidestrconsts.dlgdividercolordefault msgid "Use right margin color" msgstr "Sağ kenar boşluğu rengini kullan" #: lazarusidestrconsts.dlgdividerdrawdepth msgid "Draw divider level" msgstr "Bölücü seviyesini çiz" #: lazarusidestrconsts.dlgdividernestcolor msgid "Nested line color" msgstr "İç içe çizgi rengi" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" msgstr "Çizgi rengi" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" msgstr "Begin/End" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" msgstr "Procedure/Function" #: lazarusidestrconsts.dlgdivpasstructglobalname msgid "Class/Struct" msgstr "Class/Struct" #: lazarusidestrconsts.dlgdivpasstructlocalname msgid "Class/Struct (local)" msgstr "Class/Struct (yerel)" #: lazarusidestrconsts.dlgdivpastryname msgid "Try/Except" msgstr "Try/Except" #: lazarusidestrconsts.dlgdivpasunitsectionname msgid "Unit sections" msgstr "Birim bölümleri" #: lazarusidestrconsts.dlgdivpasusesname msgid "Uses clause" msgstr "Uses maddesi" #: lazarusidestrconsts.dlgdivpasvarglobalname msgid "Var/Type" msgstr "Var/Type" #: lazarusidestrconsts.dlgdivpasvarlocalname msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" msgid "Var/Type (local)" msgstr "Var/Type (yerel)" #: lazarusidestrconsts.dlgdrawcomponentsnamebelowit msgid "Draw the component's name below it." msgstr "Bileşenin adını altına çizin." #: lazarusidestrconsts.dlgedback msgid "Back" msgstr "Geri" #: lazarusidestrconsts.dlgedbold msgid "Bold" msgstr "Kalın" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" msgstr "Alt dizin" #: lazarusidestrconsts.dlgedcodetempl msgctxt "lazarusidestrconsts.dlgedcodetempl" msgid "Code Templates" msgstr "Kod Şablonları" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Add close statement for Pascal blocks" msgstr "Pascal blokları için açık bildiri ekleyin" #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" msgstr "Kullanıcı tanımlı uzantı" #: lazarusidestrconsts.dlgeddelayinsec #, object-pascal-format msgid "(%s sec delay)" msgstr "(%s sn gecikme)" #: lazarusidestrconsts.dlgeddisplay msgid "Display" msgstr "Ekran" #: lazarusidestrconsts.dlgedfiles msgid "Editor Files" msgstr "Editör Dosyaları" #: lazarusidestrconsts.dlgedidcomlet msgid "Identifier completion" msgstr "Tanımlayıcı tamamlama" #: lazarusidestrconsts.dlgedinvert msgid "Invert" msgstr "Ters çevir" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit msgid "Ignore Locks, use longest unused editor" msgstr "Kilitleri yoksay, kullanılmayan en uzun editörü kullan" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit msgid "Ignore Locks, if editor is current" msgstr "Editör güncelse, Kilitleri yoksay" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin msgid "Ignore Locks, if editor in current window" msgstr "Geçerli pencerede düzenleyici varsa, Kilitleri yoksay" #: lazarusidestrconsts.dlgeditaccesscaptionlockedinview msgid "Locked, if text in view" msgstr "Eğer metin görünüyorsa kilidi kaldır" #: lazarusidestrconsts.dlgeditaccesscaptionunlocked msgid "Unlocked" msgstr "Kilitsiz" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview msgid "Unlocked, if text in centered view" msgstr "Metin ortalanmış görünümdeyse, kilitsiz" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin msgid "New tab, existing or new window" msgstr "Yeni sekme, varolan veya yeni pencere" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin msgid "New tab in new window" msgstr "Yeni pencerede yeni sekme" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin msgid "New tab in existing window" msgstr "Mevcut pencerede yeni sekme" #: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." msgstr "Bu seçenek, kilitli olsa ve/veya kaydırma gerektirse bile dosya için kullanılmayan en uzun düzenleyiciyi kullanacaktır. Kullanılmayan en uzun düzenleyicinin belirlenmesi, \"aynı ölçüt sırası\" ayarıyla belirlenmiş olsa bile, pencerelerin odaklandığı sıraya bakmaz. Bu seçenek her zaman başarılı olur, diğer seçenekler asla test edilmez." #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." msgstr "Bu seçenek, mevcut aktif düzenleyicinin hedef dosyaya sahip olup olmadığını kontrol eder ve eğer öyleyse, kilitli olsa ve/veya kaydırma gerektirse bile mevcut düzenleyiciyi kullanır." #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." msgstr "Bu seçenek, geçerli pencerede hedef dosya için bir düzenleyici olup olmadığını kontrol eder ve varsa, kilitli olsa ve/veya kaydırma gerektirse bile bu düzenleyiciyi kullanır." #: lazarusidestrconsts.dlgeditaccessdesclockedinview msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." msgstr "Bu seçenek, hedef atlama noktasını görüntülemek için kaydırmaya ihtiyaç duymayan kilitli (ve sadece kilitli) bir Editör kullanacaktır (hedef atlama noktası zaten görünür ekran alanındadır)." #: lazarusidestrconsts.dlgeditaccessdescunlocked msgid "This option will use any not locked Editor." msgstr "Bu seçenek kilitli olmayan herhangi bir Editörü kullanacaktır." #: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." msgstr "Bu seçenek, hedef atlama noktasını görüntülemek için kaydırmaya ihtiyaç duymayan kilitli olmayan bir Editör kullanacaktır (hedef atlama noktası, üstte/altta 2-5 satır hariç olmak üzere zaten görünür ekran merkezi alanındadır)." #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested." msgstr "Bu seçenek, kilitlenmemiş bir sekme bulunamazsa mevcut veya yeni bir Pencerede yeni bir Sekme açacaktır. Bu seçenek her zaman başarılı olur, diğer seçenekler asla test edilmez." #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." msgstr "Kilitli olmayan bir sekme bulunmazsa, bu seçenek yeni bir Pencerede yeni bir Sekme açacaktır (diğer sekmeler yeni sekme için kullanılabilse bile). Bu seçenek her zaman başarılı olur, başka seçenekler asla test edilmez." #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet." msgstr "Kilidi açılmış bir sekme bulunmazsa, bu seçenek varolan (ve yalnızca varolan) bir Pencerede yeni bir Sekme açar. Bir sekme, ancak henüz hedef dosya için düzenleyici olmayan bir pencere varsa açılır." #: lazarusidestrconsts.dlgedital msgid "Italic" msgstr "İtalik" #: lazarusidestrconsts.dlgeditexportbackcolor msgid "Use Background color in HTML export" msgstr "HTML dışa aktarımında Arka Plan rengini kullanma" #: lazarusidestrconsts.dlgeditmaxlength msgid "(Edit Max Length)" msgstr "" #: lazarusidestrconsts.dlgeditorfontsize msgid "Editor font size" msgstr "Editör yazıtipi boyutu" #: lazarusidestrconsts.dlgeditoroptions msgid "Editor options" msgstr "Editör seçenekleri" #: lazarusidestrconsts.dlgeditschemdefaults msgid "Scheme globals" msgstr "Şema globals" #: lazarusidestrconsts.dlgedmisc msgctxt "lazarusidestrconsts.dlgedmisc" msgid "Miscellaneous" msgstr "Çeşitli" #: lazarusidestrconsts.dlgedoff msgid "Off" msgstr "Kapalı" #: lazarusidestrconsts.dlgedon msgid "On" msgstr "Açık" #: lazarusidestrconsts.dlgedtabindent msgid "Tab and Indent" msgstr "Sekme ve Girinti" #: lazarusidestrconsts.dlgedunder msgid "Underline" msgstr "Altını çiz" #: lazarusidestrconsts.dlgelastictabs msgid "Elastic tabs" msgstr "Elastik sekmeler" #: lazarusidestrconsts.dlgelastictabswidths msgid "Elastic min Widths" msgstr "Elastik minimum Genişlikler" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" msgstr "Öğe Öznitelikleri" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" msgstr "End tuşu en yakın noktaya atlar" #: lazarusidestrconsts.dlgenvask msgid "Ask" msgstr "Sor" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Not: Proje dosyaları, proje dizinindeki tüm dosyalardır" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" msgstr "Yedek" #: lazarusidestrconsts.dlgenvfiles msgid "Files" msgstr "Dosyalar" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" msgstr "Izgara" #: lazarusidestrconsts.dlgenvidestartup msgid "IDE Startup" msgstr "IDE Başlangıcı" #: lazarusidestrconsts.dlgenvlanguage msgctxt "lazarusidestrconsts.dlgenvlanguage" msgid "Language" msgstr "Dil" #: lazarusidestrconsts.dlgenvlanguagerestarthint msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint" msgid "Restart the IDE to complete the language change." msgstr "" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" msgstr "Kılavuz çizgiler" #: lazarusidestrconsts.dlgenvmisc msgctxt "lazarusidestrconsts.dlgenvmisc" msgid "Miscellaneous" msgstr "Çeşitli" #: lazarusidestrconsts.dlgenvnone msgctxt "lazarusidestrconsts.dlgenvnone" msgid "None" msgstr "Yok" #: lazarusidestrconsts.dlgenvotherfiles msgid "Other Files" msgstr "Diğer dosyalar" #: lazarusidestrconsts.dlgenvproject msgid "Tabs for project" msgstr "Projenin sekmeleri" #: lazarusidestrconsts.dlgenvtype msgctxt "lazarusidestrconsts.dlgenvtype" msgid "Type" msgstr "Tür" #: lazarusidestrconsts.dlgeofocusmessagesatcompilation msgid "Focus messages at compilation" msgstr "Derleme anında mesajları odakla" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra character spacing" msgstr "Ekstra karakter aralığı" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" msgstr "Ekstra satır aralığı" #: lazarusidestrconsts.dlgextsymb msgid "Use external debug symbols file" msgstr "Harici hata ayıklama sembolleri dosyasını kullan" #: lazarusidestrconsts.dlgfileassociationinos msgid "Opening Files from OS" msgstr "İşletim Sistemi'nden Dosyaları Açma" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" msgstr "Dosya uzantıları" #: lazarusidestrconsts.dlgfiles #, object-pascal-format msgid "%s files" msgstr "%s dosyası" #: lazarusidestrconsts.dlgfilterall msgid "All files" msgstr "Tüm dosyalar" #: lazarusidestrconsts.dlgfiltercodetoolstemplatefile msgid "CodeTools template file" msgstr "CodeTools şablon dosyası" #: lazarusidestrconsts.dlgfilterdcifile msgid "DCI file" msgstr "DCI dosyası" #: lazarusidestrconsts.dlgfilterdelphiform msgid "Delphi form" msgstr "Delphi formu" #: lazarusidestrconsts.dlgfilterdelphipackage msgid "Delphi package" msgstr "Delphi paketi" #: lazarusidestrconsts.dlgfilterdelphiproject msgid "Delphi project" msgstr "Delphi projesi" #: lazarusidestrconsts.dlgfilterdelphiunit msgid "Delphi unit" msgstr "Delphi birimi" #: lazarusidestrconsts.dlgfilterexecutable msgid "Executable" msgstr "Çalıştırılabilir" #: lazarusidestrconsts.dlgfilterfpcmessagefile msgid "FPC message file" msgstr "FPC mesaj dosyası" #: lazarusidestrconsts.dlgfilterfppkgconfigurationfile msgid "Fppkg configuration file" msgstr "Fppkg yapılandırma dosyası" #: lazarusidestrconsts.dlgfilterhtml msgid "HTML files" msgstr "HTML dosyaları" #: lazarusidestrconsts.dlgfilterimagesbitmap msgid "Bitmap images" msgstr "Bitmap görüntüleri" #: lazarusidestrconsts.dlgfilterimagespixmap msgid "Pixmap images" msgstr "Pixmap görüntüleri" #: lazarusidestrconsts.dlgfilterimagespng msgid "PNG images" msgstr "PNG resimleri" #: lazarusidestrconsts.dlgfilterlazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "Lazarus Masaüstü Ayarları" #: lazarusidestrconsts.dlgfilterlazaruseditorfile msgid "Editor file types" msgstr "Editör dosya türleri" #: lazarusidestrconsts.dlgfilterlazarusfile msgid "Lazarus file" msgstr "Lazarus dosyası" #: lazarusidestrconsts.dlgfilterlazarusform msgid "Lazarus form" msgstr "Lazarus formu" #: lazarusidestrconsts.dlgfilterlazarusinclude msgid "Lazarus include file" msgstr "Lazarus dosya ekle" #: lazarusidestrconsts.dlgfilterlazarusotherfile msgid "Lazarus other file" msgstr "Lazarus diğer dosya" #: lazarusidestrconsts.dlgfilterlazaruspackage msgid "Lazarus package" msgstr "Lazarus paketi" #: lazarusidestrconsts.dlgfilterlazarusproject msgid "Lazarus project" msgstr "Lazarus projesi" #: lazarusidestrconsts.dlgfilterlazarusprojectsource msgid "Lazarus project source" msgstr "Lazarus proje kaynağı" #: lazarusidestrconsts.dlgfilterlazarussession msgid "Lazarus session" msgstr "Lazarus oturumu" #: lazarusidestrconsts.dlgfilterlazarusunit msgid "Lazarus unit" msgstr "Lazarus birimi" #: lazarusidestrconsts.dlgfilterpackagelistfiles msgid "Package list files" msgstr "Paket listesi dosyaları" #: lazarusidestrconsts.dlgfilterpascalfile msgid "Pascal file" msgstr "Pascal dosyası" #: lazarusidestrconsts.dlgfilterprograms msgid "Programs" msgstr "Programlar" #: lazarusidestrconsts.dlgfilterxml msgid "XML files" msgstr "XML dosyaları" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" msgstr "İmleçte metin bulun" #: lazarusidestrconsts.dlgfolddiffchunk msgid "Chunk" msgstr "Yığın" #: lazarusidestrconsts.dlgfolddiffchunksect msgid "Chunk section" msgstr "Yığın bölümü" #: lazarusidestrconsts.dlgfoldhtmlasp msgid "ASP" msgstr "ASP" #: lazarusidestrconsts.dlgfoldhtmlcomment msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" msgid "Comment" msgstr "Açıklama" #: lazarusidestrconsts.dlgfoldhtmlnode msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" msgid "Node" msgstr "Node" #: lazarusidestrconsts.dlgfoldlfmitem msgid "Item" msgstr "Öğe" #: lazarusidestrconsts.dlgfoldlfmlist msgid "List <>" msgstr "List <>" #: lazarusidestrconsts.dlgfoldlfmobject msgid "Object (inherited, inline)" msgstr "Object (inherited, inline)" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" msgid "Var/Type (local)" msgstr "Var/Type (yerel)" #: lazarusidestrconsts.dlgfoldpasanonprocedure msgid "Anonymous Procedure" msgstr "Anonim Prosedür" #: lazarusidestrconsts.dlgfoldpasansicomment msgid "Comment (* *)" msgstr "Açıklama (* *)" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" msgstr "Asm" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" msgstr "Begin/End (iç içe geçmiş)" #: lazarusidestrconsts.dlgfoldpasborcomment msgid "Comment { }" msgstr "Açıklama { }" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" msgstr "Case" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" msgstr "Class/Object" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" msgstr "public/private" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" msgstr "Except/Finally" #: lazarusidestrconsts.dlgfoldpasfordo msgid "For/Do" msgstr "For/Do döngüsü" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" msgstr "{$IfDef}" #: lazarusidestrconsts.dlgfoldpasifthen msgid "If/Then/Else" msgstr "If/Then/Else" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" msgstr "İç içe Yorum" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" msgstr "Begin/End (procedure)" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" msgid "Procedure" msgstr "Prosedür" #: lazarusidestrconsts.dlgfoldpasprogram msgctxt "lazarusidestrconsts.dlgfoldpasprogram" msgid "Program" msgstr "Program" #: lazarusidestrconsts.dlgfoldpasrecord msgctxt "lazarusidestrconsts.dlgfoldpasrecord" msgid "Record" msgstr "Kayıt" #: lazarusidestrconsts.dlgfoldpasrecordcase msgid "Record case" msgstr "Kayıt vakası" #: lazarusidestrconsts.dlgfoldpasrecordcasesect msgid "Record case section" msgstr "Kayıt vakası bölümü" #: lazarusidestrconsts.dlgfoldpasrepeat msgctxt "lazarusidestrconsts.dlgfoldpasrepeat" msgid "Repeat" msgstr "Tekrar et" #: lazarusidestrconsts.dlgfoldpasslashcomment msgid "Comment //" msgstr "Açıklama //" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" msgstr "Try" #: lazarusidestrconsts.dlgfoldpasunit msgctxt "lazarusidestrconsts.dlgfoldpasunit" msgid "Unit" msgstr "Birim" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" msgstr "Birim bölümü" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" msgstr "{%Bölge}" #: lazarusidestrconsts.dlgfoldpasuses msgctxt "lazarusidestrconsts.dlgfoldpasuses" msgid "Uses" msgstr "Uses" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" msgstr "Var/Type (global)" #: lazarusidestrconsts.dlgfoldpaswhiledo msgid "While/Do" msgstr "While/Do" #: lazarusidestrconsts.dlgfoldpaswithdo msgid "With/Do" msgstr "With/Do" #: lazarusidestrconsts.dlgfoldxmlcdata msgid "CData" msgstr "CData" #: lazarusidestrconsts.dlgfoldxmlcomment msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" msgid "Comment" msgstr "Açıklama" #: lazarusidestrconsts.dlgfoldxmldoctype msgid "DocType" msgstr "DocType" #: lazarusidestrconsts.dlgfoldxmlnode msgctxt "lazarusidestrconsts.dlgfoldxmlnode" msgid "Node" msgstr "Düğüm" #: lazarusidestrconsts.dlgfoldxmlprocess msgid "Processing Instruction" msgstr "İşleme Talimatı" #: lazarusidestrconsts.dlgforcedpiscalingindesigntime msgid "Force DPI scaling in design-time" msgstr "Tasarım zamanında DPI ölçeklendirmesini zorla" #: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account." msgstr "İşaretlendiğinde proje ölçeklendirme ayarları göz ardı edilir - yalnızca form/çerçeve/datamodül Ölçeklendirildi özelliği dikkate alınır." #: lazarusidestrconsts.dlgforceuniqueinstancemodalerror msgid "The running Lazarus instance cannot accept any files." msgstr "Çalışan Lazarus örneği herhangi bir dosyayı kabul edemez." #: lazarusidestrconsts.dlgforecolor msgid "Foreground" msgstr "Ön plan" #: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector msgid "Change Object Inspector contents on clicking form title bar" msgstr "Form başlığı çubuğuna tıklayarak Nesne Denetçisi içeriğini değiştirin" #: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint msgid "Show a form's properties in Object Inspector by clicking on its title bar." msgstr "Bir formun özelliklerini başlık çubuğuna tıklayarak Nesne denetçisinde göster." #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "Prosedür ekleme politikası" #: lazarusidestrconsts.dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Usullerin düzenini sürdürün" #: lazarusidestrconsts.dlgfpcexecutable #, object-pascal-format msgid "Compiler executable (e.g. %s)" msgstr "Derleyici çalıştırılabilir (örn. %s)" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" msgstr "FPC kaynak dizini" #: lazarusidestrconsts.dlgfppkgconfigurationfile msgid "Fppkg configuration file (e.g. fppkg.cfg)" msgstr "Fppkg yapılandırma dosyası (örn. fppkg. cfg)" #: lazarusidestrconsts.dlgframecolor msgid "Text-mark" msgstr "Metin işareti" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" msgstr "Form Editörü" #: lazarusidestrconsts.dlgfrombeginning msgid "From b&eginning" msgstr "Başlangıçta&n itibaren" #: lazarusidestrconsts.dlgfromcursor msgid "From c&ursor" msgstr "İ&mleçten" #: lazarusidestrconsts.dlgglobal msgid "&Global" msgstr "&Küresel" #: lazarusidestrconsts.dlggprof msgid "Generate code for gprof" msgstr "Gprof için kod üret" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" msgstr "Rengi yakala" #: lazarusidestrconsts.dlggrayeddesktopsdocked msgid "Grayed desktops are for docked environment." msgstr "Gri renkli masaüstleri yerleşik ortamlar içindir." #: lazarusidestrconsts.dlggrayeddesktopsundocked msgid "Grayed desktops are for undocked environment." msgstr "Gri tonlamalı masaüstü bilgisayarları kurtarma ortamı içindir." #: lazarusidestrconsts.dlggridcolor msgid "Grid color" msgstr "Izgara rengi" #: lazarusidestrconsts.dlggridconsistsofsmalldots msgid "Grid consists of small dots which help aligning controls." msgstr "Izgara, kontrolleri hizalamaya yardımcı olan küçük noktalardan oluşur." #: lazarusidestrconsts.dlggridx msgid "Grid size X" msgstr "Izgara ebadı X" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" msgstr "Yatay kılavuz adım boyutu" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" msgstr "Izgara ebadı Y" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" msgstr "Dikey ızgara adım boyutu" #: lazarusidestrconsts.dlggroupcodeexplorer msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" msgid "Code Explorer" msgstr "Kod Explorer" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" msgstr "Kod Araçları" #: lazarusidestrconsts.dlggroupdebugger msgctxt "lazarusidestrconsts.dlggroupdebugger" msgid "Debugger" msgstr "Hata ayıklayıcı" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" msgstr "Editör" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" msgid "Environment" msgstr "Ortam" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" msgstr "Grup Geri Al" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" msgstr "Kılavuz Çizgileri Göster" #: lazarusidestrconsts.dlgguidelineshint msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown." msgstr "Bir kontrol başka bir kontrolle yatay veya dikey olarak hizalandığında, mavi bir kılavuz çizgi gösterilir." #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" msgstr "Oluk" #: lazarusidestrconsts.dlgguttercollapsedcolor msgid "Collapsed" msgstr "Daraltılmış" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" msgstr "Oluk rengi" #: lazarusidestrconsts.dlgguttercurrentlinenumber msgid "Current Line (number)" msgstr "Mevcut Hat (numara)" #: lazarusidestrconsts.dlgguttercurrentlineother msgid "Current Line (other)" msgstr "Mevcut Hat (diğer)" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" msgstr "Oluk kenar rengi" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" msgstr "Oluk ayırıcı indeksi" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" msgstr "Yarım sayfa kaydırma" #: lazarusidestrconsts.dlgheapandstacksize msgid "Heap and stack sizes" msgstr "Yığın ve yığın boyutları" #: lazarusidestrconsts.dlgheapsize msgid "Heap size" msgstr "Yığın boyutu" #: lazarusidestrconsts.dlgheightofonepropertyingrid msgid "Height of one property in the grid." msgstr "Izgaradaki bir özelliğin yüksekliği." #: lazarusidestrconsts.dlgheightpos msgid "Height:" msgstr "Yükseklik:" #: lazarusidestrconsts.dlghideideonrun #, fuzzy #| msgid "Hide IDE windows on run" msgid "Hide IDE windows on Run/Debug" msgstr "Çalıştırıldığında IDE pencerelerini gizle" #: lazarusidestrconsts.dlghideideonrunhint msgid "Do not show the IDE at all while program is running." msgstr "Program çalışırken IDE 'yi hiç gösterme." #: lazarusidestrconsts.dlghidesingletabinnotebook msgid "Hide tab in single page windows" msgstr "Tek sayfa ise sekmeyi gizle" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" msgstr "Rengi Vurgula" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" msgstr "Yazı tipi rengini vurgula" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Caret" msgstr "İmleç solu" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Caret" msgstr "İmleç sağı" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show hints for parameter \"Sender\" not used" msgstr "Kullanılmayan \"Sender\" parametresi için ipuçlarını göster" #: lazarusidestrconsts.dlghintsunused msgid "Show hints for unused units in main" msgstr "Kullanılmayan birimler için ana ipuçlarını göster" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "Home tuşu en yakın başlangıca atlar" #: lazarusidestrconsts.dlghostapplication msgid "Host application" msgstr "Ana bilgisayar uygulaması" #: lazarusidestrconsts.dlgidentifiercompletion msgid "Identifier Completion" msgstr "Tamamlama Tanımlayıcı" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" msgstr "Tanımlayıcı politikası" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" msgstr "IDE Seçenekleri" #: lazarusidestrconsts.dlgifdefblockactive msgid "Active $IFDEF code" msgstr "Aktif $IFDEF kodu" #: lazarusidestrconsts.dlgifdefblockinactive msgid "Inactive $IFDEF code" msgstr "Pasif $IFDEF kodu" #: lazarusidestrconsts.dlgifdefblocktmpactive msgid "Included mixed state $IFDEF code" msgstr "Dahil edilen karma durum $IFDEF kodu" #: lazarusidestrconsts.dlgifdefnodeactive msgid "Active $IFDEF node" msgstr "Aktif $IFDEF node" #: lazarusidestrconsts.dlgifdefnodeinactive msgid "Inactive $IFDEF node" msgstr "Pasif $IFDEF node" #: lazarusidestrconsts.dlgifdefnodetmpactive msgid "Included mixed state $IFDEF node" msgstr "Dahil edilen karma durum $IFDEF node" #: lazarusidestrconsts.dlgimportdesktopexists msgid "" "A desktop with the same name already exists.\n" "Please confirm the desktop name:" msgstr "" "Aynı ada sahip bir masaüstü zaten var.\n" "Lütfen masaüstü adını doğrulayın:" #: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl msgid "Include code templates" msgstr "Kod şablonlarını dahil et" #: lazarusidestrconsts.dlgincludeidentifierscontainingprefix msgid "Include identifiers containing prefix" msgstr "Önek içeren tanımlayıcılarını dahil et" #: lazarusidestrconsts.dlgincludekeywordstoidentcompl msgid "Include all keywords and operators" msgstr "Tüm anahtar kelimeleri ve operatörleri dahil edin" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" msgstr "Sistem değişkenlerini dahil et" #: lazarusidestrconsts.dlgincludewordstoidentcompl msgid "Include words" msgstr "Kelimeleri dahil et" #: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude msgid "don't include" msgstr "dahil etme" #: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits msgid "from all units" msgstr "tüm birimlerden" #: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit msgid "from current unit" msgstr "mevcut birimden" #: lazarusidestrconsts.dlgindentsindentgroupoptions msgid "Indent" msgstr "Girinti" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Tabs" msgstr "Sekmeler" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" msgstr "Metodların önünde" #: lazarusidestrconsts.dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Constructor adı 'init' olmalıdır (destructor 'bitmiş' olmalıdır)" #: lazarusidestrconsts.dlginsertclassparts msgid "Insert class parts" msgstr "Sınıf parçalarını ekle" #: lazarusidestrconsts.dlginsertimplementation msgid "Implementation" msgstr "Implementation" #: lazarusidestrconsts.dlginsertinterface msgid "Interface" msgstr "Interface" #: lazarusidestrconsts.dlginsertmethods msgid "Insert method implementations" msgstr "Implementations metodlarını ekle" #: lazarusidestrconsts.dlginsertsection msgid "Insert into Uses section of" msgstr "Uses bölümüne ekleyin" #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" msgstr "Sona boşluk ekle" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" msgstr "Önüne boşluk ekle" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" msgstr "Saniye Aralığı" #: lazarusidestrconsts.dlgjumpcodeblockpos msgid "Vertical position for a code block jump in % (0=top, 100=bottom)" msgstr "Kod bloğu atlaması için % cinsinden dikey konum (0=üst, 100=alt)" #: lazarusidestrconsts.dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Atlama (ör. Metoda Atlama)" #: lazarusidestrconsts.dlgjumpsinglelinepos msgid "Vertical position for a single line jump in % (0=top, 100=bottom)" msgstr "Tek bir çizgi atlaması için % cinsinden dikey konum (0=üst, 100=alt)" #: lazarusidestrconsts.dlgjumptomethodbody msgid "Jump directly to method body" msgstr "Doğrudan yöntem gövdesine atla" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep caret X position when navigating up/down" msgstr "Yukarı/aşağı gezinirken imlecin X konumunu koruyun" #: lazarusidestrconsts.dlgkeylink msgid "(Edit Key)" msgstr "(Tuş Düzenle)" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" msgstr "Tuş haritası" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" msgstr "Tuş haritası hataları" #: lazarusidestrconsts.dlgkeywordpolicy msgid "Keyword policy" msgstr "Anahtar kelime politikası" #: lazarusidestrconsts.dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "LABEL ve GOTO'ya izin ver" #: lazarusidestrconsts.dlglang msgctxt "lazarusidestrconsts.dlglang" msgid "Language" msgstr "Dil" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" msgstr "Son (yani kaynağın sonunda)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Lazarus dizini (tüm projeler için varsayılan)" #: lazarusidestrconsts.dlglazarusinstances msgid "Lazarus instances" msgstr "Lazarus örnekleri" #: lazarusidestrconsts.dlglefttopclr msgid "Guide lines Left,Top" msgstr "Kılavuz Çizgileri Sol, Üst" #: lazarusidestrconsts.dlglevel1opt msgid "1 (quick, debugger friendly with small limitations)" msgstr "1 (küçük sınırlamalarla hızlı, hata ayıklayıcı dostu)" #: lazarusidestrconsts.dlglevel2opt msgid "2 (-O1 + quick optimizations)" msgstr "2 (-O1 + hızlı optimizasyon)" #: lazarusidestrconsts.dlglevel3opt msgid "3 (-O2 + slow optimizations)" msgstr "3 (-O2 + yavaş optimizasyon)" #: lazarusidestrconsts.dlglevel4opt msgid "4 (-O3 + aggressive optimizations, beware)" msgstr "4 (-O3 + agresif optimizasyon, dikkatli olun)" #: lazarusidestrconsts.dlglevelnoneopt msgid "0 (no optimization, for debugging)" msgstr "0 (hata ayıklayıcı için optimizasyon yok)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" msgstr "Satır Bölme" #: lazarusidestrconsts.dlglinksmart msgid "Link smart" msgstr "Akıllı bağlantı" #: lazarusidestrconsts.dlglnumsbct msgid "Display line numbers in run-time error backtraces" msgstr "Çalışma zamanı hata geri izlemelerinde satır numaralarını görüntüle" #: lazarusidestrconsts.dlgmainviewforms msgid "View Project Forms" msgstr "Proje Formlarını Görüntüle" #: lazarusidestrconsts.dlgmainviewframes msgid "View Project Frames" msgstr "Proje Framelerini Görüntüle" #: lazarusidestrconsts.dlgmainviewunits msgid "View Project Units" msgstr "Proje Birimlerini Görüntüle" #: lazarusidestrconsts.dlgmakeexecutable msgid "\"Make\" executable" msgstr "Yürütülebilir \"yap\"" #: lazarusidestrconsts.dlgmanagedesktops msgid "Manage desktops" msgstr "Masaüstlerini yönet" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" msgstr "Kenar boşluğu ve oluk" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" msgstr "İşaretçi rengi" #: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec #, object-pascal-format msgid "(%s sec delay after caret move)" msgstr "" #: lazarusidestrconsts.dlgmarkupfoldcolor msgid "Vertical-mark" msgstr "Dikey-işaret" #: lazarusidestrconsts.dlgmarkupgroup msgid "Highlight all occurrences of Word under Caret" msgstr "İmleç altındaki kelimenin bütün oluşumlarını vurgula" #: lazarusidestrconsts.dlgmarkupoutline msgid "Outline (global)" msgstr "Anahat (genel)" #: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor msgid "Warning: There are no colors configured for the selected language" msgstr "Uyarı: Seçilen dil için yapılandırılmış renk yok" #: lazarusidestrconsts.dlgmarkupuserdefined msgid "User defined markup" msgstr "Kullanıcı tanımlı biçimlendirme" #: lazarusidestrconsts.dlgmarkupuserdefineddelcaption msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption" msgid "Delete" msgstr "Sil" #: lazarusidestrconsts.dlgmarkupuserdefineddelprompt #, object-pascal-format msgid "Delete list \"%s\"?" msgstr "Listeyi sil \"%s\"?" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd #, fuzzy #| msgid "Add Word or Term" msgid "Add Word or Term by key" msgstr "Kelime veya Terim Ekle" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove #, fuzzy #| msgid "Remove Word or Term" msgid "Remove Word or Term by key" msgstr "Kelimeyi veya Terimi Kaldır" #: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle #, fuzzy #| msgid "Toggle Word or Term" msgid "Toggle Word or Term by key" msgstr "Kelimeyi veya Terimi Değiştir" #: lazarusidestrconsts.dlgmarkupuserdefinedduplicate msgid "Duplicate Term" msgstr "Yinelenen Terim" #: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg #, object-pascal-format msgid "The term %s already exists. Duplicates will be removed when the list is saved." msgstr "%s terimi zaten var. Liste kaydedildiğinde yinelenenler kaldırılacak." #: lazarusidestrconsts.dlgmarkupuserdefinedgloballist msgid "Add/Remove in all editors" msgstr "Tüm editörlerde Ekle/Kaldır" #: lazarusidestrconsts.dlgmarkupuserdefinedlistdel msgid "Delete list" msgstr "Listeyi sil" #: lazarusidestrconsts.dlgmarkupuserdefinedlistname msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname" msgid "Name" msgstr "Ad" #: lazarusidestrconsts.dlgmarkupuserdefinedlistnew msgid "Add list" msgstr "Liste ekle" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase msgid "Case sensitive" msgstr "Harfe duyarlı" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound msgid "Set bound at term end" msgstr "Terim sonunda sınırlanmış olarak ayarla" #: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound msgid "Set bound at term start" msgstr "Terim başında sınırlandırılmış ayarla" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen msgid "Ignore bounds for terms longer than" msgstr "Şundan daha uzun terimler için sınırları yoksay" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect msgid "selection" msgstr "seçim" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword msgid "current word" msgstr "geçerli kelime" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts msgid "Settings for terms added by key" msgstr "Tuş tarafından eklenen terimler için ayarlar" #: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect msgid "Smart match selection bounds" msgstr "Akıllı eşleşme seçim sınırları" #: lazarusidestrconsts.dlgmarkupuserdefinednewname msgid "New list" msgstr "Yeni liste" #: lazarusidestrconsts.dlgmarkupuserdefinednolists msgid "No lists" msgstr "Liste yok" #: lazarusidestrconsts.dlgmarkupuserdefinednolistssel msgid "Select ..." msgstr "Seç ..." #: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys #, fuzzy #| msgid "Key Settings" msgid "Key mappings" msgstr "Tuş Ayarları" #: lazarusidestrconsts.dlgmarkupuserdefinedpagemain msgid "Main settings" msgstr "Ana ayarlar" #: lazarusidestrconsts.dlgmarkupwordbracket msgid "Keyword brackets on caret (global)" msgstr "İmleçteki anahtar sözcükler (global)" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Match whole words, if length is less or equal to:" msgstr "Uzunluk şundan küçük veya eşitse, tam kelimeleri eşleştirin:" #: lazarusidestrconsts.dlgmarkupwordkeycombo #, object-pascal-format msgid "Markup current word by key: %s" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore keywords" msgstr "Anahtar kelimeleri yoksay" #: lazarusidestrconsts.dlgmarkupwordoncaretmove msgid "Automatically markup current word on caret move" msgstr "" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim spaces (when highlighting current selection)" msgstr "Boşlukları kırp(geçerli seçimi vurgularken)" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" msgstr "Maksimum sayaç" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" msgstr "Maks. Satır uzunluğu:" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" msgstr "Son güncellenen dosyalar" #: lazarusidestrconsts.dlgmaxrecenthint msgid "Value 0 means unlimited." msgstr "0 değeri sınırsız demektir." #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" msgstr "Maksimum yeni proje dosyaları" #: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod msgid "Middle-click-modifier to close all other tabs" msgstr "Diğer tüm sekmeleri kapatmak için orta tıklamayla değiştirir" #: lazarusidestrconsts.dlgmiddletabcloserightpagesmod msgid "Middle-click-modifier to close tabs on the right" msgstr "Sağdaki sekmeleri kapatmak için orta tıklama değiştir" #: lazarusidestrconsts.dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "Karışım yöntemleri ve özellikleri" #: lazarusidestrconsts.dlgmode msgid "Mode" msgstr "Mod" #: lazarusidestrconsts.dlgmouseaction msgid "Mouse Action" msgstr "Fare Hareketi" #: lazarusidestrconsts.dlgmouseoptbtn1 msgctxt "lazarusidestrconsts.dlgmouseoptbtn1" msgid "Single" msgstr "Tek" #: lazarusidestrconsts.dlgmouseoptbtn2 msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" msgid "Double" msgstr "Çift" #: lazarusidestrconsts.dlgmouseoptbtn3 msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" msgid "Triple" msgstr "Üçlü" #: lazarusidestrconsts.dlgmouseoptbtn4 msgctxt "lazarusidestrconsts.dlgmouseoptbtn4" msgid "Quad" msgstr "Dörtlü" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" msgstr "Herhangi biri" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1" msgid "Extra 1" msgstr "Ekstra 1" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2" msgid "Extra 2" msgstr "Ekstra 2" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" msgstr "Sol" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" msgstr "Orta" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" msgstr "Geri Dönüş Yap" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" msgstr "Sağ" #: lazarusidestrconsts.dlgmouseoptbtnwheeldown msgid "Wheel down" msgstr "Tekerlek aşağı" #: lazarusidestrconsts.dlgmouseoptbtnwheelleft msgid "Wheel left" msgstr "Sol tekerlek" #: lazarusidestrconsts.dlgmouseoptbtnwheelright msgid "Wheel right" msgstr "Sağ tekerlek" #: lazarusidestrconsts.dlgmouseoptbtnwheelup msgid "Wheel up" msgstr "Tekerlek yukarı" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" msgstr "Almak" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" msgstr "İmleci Taşı (ekstra)" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" msgstr "Fare yukarı hareket aksiyonu" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" msgid "Action" msgstr "Aksiyon" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" msgstr "Tıkla" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" msgstr "Fare Düzenle" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" msgstr "Yinelenen Giriş" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" msgstr "Bu giriş mevcut bir girişle çakışıyor" #: lazarusidestrconsts.dlgmouseoptheadalt msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" msgstr "Düğme" #: lazarusidestrconsts.dlgmouseoptheadcaret msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret" msgid "Caret" msgstr "İmleç" #: lazarusidestrconsts.dlgmouseoptheadcontext msgid "Context" msgstr "İçerik" #: lazarusidestrconsts.dlgmouseoptheadcount msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" msgid "Click" msgstr "Tıkla" #: lazarusidestrconsts.dlgmouseoptheadctrl msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptheaddesc msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" msgid "Action" msgstr "Aksiyon" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" msgstr "Yukarı/aşağı" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" msgstr "Seçenek" #: lazarusidestrconsts.dlgmouseoptheadorder msgid "Order" msgstr "Sıra" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" msgstr "Öncelikli" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" msgid "Shift" msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptions msgid "Mouse" msgstr "Fare" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" msgstr "Gelişmiş" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" msgstr "IDE-Komut" #: lazarusidestrconsts.dlgmouseoptmodalt msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptmodctrl msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" msgstr "n" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" msgstr "-" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" msgstr "Y" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" msgid "Shift" msgstr "Shift" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" msgstr "Y" #: lazarusidestrconsts.dlgmouseoptnodeall msgctxt "lazarusidestrconsts.dlgmouseoptnodeall" msgid "All" msgstr "Tümü" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" msgid "Gutter" msgstr "Oluk" #: lazarusidestrconsts.dlgmouseoptnodegutterchanges msgid "Line Changes" msgstr "Satır Değişiklikleri" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" msgstr "Kat Ağacı" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" msgstr "Daraltılmış [+]" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" msgstr "Genişletilmiş [-]" #: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview msgid "Overview" msgstr "Genel bakış" #: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks msgid "Overview Mark" msgstr "Genel Bakış İşareti" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" msgstr "Satır Numaraları" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" msgid "Text" msgstr "Metin" #: lazarusidestrconsts.dlgmouseoptnodeselect msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" msgid "Selection" msgstr "Seçim" #: lazarusidestrconsts.dlgmouseoptopt2label msgid "Opt" msgstr "Opt" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" msgstr "Aynı düğmeyi kullanan diğer eylemler" #: lazarusidestrconsts.dlgmouseoptotheracthint msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." msgstr "Değiştirme Tuşları, Ayrıntılı Ayarlar, Tek/Çift, Yukarı/Aşağı öğelerine bağlı olarak çalıştırılabilirler...." #: lazarusidestrconsts.dlgmouseoptotheracttoggle msgid "Filter Mod-Keys" msgstr "Filtre Mod - tuşları" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" msgid "Priority" msgstr "Öncelikli" #: lazarusidestrconsts.dlgmsgwincolorurgentdebug msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug" msgid "Debug" msgstr "Hata ayıklama" #: lazarusidestrconsts.dlgmsgwincolorurgenterror msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror" msgid "Error" msgstr "Hata" #: lazarusidestrconsts.dlgmsgwincolorurgentfatal msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal" msgid "Fatal" msgstr "Ölümcül" #: lazarusidestrconsts.dlgmsgwincolorurgenthint msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint" msgid "Hint" msgstr "İpucu" #: lazarusidestrconsts.dlgmsgwincolorurgentimportant msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant" msgid "Important" msgstr "Önemli" #: lazarusidestrconsts.dlgmsgwincolorurgentnone msgid "Normal" msgstr "Normal" #: lazarusidestrconsts.dlgmsgwincolorurgentnote msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote" msgid "Note" msgstr "Not" #: lazarusidestrconsts.dlgmsgwincolorurgentpanic msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic" msgid "Panic" msgstr "Panik" #: lazarusidestrconsts.dlgmsgwincolorurgentprogress msgid "Time and statistics" msgstr "Zaman ve istatistikler" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose" msgid "Verbose" msgstr "Ayrıntılı" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose2 msgid "Verbose 2" msgstr "Ayrıntılı 2" #: lazarusidestrconsts.dlgmsgwincolorurgentverbose3 msgid "Verbose 3" msgstr "Ayrıntılı 3" #: lazarusidestrconsts.dlgmsgwincolorurgentwarning msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning" msgid "Warning" msgstr "Uyarı" #: lazarusidestrconsts.dlgmulticaretcolumnmode msgid "Navigation keys move all carets (column-select)" msgstr "Çoklu liste (sütun seçimi) imleci hareket ettir" #: lazarusidestrconsts.dlgmulticaretdelskipcr msgid "Skip delete key at EOL (do not join lines)" msgstr "EOL'deki silme anahtarını atla (satırlara katılma)" #: lazarusidestrconsts.dlgmulticaretgroupoptions msgid "Multi-caret" msgstr "Çoklu-imleç" #: lazarusidestrconsts.dlgmulticaretmode msgid "Navigation keys move all carets" msgstr "İmleçle birlikte çok satırlı hareket" #: lazarusidestrconsts.dlgmulticaretoncolumnselection msgid "Enable multi-caret for column selection" msgstr "Sütun seçimi için çoklu imleci etkinleştir" #: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew msgid "always start a new instance" msgstr "her zaman yeni bir Lazarus da dosyayı aç" #: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance msgid "do not allow multiple instances" msgstr "aynı anda birden fazla Lazarus çalışmasın" #: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning msgid "open files in a running instance" msgstr "çalışan mevcut Lazarus da dosyaları aç" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" msgstr "Çoklu seçim" #: lazarusidestrconsts.dlgmultiwinaccessgroup msgid "Jump target priority between multiple editors" msgstr "Birden çok editör arasında hedef önceliğini atla" #: lazarusidestrconsts.dlgmultiwinaccessorder msgid "Order to use for editors matching the same criteria" msgstr "Aynı kriterlere uyan editörler için kullanım sırası" #: lazarusidestrconsts.dlgmultiwinaccessorderedit msgid "Most recent focused editor for this file" msgstr "Bu dosya için en son odaklanmış editör" #: lazarusidestrconsts.dlgmultiwinaccessorderwin msgid "Editor (for file) in most recent focused window" msgstr "En son odaklanan pencerede Editör (dosya için)" #: lazarusidestrconsts.dlgmultiwinaccesstype msgid "Priority list of criteria to choose an editor:" msgstr "Bir düzenleyici seçmek için kriterlerin öncelik listesi:" #: lazarusidestrconsts.dlgmultiwinoptions msgid "Pages and Windows" msgstr "Sayfalar ve Pencereler" #: lazarusidestrconsts.dlgmultiwintabgroup msgid "Notebook Tabs" msgstr "Editör Sekmeleri" #: lazarusidestrconsts.dlgnaming msgid "Naming" msgstr "Adlandırma" #: lazarusidestrconsts.dlgnewdesktop msgid "New desktop ..." msgstr "Yeni masaüstü ..." #: lazarusidestrconsts.dlgnewprojecttype msgid "New Project Type" msgstr "Yeni Proje Türü" #: lazarusidestrconsts.dlgnoautomaticrenaming msgid "No automatic renaming" msgstr "Otomatik yeniden adlandırma yok" #: lazarusidestrconsts.dlgnoavailableunits msgid "No available units to add." msgstr "Eklenebilecek birim yok." #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" msgstr "Vurgulama Yok" #: lazarusidestrconsts.dlgnonformbackgroundcolor msgid "Other Designer background (e. g. TDataModule)" msgstr "Diğer Tasarımcı arka planı (ör. TDataModule)" #: lazarusidestrconsts.dlgnotebooktabpos msgid "Source notebook tabs position" msgstr "Kaynak sekmeleri konumu" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after" msgstr "Satırın sonunu bölme" #: lazarusidestrconsts.dlgnotsplitlinefront msgid "Do not split line in front of" msgstr "Satırın önünü bölme" #: lazarusidestrconsts.dlgnsprincipalclass msgid "NSPrincipalClass" msgstr "NSPrincipalClass" #: lazarusidestrconsts.dlgobjinsp msgctxt "lazarusidestrconsts.dlgobjinsp" msgid "Object Inspector" msgstr "Nesne(Bileşen) Özellikleri" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height (0 = auto)" msgstr "Öğe yüksekliği(otomatik=0)" #: lazarusidestrconsts.dlgoimiscellaneous msgctxt "lazarusidestrconsts.dlgoimiscellaneous" msgid "Miscellaneous" msgstr "Çeşitli" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" msgstr "Hızlı ayarlar" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" msgstr "Delphi varsayılan ayarlarını kullan" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" msgstr "Lazarus varsayılan ayarlarını kullan" #: lazarusidestrconsts.dlgoptimizationlevels msgid "Optimization levels" msgstr "İyileştirilme seviyeleri" #: lazarusidestrconsts.dlgotheroptimizations msgid "Other optimizations" msgstr "Diğer optimizasyonlar" #: lazarusidestrconsts.dlgotherunitfiles msgid "Other unit files (-Fu):" msgstr "Diğer birim dosyaları (-Fu):" #: lazarusidestrconsts.dlgoverviewgutterback1color msgid "Background 1" msgstr "Arkaplan 1" #: lazarusidestrconsts.dlgoverviewgutterback2color msgid "Background 2" msgstr "Arkaplan 2" #: lazarusidestrconsts.dlgoverviewguttercolor msgid "Overview Gutter" msgstr "Genel Bakış" #: lazarusidestrconsts.dlgoverviewgutterpagecolor msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor" msgid "Page" msgstr "Sayfa" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite block" msgstr "Bloğun üzerine yaz" #: lazarusidestrconsts.dlgoverwritedesktop #, object-pascal-format msgid "" "Desktop with the name \"%s\" was found.\n" "Should the old desktop be overwritten?" msgstr "" "\"%s\" adında bir masaüstü bulundu.\n" "Eski masaüstünün üzerine yazılsın mı?" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" msgstr "Bileşen paleti için İpuçları" #: lazarusidestrconsts.dlgpasext msgid "Default Pascal extension" msgstr "Varsayılan Pascal uzantısı" #: lazarusidestrconsts.dlgpasextkeywords msgid "Highlight control statements as keywords" msgstr "Kontrol ifadelerini anahtar kelime olarak vurgulayın" #: lazarusidestrconsts.dlgpasextkeywordsgroup msgid "Extended Pascal Keyword Options" msgstr "Genişletilmiş Pascal Anahtar Kelime Seçenekleri" #: lazarusidestrconsts.dlgpaskeywordsmarkup msgid "Markup (on caret)" msgstr "İşaretle (İmleç üzerinde)" #: lazarusidestrconsts.dlgpaskeywordsmatches msgid "Matching Keywords" msgstr "Eşleşen Anahtar Kelimeler" #: lazarusidestrconsts.dlgpaskeywordsoutline msgid "Outline" msgstr "Anahat" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass options to linker with \"-k\", delimiter is space" msgstr "\"-k\" ile bağlayıcıya geçiş seçenekleri, sınırlayıcı boşluktur" #: lazarusidestrconsts.dlgpasstringkeywords msgid "Highlight \"String\" keyword(s)" msgstr "\"String\" anahtar kelimelerini vurgula" #: lazarusidestrconsts.dlgpasstringkeywordsoptdefault msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" msgid "Default" msgstr "Varsayılan" #: lazarusidestrconsts.dlgpasstringkeywordsoptnone msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" msgid "None" msgstr "Yok" #: lazarusidestrconsts.dlgpasstringkeywordsoptstring msgid "Only \"String\"" msgstr "Sadece \"String\"" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent block" msgstr "Kalıcı blok" #: lazarusidestrconsts.dlgpersistentcursor msgid "Visible caret in unfocused editor" msgstr "Odaklanmamış düzenleyicide imleci göster" #: lazarusidestrconsts.dlgpersistentcursornoblink msgid "Caret in unfocused editor does not blink" msgstr "Odaklanmamış düzenleyicideki imleç yanıp sönsün" #: lazarusidestrconsts.dlgpoansiutf8 msgid "ANSI codepage is UTF-8 (Windows 10 1903+)" msgstr "ANSI kod sayfası UTF-8 'dir (Windows 10 1903+)" #: lazarusidestrconsts.dlgpoapplication msgid "Application" msgstr "Uygulama" #: lazarusidestrconsts.dlgpoasinvoker msgid "as invoker (asInvoker)" msgstr "çağıran olarak (asInvoker)" #: lazarusidestrconsts.dlgpoclearicon msgid "&Clear Icon" msgstr "&Ikonu temizle" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" msgstr "Uygulama Paketi Oluştur" #: lazarusidestrconsts.dlgpodebugger msgctxt "lazarusidestrconsts.dlgpodebugger" msgid "Debugger" msgstr "Hata ayıklayıcı" #: lazarusidestrconsts.dlgpodefaulticon msgid "Load &Default" msgstr "Varsayılanı yükle" #: lazarusidestrconsts.dlgpodpiawareness msgid "DPI awareness" msgstr "DPI farkındalığı" #: lazarusidestrconsts.dlgpodpiawarenessoff msgid "off" msgstr "kapalı" #: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor msgid "Vista-8: off, 8.1+: per monitor" msgstr "Vista-8: kapalı, 8.1+: monitör başına" #: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor msgid "Vista-8: on, 8.1+: per monitor" msgstr "Vista-8: açık, 8.1+: monitör başına" #: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2 msgid "Vista-8: on, 8.1/10+: per monitor/V2" msgstr "Vista-8: açık, 8.1/10+: monitör başına /V2" #: lazarusidestrconsts.dlgpodpiawarenesson msgid "on" msgstr "on" #: lazarusidestrconsts.dlgpoexecutionlevel msgid "Execution Level" msgstr "Yürütme Seviyesi" #: lazarusidestrconsts.dlgpofroms msgid "Forms" msgstr "Formlar" #: lazarusidestrconsts.dlgpohighestavailable msgid "highest available (highestAvailable)" msgstr "mevcut en yüksek (en yüksek kullanılabilir)" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" msgstr "i18n" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" msgstr "Simge:" #: lazarusidestrconsts.dlgpoicondesc #, object-pascal-format msgid "(size: %d:%d, bpp: %d)" msgstr "(Boyut: %d:%d, bpp: %d)" #: lazarusidestrconsts.dlgpoicondescnone msgid "(none)" msgstr "(Yok)" #: lazarusidestrconsts.dlgpointertypecheck msgid "@ returns a typed pointer" msgstr "@ yazılan bir işaretçiyi döndürür" #: lazarusidestrconsts.dlgpoloadicon msgid "&Load Icon" msgstr "&Simge Yükle" #: lazarusidestrconsts.dlgpolongpathaware msgid "Long path awareness (Windows 10 1607+)" msgstr "Uzun yol farkındalığı (Windows 10 1607+)" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" msgid "Miscellaneous" msgstr "Çeşitli" #: lazarusidestrconsts.dlgporequireadministrator msgid "require administrator (requireAdministrator)" msgstr "yönetici gerektirir (yönetici gerektir)" #: lazarusidestrconsts.dlgporesources msgid "Resources" msgstr "Kaynaklar" #: lazarusidestrconsts.dlgposaveicon msgid "&Save Icon" msgstr "&Simgeyi Kaydet" #: lazarusidestrconsts.dlgposavesession msgid "Session" msgstr "Oturum" #: lazarusidestrconsts.dlgpotitle msgid "Title:" msgstr "Başlık:" #: lazarusidestrconsts.dlgpouiaccess msgid "UI Access (uiAccess)" msgstr "Kullanıcı Arayüz Erişimi (uiAccess)" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging" msgstr "Çalıştırma ve hata ayıklama için Uygulama Paketini kullanın" #: lazarusidestrconsts.dlgpouselclscaling msgid "Use LCL scaling (Hi-DPI)" msgstr "LCL ölçeklendirmesi kullan (Hi-DPI)" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest resource (and enable themes)" msgstr "Temaları etkinleştirmek için manifest dosyasını kullanın" #: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick msgid "Prefer double-click over single-click" msgstr "Tek tıklama yerine çift tıklamayı tercih edin" #: lazarusidestrconsts.dlgpriorities msgid "Priorities" msgstr "Öncelikler" #: lazarusidestrconsts.dlgproject msgctxt "lazarusidestrconsts.dlgproject" msgid "Project" msgstr "Proje" #: lazarusidestrconsts.dlgprojectoptionsfor #, object-pascal-format msgid "Options for Project: %s" msgstr "Proje Seçenekleri: %s" #: lazarusidestrconsts.dlgprojecttoopenorcreate msgid "Project to Open or Create" msgstr "Açılacak veya Oluşturulacak Proje" #: lazarusidestrconsts.dlgprojfiles msgid "Project Files" msgstr "Proje Dosyaları" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt on replace" msgstr "&Değiştirme istemi" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" msgstr "Property tamamlanması" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" msgstr "Property adı" #: lazarusidestrconsts.dlgqopenlastprj msgid "Open last project and packages at start" msgstr "Başlangıçta son proje ve paketleri aç" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" msgstr "Kenar boşluğunu göster" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" msgstr "Izgarayı göster" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" msgstr "Izgaraya yapış" #: lazarusidestrconsts.dlgreallydeletedesktop #, object-pascal-format msgid "Really delete desktop \"%s\"?" msgstr "Masaüstünü gerçekten silmek istiyormusunuz \"%s\"?" #: lazarusidestrconsts.dlgredirappend msgid "To file (append)" msgstr "Dosyaya (ekleme)" #: lazarusidestrconsts.dlgredirinput msgid "From file" msgstr "Dosyadan" #: lazarusidestrconsts.dlgredirinputend msgid "From file (at EOF)" msgstr "Dosyadan (EOF'de)" #: lazarusidestrconsts.dlgrediroff msgid "No redirection" msgstr "Yönlendirme yok" #: lazarusidestrconsts.dlgrediroverwrite msgid "To file (overwrite)" msgstr "Dosyaya (üzerine yaz)" #: lazarusidestrconsts.dlgredirstderr msgid "Redirect StdErr" msgstr "StdErr Yönlendir" #: lazarusidestrconsts.dlgredirstdin msgid "Redirect StdIn" msgstr "StdIn'i Yönlendir" #: lazarusidestrconsts.dlgredirstdnotsupported msgid "Current debugger does not support redirection." msgstr "Mevcut hata ayıklayıcı yeniden yönlendirmeyi desteklemiyor." #: lazarusidestrconsts.dlgredirstdout msgid "Redirect StdOut" msgstr "StdOut'u Yönlendir" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" msgstr "Referans" #: lazarusidestrconsts.dlgregularexpressions msgid "Regular e&xpressions" msgstr "Düzenli ifadeler" #: lazarusidestrconsts.dlgrenamedesktop msgid "Rename desktop" msgstr "Masaüstünü yeniden adlandır" #: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption" msgid "Rename" msgstr "Yeniden Adlandır" #: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint msgid "Rename selected desktop" msgstr "Seçili masaüstünü yeniden adlandır" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" msgstr "&Hepsini değiştir" #: lazarusidestrconsts.dlgreplacewith msgid "Replace wit&h" msgstr "&İle değiştirin" #: lazarusidestrconsts.dlgreport msgid "Report" msgstr "Rapor" #: lazarusidestrconsts.dlgreset msgctxt "lazarusidestrconsts.dlgreset" msgid "Reset" msgstr "Sıfırla" #: lazarusidestrconsts.dlgresetall msgid "Reset all" msgstr "Tümünü sıfırla" #: lazarusidestrconsts.dlgrightbottomclr msgid "Guide lines Right,Bottom" msgstr "Kılavuz çizgiler sağ, alt" #: lazarusidestrconsts.dlgrightclickselects msgid "Right click selects" msgstr "Sağ tıklamayla seç" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" msgstr "Sağ kenar" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" msgstr "Çalışma dizini" #: lazarusidestrconsts.dlgrubberbandselectsgrandchildren msgid "Select grandchildren" msgstr "Alt bileşenleride seç" #: lazarusidestrconsts.dlgruberbandcreationcolor msgid "Rubberband Creation" msgstr "Lastik Bant Oluşturma" #: lazarusidestrconsts.dlgruberbandselectioncolor msgid "Rubberband Selection" msgstr "Lastik Bant Seç" #: lazarusidestrconsts.dlgrunninginstancemodalerror #, object-pascal-format msgid "" "The running Lazarus instance cannot accept any files.\n" "Do you want to open them in a new IDE instance?\n" "\n" "%s" msgstr "" "Çalışmakta olan Lazarus da bu dosya açılamaz.\n" "Yeni bir Larzarus da dosya açılsın mı?\n" "\n" "%s" #: lazarusidestrconsts.dlgrunninginstancenotrespondingerror msgid "Lazarus instance is running but not responding." msgstr "Lazarus çalışıyor ancak yanıt vermiyor." #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Görüntüleme (win32 için değil, ör. 198.112.45.11:0, x.org:1, hydra: 0.1)" #: lazarusidestrconsts.dlgrunoenvironment msgctxt "lazarusidestrconsts.dlgrunoenvironment" msgid "Environment" msgstr "Ortam" #: lazarusidestrconsts.dlgrunolocal msgid "Local" msgstr "Yerel" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" msgstr "Sistem değişkenleri" #: lazarusidestrconsts.dlgrunousedisplay msgid "Use display" msgstr "Görüntüyü kullan" #: lazarusidestrconsts.dlgrunouseroverrides msgid "User overrides" msgstr "Kullanıcı geçersiz kılma" #: lazarusidestrconsts.dlgrunparameters msgid "Run Parameters" msgstr "Parametreleri Çalıştır" #: lazarusidestrconsts.dlgrunwithdebug msgid "Run uses the debugger (disable for release-mode)" msgstr "Çalıştırma hata ayıklayıcıyı kullanır (serbest bırakma modu için devre dışı bırakın)" #: lazarusidestrconsts.dlgsavecurrentdesktop msgid "Save current desktop" msgstr "Geçerli masaüstünü kaydet" #: lazarusidestrconsts.dlgsavecurrentdesktopas msgid "Save current desktop as" msgstr "Geçerli masaüstünü şu şekilde kaydet" #: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption msgid "Save active desktop as ..." msgstr "Aktif masaüstünü farklı kaydet.." #: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint msgid "Save active desktop as" msgstr "Aktif masaüstünü farklı kaydet" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" msgstr "Kaydedilen satır" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "Kapatılan dosyalar için editör bilgisini kaydet" #: lazarusidestrconsts.dlgsaveeditorinfohint msgid "The files are available in the \"Open Recent\" history list." msgstr "Dosyalar \"Son Açılanlar\" geçmiş listesinde mevcuttur." #: lazarusidestrconsts.dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "Editör bilgilerini yalnızca proje dosyaları için kaydet" #: lazarusidestrconsts.dlgsaveeditorinfoprojecthint msgid "Only files that belong to this project." msgstr "Sadece bu projeye ait dosyalar." #: lazarusidestrconsts.dlgsavein msgid "Save in" msgstr "Kaydet" #: lazarusidestrconsts.dlgscrollbarpasteolfixed msgid "Force 1024 columns minimum for horizontal scroll range" msgstr "Yatay kaydırma aralığı için minimum 1024 sütunu zorla" #: lazarusidestrconsts.dlgscrollbarpasteolnone msgid "Do not add any permanent space to horizontal scroll range" msgstr "Yatay kaydırma aralığına kalıcı boşluk eklemeyin" #: lazarusidestrconsts.dlgscrollbarpasteolpage msgid "Always add one page to horizontal scroll range" msgstr "Yatay kaydırma aralığına her zaman bir sayfa ekleyin" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" msgstr "Bir daha kaydırın" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling" msgstr "Kaydırma" #: lazarusidestrconsts.dlgscrollhint msgctxt "lazarusidestrconsts.dlgscrollhint" msgid "Show scroll hint" msgstr "Kaydırma ipucunu göster" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" msgstr "Dosyanın sonuna kaydır" #: lazarusidestrconsts.dlgscrollpastendline msgid "Allow Caret to move past the end of line" msgstr "İmlecin satırın sonunu geçmesine izin ver" #: lazarusidestrconsts.dlgseachdirectorynotfound #, object-pascal-format msgid "Search directory \"%s\" not found." msgstr "Aranan dizin \"%s\" bulunamadı." #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." msgstr "Arama kullanıcı tarafından sonlandırıldı." #: lazarusidestrconsts.dlgsearchcaption msgid "Searching ..." msgstr "Aranıyor...." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" msgstr "Yollar" #: lazarusidestrconsts.dlgsearchscope msgid "Search scope" msgstr "Arama kapsamı" #: lazarusidestrconsts.dlgselectallchildcontrols msgid "Select all child controls together with their parent." msgstr "Tüm alt bileşenleri parent birleşen ile birlikte seçin." #: lazarusidestrconsts.dlgselectallnoscroll msgid "Do not scroll on Select-All / Paragraph or To-Brace" msgstr "Tümünü Seç / Paragraf veya Küme Ayracı'na kaydırmayın" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected text" msgstr "&Seçili metin" #: lazarusidestrconsts.dlgsetactivedesktopbtncaption msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption" msgid "Set active" msgstr "Aktif et" #: lazarusidestrconsts.dlgsetactivedesktopbtnhint msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint" msgid "Set active" msgstr "Aktif et" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" msgstr "Tüm öğeleri varsayılana ayarla" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" msgstr "Öğe değerini varsayılana ayarla" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" msgstr "Değişken özelliklerini ayarla" #: lazarusidestrconsts.dlgsetpropertyvariablehint msgid "The parameter name for the default setter procedure." msgstr "Varsayılan ayarlayıcı prosedürü için parametre adı." #: lazarusidestrconsts.dlgsetpropertyvariableisprefix msgid "is prefix" msgstr "öneki" #: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name." msgstr "\"Değişken özelliklerini ayarla\" işaretlenirse bir önektir. Aksi takdirde sabit bir isimdir." #: lazarusidestrconsts.dlgsetpropertyvariableuseconst msgid "use const" msgstr "const kullan" #: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint msgid "If checked, the setter parameter is marked with \"const\"." msgstr "İşaretlenirse, ayarlayıcı parametresi \"const\" ile işaretlenir." #: lazarusidestrconsts.dlgshowallunits msgid "Show all units" msgstr "Tüm birimleri göster" #: lazarusidestrconsts.dlgshowcaptionsofnonvisuals msgid "Show captions of nonvisual components" msgstr "Görsel olmayan bileşenlerin başlıklarını göster" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "Derlenmiş işlemleri göster" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" msgstr "Satır numaralarını göster" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" msgstr "Koşul şartlarını göster" #: lazarusidestrconsts.dlgshowdebuginfo msgid "Show debug info" msgstr "Hata ayıklama bilgilerini göster" #: lazarusidestrconsts.dlgshowdesignerhints msgid "Show designer hints" msgstr "Tasarımcı ipuçlarını göster" #: lazarusidestrconsts.dlgshowdesignerhintshint msgid "Hint shows control's position or size while moving or resizing it." msgstr "İpucu, taşınırken veya yeniden boyutlandırırken kontrolün konumunu veya boyutunu gösterir." #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" msgstr "Her şeyi göster" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "Çalıştırılabilir bilgileri göster (yalnızca Win32)" #: lazarusidestrconsts.dlgshowfilenameincaption msgid "Show file name in caption" msgstr "Dosya adını başlıkta göster" #: lazarusidestrconsts.dlgshowgeneralinfo msgid "Show general info" msgstr "Genel bilgiyi göster" #: lazarusidestrconsts.dlgshowgutterhints msgid "Show gutter hints" msgstr "Oluk ipuçlarını göster" #: lazarusidestrconsts.dlgshowhint msgctxt "lazarusidestrconsts.dlgshowhint" msgid "Show hints" msgstr "İpuçlarını göster" #: lazarusidestrconsts.dlgshowingwindows msgid "Showing Windows" msgstr "Gösterilen Pencereler" #: lazarusidestrconsts.dlgshowlinenumbers msgctxt "lazarusidestrconsts.dlgshowlinenumbers" msgid "Show line numbers" msgstr "Satır numaralarını göster" #: lazarusidestrconsts.dlgshowmessagesicons msgid "Show Messages Icons" msgstr "Mesaj Simgelerini Göster" #: lazarusidestrconsts.dlgshownotes msgid "Show notes" msgstr "Notları göster" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" msgstr "Çalıştırılan dosyaları göster" #: lazarusidestrconsts.dlgshowusedfiles msgid "Show used files" msgstr "Kullanılmış dosyaları göster" #: lazarusidestrconsts.dlgshowwarnings msgid "Show warnings" msgstr "Uyarıları göster" #: lazarusidestrconsts.dlgsingletaskbarbutton msgid "Show single button in TaskBar" msgstr "TaskBar'da tek düğmeyi göster" #: lazarusidestrconsts.dlgskipforwardclassdeclarations msgid "Skip forward class declarations" msgstr "İleri sınıf bildirimlerini atla" #: lazarusidestrconsts.dlgslashcommenttab msgid "Slash //" msgstr "Kesme //" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" msgstr "Akıllı sekmeler" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Arkasına Sembol ekle (.pp ~)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Sayaç (.pp; 1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Önüne sembol ekle (~ ~ pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Kılavuz Çizgilere Yapış" #: lazarusidestrconsts.dlgsnapguidelineshint msgid "When a control is close to being aligned with another control, it snaps to the aligned position." msgstr "Bir kontrol başka bir kontrolle hizalanmaya yaklaştığında, hizalanan konuma yapışır." #: lazarusidestrconsts.dlgsourceedittabmultiline msgid "Multiline tabs" msgstr "Çok Satırlı Sekmeler" #: lazarusidestrconsts.dlgspacenotcosmos msgctxt "lazarusidestrconsts.dlgspacenotcosmos" msgid "Space" msgstr "Boşluk" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "Ana hızlı düğmeler için ipuçları (açık, kaydet ...)" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" msgstr "Köken" #: lazarusidestrconsts.dlgstacksize msgid "Stack size" msgstr "Yığın boyutu" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Hata sayısından sonra dur:" #: lazarusidestrconsts.dlgstringautoappend msgid "Append text to close string" msgstr "Stringi kapatmak için metin ekle" #: lazarusidestrconsts.dlgstringautoprefix msgid "Prefix string on new line" msgstr "Yeni satıra önek dize" #: lazarusidestrconsts.dlgstringbreakindenttab msgid "String ''" msgstr "String ''" #: lazarusidestrconsts.dlgstringenableautocontinue msgid "Extend strings on linebreak" msgstr "Satır sonuna Stringleri uzat" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" msgstr "Alt özelliklerini" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" msgstr "Sözdizimi seçenekleri" #: lazarusidestrconsts.dlgtabindent msgid "Tab indents blocks" msgstr "Sekme girintileri engeller" #: lazarusidestrconsts.dlgtabnumbersnotebook msgid "Show tab numbers in notebook" msgstr "Sekme numaralarını deftere göster" #: lazarusidestrconsts.dlgtabstospaces msgid "Tabs to spaces" msgstr "Sekme boşluğu" #: lazarusidestrconsts.dlgtabwidths msgid "Tab widths" msgstr "Sekme genişlikleri" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" msgstr "Hedef CPU ailesi" #: lazarusidestrconsts.dlgtargetos msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" msgstr "Hedef İşletim Sistemi" #: lazarusidestrconsts.dlgtargetplatform msgid "Target platform" msgstr "Hedef platform" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" msgstr "Hedef işlemci" #: lazarusidestrconsts.dlgtargetspecificoptions msgid "Target-specific options" msgstr "Hedefe özel seçenekler" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" msgstr "Test projeleri hazırlama klasörü" #: lazarusidestrconsts.dlgtextstyle msgid "Text-Style" msgstr "Yazı Stili" #: lazarusidestrconsts.dlgtexttofind msgid "Search s&tring" msgstr "&Bulunacak metin" #: lazarusidestrconsts.dlgthiselementusescolor msgid "The element uses (and edits) the schemes:" msgstr "Öğe, şemaları kullanır (ve düzenler):" #: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption" msgid "Toggle as debug desktop" msgstr "Hata ayıklama masaüstü olarak aç / kapat" #: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint" msgid "Toggle as debug desktop" msgstr "Hata ayıklama masaüstü olarak aç / kapat" #: lazarusidestrconsts.dlgtopinfohint msgid "Current Class/Proc Hint" msgstr "Geçerli Sınıf / Proc İpucu" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim spaces style" msgstr "Boşluk stilini kırp" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" msgstr "İmleç veya Düzenle" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" msgstr "Satır Düzenlendi" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" msgstr "Satır bırak" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" msgstr "Yalnızca pozisyon" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Sondaki boşlukları kırp" #: lazarusidestrconsts.dlgundoaftersave msgid "Undo after save" msgstr "Kaydettikten sonra geri al" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo" msgstr "Geri Al/İleri al" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" msgstr "Geri alma limiti" #: lazarusidestrconsts.dlgunitdeprefresh msgid "Refresh" msgstr "Yenile" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" msgstr "Birim çıkış dizini (-FU):" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" msgstr "Kaydedilmemiş satır" #: lazarusidestrconsts.dlgusecodefolding msgid "Code Folding" msgstr "Kod Katlama" #: lazarusidestrconsts.dlguseconsolebuffer msgid "Set Columns/Rows" msgstr "Sütunları/Satırları Ayarla" #: lazarusidestrconsts.dlguseconsolepos msgid "Set Left/Top" msgstr "Sol/Üst Ayarı" #: lazarusidestrconsts.dlguseconsolesize msgid "Set Width/Height" msgstr "Genişlik/Yükseklik Ayarı" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional compiler config file" msgstr "Ek derleyici yapılandırma dosyası kullanın" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider Drawing" msgstr "Bölücü Çizimi" #: lazarusidestrconsts.dlgusefpccfg msgid "Use standard compiler config file (fpc.cfg)" msgstr "Standart derleyici yapılandırma dosyasını (fpc.cfg) kullanın" #: lazarusidestrconsts.dlgusehighlight msgid "Use Highlight" msgstr "Vurgulamayı Kullan" #: lazarusidestrconsts.dlguseiconsincompletionbox msgid "Icons in code completion box" msgstr "Kod tamamlama kutusundaki simgeler" #: lazarusidestrconsts.dlguselaunchingapp msgid "Use launching application" msgstr "Başlatma uygulaması kullan" #: lazarusidestrconsts.dlguseminimumime msgid "IME handled by System" msgstr "Sistem tarafından işlenen IME" #: lazarusidestrconsts.dlguserschemeerror #, object-pascal-format msgid "Failed to load user-scheme file %s" msgstr "%s kullanıcı şema dosyası yüklenemedi" #: lazarusidestrconsts.dlguseschemedefaults msgid "- Scheme globals -" msgstr "- Global Şema -" #: lazarusidestrconsts.dlguseschemelocal msgid "selected language" msgstr "dil seçin" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Sözdizimi vurgulamayı kullan" #: lazarusidestrconsts.dlgusetabshistory msgid "Use tab history when closing tabs" msgstr "Sekmeleri kapatırken sekme geçmişi kullanın" #: lazarusidestrconsts.dlguseunitcaption msgid "Add unit to Uses section" msgstr "Uses alanına birim ekle" #: lazarusidestrconsts.dlgvaluecolor msgctxt "lazarusidestrconsts.dlgvaluecolor" msgid "Value" msgstr "Değer" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" msgstr "Derleme sırasında ayrıntı:" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" msgstr "Oluk görünsün" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" msgstr "Sağ kenar boşluğu görünsün" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole words only" msgstr "&Sadece bütün kelimeler" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" msgstr "Genişlik:" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" msgstr "Win32 gui uygulaması" #: lazarusidestrconsts.dlgwindow msgctxt "lazarusidestrconsts.dlgwindow" msgid "Window" msgstr "Pencere" #: lazarusidestrconsts.dlgwordexceptions msgid "Exceptions" msgstr "İstisnalar" #: lazarusidestrconsts.dlgwordspolicies msgctxt "lazarusidestrconsts.dlgwordspolicies" msgid "Words" msgstr "Kelimeler" #: lazarusidestrconsts.dlgwrdpreview msgctxt "lazarusidestrconsts.dlgwrdpreview" msgid "Preview" msgstr "Önizleme" #: lazarusidestrconsts.dlgwritefpclogo msgid "Write FPC logo" msgstr "FPC logosu yaz" #: lazarusidestrconsts.drsignoringprojectdebuggersettings msgid " (Ignoring project settings below)" msgstr " (Aşağıdaki proje ayarları dikkate alınmaz)" #: lazarusidestrconsts.drsstoreconverterconfiginses msgid "Store converter config in session" msgstr "Dönüştürücü yapılandırmasını oturumda sakla" #: lazarusidestrconsts.drsstoredispformatconfiginses msgid "Store display formats config in session" msgstr "Görüntüleme biçimleri yapılandırmasını oturumda sakla" #: lazarusidestrconsts.drsstoreformatterconfiginses msgid "Store formatter config in session" msgstr "Biçimlendirici yapılandırmasını oturumda sakla" #: lazarusidestrconsts.drsstoreprojectdebuggerconfi msgid "Store project debugger configs in session" msgstr "Proje hata ayıklayıcı yapılandırmalarını oturumda sakla" #: lazarusidestrconsts.drsthedebuggerbackendselecti msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI." msgstr "Açılır menüden \"Hata Ayıklayıcı Arka Ucu\" seçimi (IDE hata ayıklayıcı arka uçlarının listesi) her zaman oturumda saklanır. Projeye özel arka uçlar (aşağıda) varsayılan olarak LPI'da saklanır." #: lazarusidestrconsts.drsthisonlyaffectsdispformats msgid "This only affects the display formats below. The settings which formats to use are always stored in the session." msgstr "Bu sadece aşağıdaki görüntüleme formatlarını etkiler. Hangi formatların kullanılacağı ayarları her zaman oturumda saklanır." #: lazarusidestrconsts.drsthisonlyaffectsthelistofc msgid "This only affects the list of converters below. The settings which list to use are always stored in the session." msgstr "Bu, yalnızca aşağıdaki dönüştürücüler listesini etkiler. Hangi listeyi kullanacağınıza dair ayarlar her zaman oturumda saklanır." #: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session." msgstr "Bu sadece aşağıdaki biçimlendirici listesini etkiler. Hangi listenin kullanılacağı ayarları her zaman oturumda saklanır." #: lazarusidestrconsts.drsuseideglobaldispformats msgid "Use the IDEs-global display formats" msgstr "IDEs-global görüntüleme biçimlerini kullanma" #: lazarusidestrconsts.drsuseprojecfdispformats msgid "Use the projects display formats" msgstr "Proje görüntüleme formatlarını kullanın" #: lazarusidestrconsts.drsusetheidegloballistofconv msgid "Use the IDE-Global list of converters" msgstr "IDE-Global dönüştürücüler listesini kullanın" #: lazarusidestrconsts.drsusetheidegloballistofformatter msgid "Use the IDE-Global list of formatters" msgstr "IDE-Global biçimlendirici listesini kullanma" #: lazarusidestrconsts.drsusetheprojectlistofconver msgid "Use the project list of converters" msgstr "Dönüştürücülerin proje listesini kullanın" #: lazarusidestrconsts.drsusetheprojectlistofformatter msgid "Use the project list of formatters" msgstr "Biçimlendiricilerin proje listesini kullanın" #: lazarusidestrconsts.drsusingidedefaultdebuggerse msgid "Using IDE default debugger settings" msgstr "IDE varsayılan hata ayıklayıcı ayarlarını kullan" #: lazarusidestrconsts.drsusingselectedidedebuggers msgid "Using selected IDE debugger settings" msgstr "Seçilen IDE hata ayıklayıcı ayarlarını kullan" #: lazarusidestrconsts.fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "Çok seçimli bileşenler tek bir formda olmalıdır." #: lazarusidestrconsts.fdmalignmenu msgid "Align ..." msgstr "Hizala ..." #: lazarusidestrconsts.fdmdeleteselection msgid "Delete Selection" msgstr "Seçimi Sil" #: lazarusidestrconsts.fdmmirrorhorizontal msgid "Mirror Horizontal" msgstr "Ayna Yatay" #: lazarusidestrconsts.fdmmirrorvertical msgid "Mirror Vertical" msgstr "Ayna Dikey" #: lazarusidestrconsts.fdmorderbackone msgid "Back One" msgstr "Bir Geri" #: lazarusidestrconsts.fdmorderforwardone msgid "Forward One" msgstr "Bir İleri" #: lazarusidestrconsts.fdmordermovetoback msgid "Move to Back" msgstr "Geri Taşı" #: lazarusidestrconsts.fdmordermovetofront msgid "Move to Front" msgstr "Öne Taşı" #: lazarusidestrconsts.fdmresetmenu msgid "Reset ..." msgstr "Sıfırla ..." #: lazarusidestrconsts.fdmsaveformasxml msgid "Save Form as XML" msgstr "Formu XML Olarak Kaydedin" #: lazarusidestrconsts.fdmscalemenu msgid "Scale ..." msgstr "Ölçek ..." #: lazarusidestrconsts.fdmscaleword msgid "Scale" msgstr "Ölçek" #: lazarusidestrconsts.fdmselectall msgctxt "lazarusidestrconsts.fdmselectall" msgid "Select All" msgstr "Hepsini seç" #: lazarusidestrconsts.fdmsizemenu msgid "Size ..." msgstr "Boyut ..." #: lazarusidestrconsts.fdmsizeword msgid "Size" msgstr "Boyut" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "Opsiyon: Izgaraya yapış" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "Opsiyon: Kılavuz çizgilerine sabitler" #: lazarusidestrconsts.fdmzorder msgid "Z-order" msgstr "Z-sırası" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" msgstr "İki tarafta da" #: lazarusidestrconsts.initdlgdebugchangepath msgid "Change path" msgstr "Yolu değiştir" #: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured msgid "Error: The backend is not configured." msgstr "Hata: Arka uç yapılandırılmamış." #: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage msgid "(The configured backend's package is not installed.)" msgstr "(Yapılandırılan arka uç paketi kurulu değil.)" #: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported msgid "Error: Your current config uses a backend that is not supported on your OS/Arch." msgstr "Hata: Geçerli yapılandırmanız, İşletim Sisteminizde/Arch'ınızda desteklenmeyen bir arka uç kullanıyor." #: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended msgid "Hint: The backend type is OK, but not the recommended type." msgstr "İpucu: Arka uç türü uygundur, ancak önerilen tür değildir." #: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback msgid "Create a new recommended backend" msgstr "Önerilen yeni bir arka uç oluştur" #: lazarusidestrconsts.initdlgdebugcurrent msgctxt "lazarusidestrconsts.initdlgdebugcurrent" msgid "Current" msgstr "Geçerli" #: lazarusidestrconsts.initdlgdebugexternalexepathdisplay msgid "The selected backend uses the external executable:" msgstr "Seçilen arka uç harici yürütülebilir dosyayı kullanır:" #: lazarusidestrconsts.initdlgdebugexternalexepathprompt #, object-pascal-format msgid "The selected backend requires an external executable: \"%s\"" msgstr "Seçilen arka uç harici bir yürütülebilir dosya gerektiriyor: \"%s\"" #: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss #, object-pascal-format msgid "Default for your OS/Arch is: \"%s\"." msgstr "İşletim Sisteminiz/Arch'ınız için varsayılan: \"%s\"." #: lazarusidestrconsts.initdlgdebugignore msgctxt "lazarusidestrconsts.initdlgdebugignore" msgid "Ignore" msgstr "Yoksay" #: lazarusidestrconsts.initdlgdebugkeepbackend msgid "Keep backend" msgstr "Arka ucu sakla" #: lazarusidestrconsts.initdlgdebugnew msgctxt "lazarusidestrconsts.initdlgdebugnew" msgid "New" msgstr "Yeni" #: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory msgid "Error: External executable is a directory, not a file." msgstr "Hata: Harici yürütülebilir dosya bir dosya değil, bir dizindir." #: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound msgid "Error: External executable not found." msgstr "Hata: Harici yürütülebilir dosya bulunamadı." #: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable msgid "Error: External file is not executable." msgstr "Hata: Harici dosya yürütülebilir değil." #: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound msgid "Error: No default for external executable found." msgstr "Hata: Harici yürütülebilir dosya için varsayılan bulunamadı." #: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified msgid "Error: No external executable specified." msgstr "Hata: Harici yürütülebilir dosya belirtilmedi." #: lazarusidestrconsts.initdlgdebugpopupinformation #, object-pascal-format msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"." msgstr "Bir arka uç, hata ayıklayıcı için işletim sistemine ve mimariye özel uygulamalar sağlar. İşletim Sisteminiz/Arch'ınız için %0:sVarsayılan: \"%1:s\".%0:s%0:sDiğer arka uçlar, özel görevler için sağlanır (örn. platformlar) veya genel alternatifler olarak.%0:sHata ayıklayıcı, arka uca bağlı olarak farklı özelliklere sahip olabilir.%0:s%0:sBazı arka uçlar harici bir exe gerektirir (gdb veya lldb gibi). Bu exe, işletim sisteminizin (Linux/Mac) bir parçası olabilir veya Lazarus yükleyicisi (Windows) tarafından sağlanabilir.%0:s%0:sKurulumunuzu yeni yükselttiyseniz, önceki sürümden önce IDE'yi yeniden oluşturmanız gerekebilir. yapılandırılmış arka uç kullanılabilir (3. taraf veya isteğe bağlı bir arka uç kullandıysanız). Bu durumda \"Yoksay\"ı seçebilirsiniz." #: lazarusidestrconsts.initdlgdebugselectanexistingbackend msgid "Select an existing backend" msgstr "Mevcut bir arka uç seçin" #: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options." msgstr "Not: Daha fazla arka uç yapılandırması vardır, ancak bunların paketleri (LPK) yüklenmemiştir. IDE'yi kurulu paketlerle yeniden oluşturmak isteyebilirsiniz. Yeniden oluşturma işleminden sonra, hata ayıklayıcı arka ucu şu menüden değiştirilebilir: Araçlar -> Seçenekler." #: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild #, object-pascal-format msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options." msgstr "Önce IDE'yi yeniden oluşturmaya ve eksik paketleri kurmaya karar verirseniz, şimdilik \"Yoksay\"ı seçin.%0:sYeniden oluşturmadan sonra, hata ayıklayıcı arka ucu şu menüden değiştirilebilir: Araçlar -> Seçenekler." #: lazarusidestrconsts.initdlgdebugstatemissingpackages msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup." msgstr "IDE kurulumunuzda eksik paketler (LPK) olabilir. Kurulumda değişiklik yapmadan önce IDE'yi yeniden oluşturmanız ve bunları yüklemeniz gerekebilir." #: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend." msgstr "Mevcut hata ayıklayıcılar listesinde önerilen türde bir arka uç vardır. Yeni bir arka uç oluşturmak yerine bunu seçebilirsiniz." #: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend." msgstr "Mevcut hata ayıklayıcılar listesinde önerilen türde bir arka uç yok. Yeni bir arka uç oluşturmayı düşünün." #: lazarusidestrconsts.initdlgdebugstatesetupok msgid "Setup is OK." msgstr "Kurulum TAMAM." #: lazarusidestrconsts.initdlgdebugstateupdatebackend msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend." msgstr "Eski bir arka uç kullanıyorsunuz. Bu size en iyi hata ayıklama deneyimini sunmayabilir. Önerilen arka uca yükseltmeyi düşünün." #: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." msgstr "0 = hayır, 1 = sadece en üst seviye için ayırıcı çizgi çiz, 2 = ilk iki seviye için çizgi çiz, ..." #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" msgstr "Dosya Ekle" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "Belirsiz ata Türü" #: lazarusidestrconsts.lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Belirsiz Sınıf Adı" #: lazarusidestrconsts.lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Belirsiz Birim Adı" #: lazarusidestrconsts.lisa2pancestortype msgid "Ancestor type" msgstr "Ata türü" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Kırık Bağımlılıklar" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "Sınıf Adı Zaten Var" #: lazarusidestrconsts.lisa2pcreatenewcomp msgid "Create New Component" msgstr "Yeni Bileşen Oluştur" #: lazarusidestrconsts.lisa2pdependency msgid "Dependency" msgstr "Bağımlılık" #: lazarusidestrconsts.lisa2pdirectoryforunitfile msgid "Directory for unit file:" msgstr "Birim dosyası için Dizin:" #: lazarusidestrconsts.lisa2pexistingfile2 #, object-pascal-format msgid "Existing file: \"%s\"" msgstr "Varolan dosya: \"%s\"" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "Dosya zaten mevcut" #: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage #, object-pascal-format msgid "File \"%s\" already exists in the package." msgstr "Pakette \"%s\" dosyası zaten var." #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" msgstr "Dosya kullanılıyor" #: lazarusidestrconsts.lisa2pfilename2 msgid "Filename/URL" msgstr "Dosya adı/URL" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" msgstr "Dosya birim değil" #: lazarusidestrconsts.lisa2picon24x24 msgid "Icon 24x24:" msgstr "Simge 24x24:" #: lazarusidestrconsts.lisa2picon36x36 msgid "Icon 36x36:" msgstr "Simge 36x36:" #: lazarusidestrconsts.lisa2picon48x48 msgid "Icon 48x48:" msgstr "Simge 48x48:" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "Geçersiz Ata Türü" #: lazarusidestrconsts.lisa2pinvalidcirculardependency msgid "Invalid Circular Dependency" msgstr "Geçersiz Dairesel Bağımlılık" #: lazarusidestrconsts.lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "Geçersiz Sınıf Adı" #: lazarusidestrconsts.lisa2pinvalidfile msgid "Invalid file" msgstr "Geçersiz dosya" #: lazarusidestrconsts.lisa2pinvalidfilename msgid "Invalid filename" msgstr "Geçersiz dosya adı" #: lazarusidestrconsts.lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "Geçersiz Ünite Adı" #: lazarusidestrconsts.lisa2pisnotavalidunitname #, object-pascal-format msgid "\"%s\" is not a valid unit name." msgstr "\"%s\" geçerli bir birim adı değil." #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" msgstr "Yeni sınıf adı:" #: lazarusidestrconsts.lisa2pnewfile msgid "New File" msgstr "Yeni dosya" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting #, object-pascal-format msgid "No package found for dependency \"%s\".%sPlease choose an existing package." msgstr "Bağımlılık \"%s\" için paket bulunamadı. %s Lütfen mevcut bir paketi seçin." #: lazarusidestrconsts.lisa2ppackageorproject msgid "Package/Project" msgstr "Paket/Proje" #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" msgstr "Sayfa Adı çok uzun" #: lazarusidestrconsts.lisa2ppalettepage msgid "Palette page:" msgstr "Palet Sayfası:" #: lazarusidestrconsts.lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Dosya adını kısaltın veya genişletin" #: lazarusidestrconsts.lisa2pshowall msgctxt "lazarusidestrconsts.lisa2pshowall" msgid "Show all" msgstr "Tümünü göster" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit #, object-pascal-format msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." msgstr "\"%s\" ata türü, \"%s\" birimiyle %s aynı ada sahiptir." #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier #, object-pascal-format msgid "The ancestor type \"%s\" is not a valid Pascal identifier." msgstr "\"%s\" ata türü geçerli bir Pascal tanımlayıcısı değil." #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame #, object-pascal-format msgid "The class name \"%s\" and ancestor type \"%s\" are the same." msgstr "Sınıf adı \"%s\" ve ata türü \"%s\" aynıdır." #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile #, object-pascal-format msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" msgstr "\"%s\" sınıf adı %s Paketinde zaten mevcut %s%sDosya: \"%s\"" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit #, object-pascal-format msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." msgstr "Sınıf adı \"%s\", birim \"%s\" ile aynı ada sahiptir.%s" #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier #, object-pascal-format msgid "The class name \"%s\" is not a valid Pascal identifier." msgstr "\"%s\" sınıf adı geçerli bir Pascal tanımlayıcısı değil." #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea #, object-pascal-format msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "\"%s\" dosyası geçerli projenin bir parçasıdır.%sProjeler ve paketler arasında dosya paylaşmak kötü bir fikirdir." #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename #, object-pascal-format msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "Paketin henüz varsayılan bir dizini olmadığı için \"%s\" dosya adı belirsizdir.%sLütfen tam yolu olan bir dosya adı belirtin." #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür." #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe #, object-pascal-format msgid "The package already has a dependency on the package \"%s\"." msgstr "Paket zaten \"%s\" paketine bağımlı." #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars #, object-pascal-format msgid "The page name \"%s\" is too long (max 100 chars)." msgstr "Sayfa adı \"%s\" çok uzun (en fazla 100 karakter)." #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage #, object-pascal-format msgid "The unitname \"%s\" already exists in the package:%s%s" msgstr "\"%s\" birim adı zaten pakette mevcut: %s %s" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage #, object-pascal-format msgid "The unitname \"%s\" already exists in this package." msgstr "\"%s\" birim adı bu pakette zaten mevcut." #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer #, object-pascal-format msgid "The unit name \"%s\"%sand filename \"%s\" differ." msgstr "Birim adı \"%s\"%s ve dosya adı \"%s\"farklı." #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent #, object-pascal-format msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." msgstr "Birim adı \"%s\" kayıtlı bir bileşenle aynıdır.%sBunun kullanılması garip hata mesajlarına neden olabilir." #: lazarusidestrconsts.lisa2punitname msgid "Unit name:" msgstr "Birim Adı:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Birim adı zaten var" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" msgstr "Değişikliklerden vazgeçilsin mi?" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" msgstr "Tüm yüklemeyi iptal et" #: lazarusidestrconsts.lisaborted msgid "Aborted" msgstr "Yoksay" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" msgstr "Projeyi yüklemeyi iptal et" #: lazarusidestrconsts.lisabout msgctxt "lazarusidestrconsts.lisabout" msgid "About" msgstr "Hakkında" #: lazarusidestrconsts.lisabout2 #, object-pascal-format msgid "About %s" msgstr "%s Hakkında" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" msgstr "Belgeler:" #: lazarusidestrconsts.lisaboutide msgid "About IDE" msgstr "IDE Hakkında" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" msgstr "Lazarus Hakkında" #: lazarusidestrconsts.lisaboutlazarusmsg #, object-pascal-format msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers." msgstr "Lisans: GPL / LGPL. Lisans ayrıntıları için Lazarus ve Free Pascal kaynaklarına bakınız.%sLazarus, Free Pascal ile grafiksel ve konsollu uygulamalar oluşturmak için bir IDE'dir. Free Pascal Windows, Linux, Mac OS X, FreeBSD ve daha fazlası üzerinde çalışan Pascal ve Object Pascal derleyicisidir.%sLazarus, bir Delphi gibi yukarıdaki platformların tümü için programlar geliştirmenize izin verecek yapbozun eksik kısmıdır. ortamı. IDE, bir form tasarımcısı içeren bir RAD aracıdır.%sLazarus büyüdükçe daha fazla geliştiriciye ihtiyacımız var." #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." msgstr "Katkıda bulunanların listesi bulunamadı." #: lazarusidestrconsts.lisaboutofficial msgid "Official:" msgstr "Resmi:" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen #, object-pascal-format msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it." msgstr "%s TControl'leri tutamıyor %sSadece görsel olmayan bileşenleri koyabilirsiniz." #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" msgstr "Teşekkür" #: lazarusidestrconsts.lisaction msgid "Action:" msgstr "Aksiyon:" #: lazarusidestrconsts.lisactivate msgid "Activate" msgstr "Etkinleştir" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Metin ve değiştirme için normal ifade sözdizimini etkinleştir (perl'e benzemektedir)" #: lazarusidestrconsts.lisactivateselected msgid "Activate Selected" msgstr "Seçiliyi Aktif et" #: lazarusidestrconsts.lisactive msgid "Active" msgstr "Aktif" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" msgstr "Aktif Filtre" #: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem msgid "Add a new separator above selected item" msgstr "Seçili öğenin üstüne yeni bir ayırıcı ekle" #: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem msgid "Add a new separator below selected item" msgstr "Seçili öğenin altına yeni bir ayırıcı ekle" #: lazarusidestrconsts.lisadddelphidefine msgid "Add defines simulating Delphi7" msgstr "Delphi7'yi simüle eden tanımları ekleyin" #: lazarusidestrconsts.lisadddelphidefinehint msgid "Useful when the code has checks for supported compiler versions" msgstr "Kod, desteklenen derleyici sürümleri için kontrollere sahip olduğunda kullanışlıdır" #: lazarusidestrconsts.lisaddedmissingobjectstopascalsource #, object-pascal-format msgid "Added missing object \"%s\" to pascal source." msgstr "Pascal kaynağına eksik nesne \"%s\" eklendi." #: lazarusidestrconsts.lisaddedpropertysfors #, object-pascal-format msgid "Added property \"%s\" for %s." msgstr "%s için \"%s\" özelliği eklendi." #: lazarusidestrconsts.lisaddfcutf8 msgid "Add -FcUTF8" msgstr "-FcUTF8 Ekle" #: lazarusidestrconsts.lisaddfcutf8hint msgid "May be needed if source files have non-ansistring literals." msgstr "Kaynak dosyalarda ansistring olmayan harfler varsa, gerekli olabilir." #: lazarusidestrconsts.lisaddfilter msgid "Add Filter ..." msgstr "Filtre Ekle ..." #: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage msgid "Addition does not fit the current message" msgstr "Ekleme mevcut mesaja uymuyor" #: lazarusidestrconsts.lisadditionfitsthecurrentmessage msgid "Addition fits the current message" msgstr "Ekleme mevcut mesaja uyuyor" #: lazarusidestrconsts.lisadditions msgid "Additions" msgstr "Ekler" #: lazarusidestrconsts.lisaddkeyworddo msgid "Add keyword \"do\"" msgstr "Anahtar kelime ekle \"do\"" #: lazarusidestrconsts.lisaddmodifieroverload msgid "Add modifier \"overload\"" msgstr "\"overload\" değiştiricisini ekle" #: lazarusidestrconsts.lisaddmodifieroverride msgid "Add modifier \"override\"" msgstr "\"override\" değiştiricisini ekle" #: lazarusidestrconsts.lisaddmodifierreintroduce msgid "Add modifier \"reintroduce\"" msgstr "\"reintroduce\" değiştiricisini ekle" #: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom #, object-pascal-format msgid "Add new build mode, copying settings from \"%s\"" msgstr "Ayarları \"%s\" den kopyalayarak yeni oluşturma modu ekleyin" #: lazarusidestrconsts.lisaddnewdiskfiles msgid "Add new disk files?" msgstr "Yeni disk dosyaları eklensin mi?" #: lazarusidestrconsts.lisaddnewfilesfromfilesystem msgid "Add New Files from File System" msgstr "Dosya Sisteminden Yeni Dosyalar Ekle" #: lazarusidestrconsts.lisaddnewmacro msgid "Add new macro" msgstr "Yeni makro ekle" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" msgstr "Yeni küme ekle" #: lazarusidestrconsts.lisaddpackagerequirement msgid "Add package requirement?" msgstr "Paket gereksinimi eklensin mi?" #: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)." msgstr "Paket(ler)i kurulu paketler listesine ekleyin (IDE'yi yeniden oluşturmak için --build-ide ile birleştirin)." #: lazarusidestrconsts.lisaddpackagetoproject2 msgid "Add package to project" msgstr "Paketi projeye ekle" #: lazarusidestrconsts.lisaddparameterbrackets msgid "Add parameter brackets" msgstr "Parametre parantezleri ekle" #: lazarusidestrconsts.lisaddthefollowingfiles msgid "Add the following files:" msgstr "Aşağıdaki dosyaları ekleyin:" #: lazarusidestrconsts.lisaddtoincludesearchpath msgid "Add to include search path?" msgstr "Arama yolunu dahil etmek için ekle?" #: lazarusidestrconsts.lisaddtoproject #, object-pascal-format msgid "Add %s to project?" msgstr "%s projeye ekle?" #: lazarusidestrconsts.lisaddtostartupcomponents msgid "Add to startup components?" msgstr "Başlangıç bileşenlerine eklensin mi?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "Birim arama yoluna eklensin mi?" #: lazarusidestrconsts.lisaddunitinterfaces msgid "Add unit interfaces" msgstr "Birim arabirimleri ekle" #: lazarusidestrconsts.lisaddunitnotrecommended msgid "Add unit (not recommended)" msgstr "Birim ekle (önerilmez)" #: lazarusidestrconsts.lisaddvaluetomacro #, object-pascal-format msgid "Add value to macro %s" msgstr "Makro %s için değer ekle" #: lazarusidestrconsts.lisaf2paddfiletoapackage msgid "Add File to Package" msgstr "Dosyayı Pakete Ekle" #: lazarusidestrconsts.lisaf2pdestinationpackage msgid "Destination package" msgstr "Hedef paket" #: lazarusidestrconsts.lisaf2pfiletype msgid "File type" msgstr "Dosya tipi" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" msgstr "Geçersiz Paket" #: lazarusidestrconsts.lisaf2pinvalidpackageid #, object-pascal-format msgid "Invalid package ID: \"%s\"" msgstr "Geçersiz paket kimliği: \"%s\"" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "Paket salt okunur" #: lazarusidestrconsts.lisaf2ppackagenotfound #, object-pascal-format msgid "Package \"%s\" not found." msgstr "Paket \"%s\" bulunamadı." #: lazarusidestrconsts.lisaf2pshowall msgctxt "lazarusidestrconsts.lisaf2pshowall" msgid "Show all" msgstr "Tümünü göster" #: lazarusidestrconsts.lisaf2pthepackageisreadonly #, object-pascal-format msgid "The package %s is read only." msgstr "%s paketi salt okunur." #: lazarusidestrconsts.lisafilterwiththenamealreadyexists #, object-pascal-format msgid "A filter with the name \"%s\" already exists." msgstr "\"%s\" adı olan bir filtre zaten var." #: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean msgid "After cleaning up (clean all or clean common files), switch to clean automatically" msgstr "Temizledikten sonra (tümünü temizle veya genel dosyaları temizle), otomatik olarak temizlemeye geç" #: lazarusidestrconsts.lisalignment msgid "Alignment" msgstr "Hizalama" #: lazarusidestrconsts.lisallblockslooksok msgid "All blocks look ok." msgstr "Bütün bloklar iyi görünüyor." #: lazarusidestrconsts.lisallbuildmodes msgid "" msgstr "" #: lazarusidestrconsts.lisallinheritedoptions msgid "All inherited options" msgstr "Devralınan tüm seçenekler" #: lazarusidestrconsts.lisalloptions #, object-pascal-format, fuzzy, badformat #| msgid "All Options" msgid "All options of FPC%s (\"%s\")" msgstr "Tüm Seçenekler" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Birden fazla satırı aramaya izin ver" #: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall msgid "All parameters of this function are already set at this call. Nothing to add." msgstr "Bu function un tüm parametreleri zaten bu çağrıda ayarlanmış. Eklenecek bir şey yok." #: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package." msgstr "Unit/include yolundaki tüm .pas, .pp, .p, .inc zaten bir proje/paketin içindedir." #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened #, object-pascal-format msgid "All your modifications to \"%s\"%swill be lost and the file reopened." msgstr "\"%s\"%s yaptığınız tüm değişiklikler kaybolacak ve dosya yeniden açılacaktır." #: lazarusidestrconsts.lisalpha msgid "Alpha" msgstr "Alfa" #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" msgstr "Alternatif tuş" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "Alternatif tuş (veya 2 tuş sıralı)" #: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase msgid "Always convert suggested default file name to lowercase" msgstr "Önerilen varsayılan dosya adını her zaman küçük harfe dönüştürün" #: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused msgid "Always draw selected items focused" msgstr "Daima seçili öğeleri odaklı çiz" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" msgstr "Her zaman yoksay" #: lazarusidestrconsts.lisamacrowiththisnamealreadyexists msgid "A macro with this name already exists." msgstr "Bu ada sahip bir makro zaten var." #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" msgstr "Belirsiz dosya bulundu" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete #, object-pascal-format msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" msgstr "Belirsiz dosya bulundu: \"%s\"%sBu dosya \"%s\" ile karıştırılabilir %sBelirsiz dosya silinsin mi?" #: lazarusidestrconsts.lisanchorbottomtobottomside msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "Kardeşin alt tarafından alt tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing'i kullanın. Kardeşin BorderSpacing'i yok sayılır." #: lazarusidestrconsts.lisanchorbottomtotopside msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "Kardeşin alt tarafından üst tarafına tutturun. Korunan mesafe, hem bu hem de kardeşin BorderSpacing özellikleri tarafından tanımlanır." #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "Tutturucu Düzenleyici - kontrol seçilmedi" #: lazarusidestrconsts.lisanchorenabledhint #, object-pascal-format msgid "Enabled = Include %s in Anchors" msgstr "Etkin = %s'yi Tutturuculara Dahil Et" #: lazarusidestrconsts.lisanchorlefttoleftside msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "Sol taraftaki kardeşin sol tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." #: lazarusidestrconsts.lisanchorlefttorightside msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "Sol taraftaki kardeşin sağ tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." #: lazarusidestrconsts.lisanchorrighttoleftside msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "Kardeşin sağ tarafından sol tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." #: lazarusidestrconsts.lisanchorrighttorightside msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "Kardeşin sağ tarafından sağ tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." #: lazarusidestrconsts.lisanchorsof #, object-pascal-format msgid "Anchors of %s" msgstr "%s tutturucu" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "Seçilen kontrollerin tutturucuları" #: lazarusidestrconsts.lisanchortoptobottomside msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." msgstr "Kardeşin üst tarafını alt tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." #: lazarusidestrconsts.lisanchortoptotopside msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." msgstr "Üst tarafı kardeşin üst tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." #: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro #, object-pascal-format msgid "An error occurred at last startup while loading %s!%sLoad this project again?" msgstr "%s yüklenirken son başlatılışta bir hata oluştu!%sBu projeyi tekrar yükle?" #: lazarusidestrconsts.lisappearance msgid "Appearance" msgstr "Görünüm" #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" msgstr "&Uygulama sınıfı adı" #: lazarusidestrconsts.lisapplicationprogramdescriptor msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI." msgstr "Çapraz platform LCL kitaplığını GUI'si için kullanan grafiksel bir Free Pascal uygulaması." #: lazarusidestrconsts.lisapply msgctxt "lazarusidestrconsts.lisapply" msgid "Apply" msgstr "Uygula" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "Apply build flags (-B) to dependencies too." msgstr "Derleme bayraklarını (-B) bağımlılıklara da uygulayın." #: lazarusidestrconsts.lisapplyconventions msgid "Apply conventions" msgstr "Sözleşmeleri uygulayın" #: lazarusidestrconsts.lisapplyconventionshint msgid "Adjust name extension and character case for platform and file type." msgstr "Platform ve dosya türü için ad uzantısını ve karakter kılıfını ayarlayın." #: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects msgid "A project unit can not be used by other packages/projects" msgstr "Bir proje birimi diğer paketler / projeler tarafından kullanılamaz" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "Denetimin etrafındaki kenarlıklar. Diğer dört kenar boşlukları bu değere eklenir." #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Bulunan her metni değiştirmeden önce sor" #: lazarusidestrconsts.lisaskbeforesavingprojectssession msgid "Ask before saving project's session" msgstr "Projenin oturumunu kaydetmeden önce sor" #: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform msgid "Ask for component name after putting it on a designer form." msgstr "Tasarımcı formuna koyduktan sonra bileşen adını sor." #: lazarusidestrconsts.lisaskforfilenameonnewfile msgid "Ask for file name on new file" msgstr "Yeni dosyada dosya adı sor" #: lazarusidestrconsts.lisasknameoncreate msgid "Ask name on create" msgstr "Forma yeni bileşen oluşturmada ad sor" #: lazarusidestrconsts.lisautoadjustideheight msgid "Automatically adjust IDE main window height" msgstr "IDE ana pencere yüksekliğini otomatik olarak ayarla" #: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette msgid "Show complete component palette" msgstr "Komple bileşen paletini göster" #: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint msgid "If component palette spans over more lines, show them all and not only one." msgstr "Bileşen paleti daha fazla çizgiye yayılmışsa, hepsini göster, sadece bir tane değil." #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" msgstr "Otomatik tamamlama: kapalı" #: lazarusidestrconsts.lisautocompletionon msgid "Auto completion: on" msgstr "Otomatik tamamlama: açık" #: lazarusidestrconsts.lisautomarkup msgid "Markup and Matches" msgstr "İşaretleme ve Eşleşmeler" #: lazarusidestrconsts.lisautomatic msgctxt "lazarusidestrconsts.lisautomatic" msgid "Automatic" msgstr "Otomatik" #: lazarusidestrconsts.lisautomatically msgid "Automatically" msgstr "Otomatik olarak" #: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs msgid "Automatically convert .lfm files to .lrs resource files" msgstr ".lfm dosyalarını .lrs kaynak dosyalarına otomatik olarak dönüştür" #: lazarusidestrconsts.lisautomaticallyignoreforselection msgid "do not complete selection" msgstr "seçimi tamamlama" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" msgstr "Noktadan sonra otomatik olarak çağır" #: lazarusidestrconsts.lisautomaticallyinvokeontype msgid "Automatically invoke on typing" msgstr "Yazarken otomatik olarak çağır" #: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength msgid "Only complete if word is longer or equal" msgstr "Yalnızca kelime daha uzun veya eşitse tamamlayın" #: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend msgid "Only complete when at end of word" msgstr "Yalnızca kelimenin sonunda tamamlayın" #: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer msgid "Use completion box delay" msgstr "Tamamlama kutusu gecikmesini kullan" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" msgstr "satır sonu" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" msgstr "boşluk" #: lazarusidestrconsts.lisautomaticallyontab msgid "tab" msgstr "sekme" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" msgstr "kelime sonu" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" msgstr "karakter ekleme" #: lazarusidestrconsts.lisautomaticallyusesinglepossibleident msgid "Automatically use single possible identifier" msgstr "Tek olası tanımlayıcıyı otomatik olarak kullan" #: lazarusidestrconsts.lisautomaticfeatures msgid "Completion and Hints" msgstr "Tamamlama ve İpuçları" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" msgstr "Otomatik göster" #: lazarusidestrconsts.lisavailableforinstallation msgid "Available for installation" msgstr "Kurulum için kullanılabilir" #: lazarusidestrconsts.lisavailableprojectbuildmodes msgid "Available project build modes" msgstr "Mevcut proje oluşturma modları" #: lazarusidestrconsts.lisbackupchangedfiles msgid "Make backup of changed files" msgstr "Değiştirilen dosyaların yedeğini alın" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" msgstr "Yedek dosyası başarısız oldu" #: lazarusidestrconsts.lisbackuphint msgid "Creates a Backup directory under project directory" msgstr "Proje dizini altında bir yedek dizini oluşturur" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies #, object-pascal-format msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Paket adını veya sürümünü değiştirmek bağımlılıkları bozar. Bu bağımlılıklar da değişmeli mi?%sListelenen tüm bağımlılıkları değiştirmek için Evet'i seçin.%sBağımlılıkları kırmak ve devam etmek için Yoksay'ı seçin." #: lazarusidestrconsts.lisbegins msgid "begins" msgstr "başla(begins)" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" msgstr "Arkasında ilgili" #: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes msgid "Be less verbose. Can be given multiple times." msgstr "Daha az ayrıntılı olun. Birden fazla kez verilebilir." #: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes msgid "Be more verbose. Can be given multiple times." msgstr "Daha ayrıntılı olun. Birden fazla kez verilebilir." #: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" msgstr "En iyi turbopoweriprodsgn gibi bir HTML denetimi yükleyerek görüntülenir" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always build before run" msgstr "Her zaman çalıştırmadan önce inşa et" #: lazarusidestrconsts.lisbfbuildcommand msgid "Build Command" msgstr "Yapı Komutu" #: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "Derleme projesinde bunun yerine Dosyayı Derle komutunu yürütün" #: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "Çalıştırma projesinde bunun yerine Dosyayı Çalıştır komutunu çalıştırın" #: lazarusidestrconsts.lisbfruncommand msgid "Run Command" msgstr "Çalıştır Komutu" #: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor" msgstr "Bu dosya kaynak düzenleyicide aktif olduğunda" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (leave empty for file path)" msgstr "Çalışma dizini (dosya yolu için boş bırakın)" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" msgstr "Varsayılan olmayan kalın değerler" #: lazarusidestrconsts.lisborderspace msgid "Border space" msgstr "Kenar boşluğu" #: lazarusidestrconsts.lisbottom msgctxt "lazarusidestrconsts.lisbottom" msgid "Bottom" msgstr "Alt" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "Alt kenarlık alanı. Bu değer taban sınır alanına eklenir ve kontrolün altındaki boşluk için kullanılır." #: lazarusidestrconsts.lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "Alt tutucu" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" msgstr "Altlar" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "Bu, alt tarafın tutturulduğu kardeş kontroldür. Delphi stilinde ebeveyne sabitlemek için boş bırakın (BorderSpacing ve ReferenceSide önemli değildir)." #: lazarusidestrconsts.lisbottomspaceequally msgid "Bottom space equally" msgstr "Alt boşluk eşit" #: lazarusidestrconsts.lisbrowseandselectacompiler msgid "Browse and select a compiler (e.g. ppcx64" msgstr "Bir derleyiciye göz atın ve seçin (örneğin, ppcx64)" #: lazarusidestrconsts.lisbtnapply msgid "&Apply" msgstr "&Uygula" #: lazarusidestrconsts.lisbtnclose msgctxt "lazarusidestrconsts.lisbtnclose" msgid "&Close" msgstr "&Kapat" #: lazarusidestrconsts.lisbtndlgreplace msgctxt "lazarusidestrconsts.lisbtndlgreplace" msgid "&Replace ..." msgstr "&Değiştir ..." #: lazarusidestrconsts.lisbtnfind msgid "&Find" msgstr "&Ara" #: lazarusidestrconsts.lisbtnquit msgctxt "lazarusidestrconsts.lisbtnquit" msgid "&Quit" msgstr "&Çıkış" #: lazarusidestrconsts.lisbtnremove msgctxt "lazarusidestrconsts.lisbtnremove" msgid "&Remove" msgstr "&Kaldır" #: lazarusidestrconsts.lisbtnrename msgid "&Rename" msgstr "&Yeniden Adlandır" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" msgstr "&Değiştir" #: lazarusidestrconsts.lisbuild msgctxt "lazarusidestrconsts.lisbuild" msgid "Build" msgstr "Derle" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "Build all files of project/package/IDE." msgstr "Proje/paket/IDE'nin tüm dosyalarını oluşturun." #: lazarusidestrconsts.lisbuildcaption msgctxt "lazarusidestrconsts.lisbuildcaption" msgid "Build" msgstr "Derle" #: lazarusidestrconsts.lisbuilddate msgid "Build Date" msgstr "Yapı Tarihi" #: lazarusidestrconsts.lisbuildide msgid "Build IDE" msgstr "IDE oluştur" #: lazarusidestrconsts.lisbuildidewithpackages #, fuzzy #| msgid "Build IDE with packages." msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option." msgstr "Paketlerle IDE oluşturun." #: lazarusidestrconsts.lisbuilding msgid "Building" msgstr "İnşa ediliyor" #: lazarusidestrconsts.lisbuildinglazarusfailed msgid "Building Lazarus failed" msgstr "Lazarus'u derlemek başarısız oldu" #: lazarusidestrconsts.lisbuildmode #, object-pascal-format msgid "Build Mode: %s" msgstr "Yapı Modu: %s" #: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes msgid "Differences between build modes" msgstr "Yapı modları arasındaki farklar" #: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes msgid "Differences from other build modes" msgstr "Diğer oluşturma modlarından farklar" #: lazarusidestrconsts.lisbuildmodediffmode msgid "Mode:" msgstr "Mod:" #: lazarusidestrconsts.lisbuildmodes msgid "Build mode" msgstr "Yapı modu" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" msgstr "Yeni proje oluştur" #: lazarusidestrconsts.lisbuildnumber msgid "Build number" msgstr "Yapı numarası" #: lazarusidestrconsts.lisbuildstage msgctxt "lazarusidestrconsts.lisbuildstage" msgid "Build" msgstr "Derle" #: lazarusidestrconsts.lisbusy msgid "Busy" msgstr "Meşgul" #: lazarusidestrconsts.lisbyte #, object-pascal-format msgid "%s byte" msgstr "%s byte" #: lazarusidestrconsts.liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "Bu bileşeni yüklemeyi iptal et" #: lazarusidestrconsts.liscancelloadingunit msgid "Cancel loading unit" msgstr "Birimi yüklemeyi iptal et" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" msgstr "Yeniden adlandırmayı iptal et" #: lazarusidestrconsts.liscannotcompileproject msgid "Cannot compile project" msgstr "Projeyi derlenemiyor" #: lazarusidestrconsts.liscannotcopytoplevelcomponent msgid "Cannot copy top level component." msgstr "Üst düzey bileşeni kopyalanamıyor." #: lazarusidestrconsts.liscannotcreatefile #, object-pascal-format msgid "Cannot create file \"%s\"" msgstr "Dosya \"%s\" oluşturulamıyor" #: lazarusidestrconsts.liscannotdeletelastmode msgid "Cannot delete last mode." msgstr "Son mod silinemiyor." #: lazarusidestrconsts.liscannotexecute #, object-pascal-format msgid "cannot execute \"%s\"" msgstr "\"%s\" çalıştırılamıyor" #: lazarusidestrconsts.liscannotfind #, object-pascal-format msgid "Cannot find %s" msgstr "%s bulunamadı" #: lazarusidestrconsts.liscannotfindexecutable #, object-pascal-format msgid "cannot find executable \"%s\"" msgstr "\"%s\" çalıştırılabilir dosyası bulamıyor" #: lazarusidestrconsts.liscannotfindlazarusstarter #, object-pascal-format msgid "Cannot find Lazarus starter:%s%s" msgstr "Lazarus başlatıcısı bulunamadı: %s %s" #: lazarusidestrconsts.liscannotopenform #, object-pascal-format msgid "Cannot open form \"%s\"." msgstr "\"%s\" Form açılamadı." #: lazarusidestrconsts.liscannotsaveform #, object-pascal-format msgid "Cannot save form \"%s\"." msgstr "\"%s\" From kaydedilemedi." #: lazarusidestrconsts.liscannotsubstitutemacros #, object-pascal-format msgid "Cannot substitute macro \"%s\"." msgstr "\"%s\" Makro değiştirilemiyor." #: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling msgid "Cannot test the compiler while debugging or compiling." msgstr "Hata ayıklama veya derleme yaparken derleyiciyi test edemiyor." #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "Sadece TComponent sınıfını değiştirebilirsin." #: lazarusidestrconsts.liscantfindavalidppu #, object-pascal-format msgid "Can't find a valid %s.ppu" msgstr "Geçerli bir %s.ppu bulunamadı" #: lazarusidestrconsts.liscaptioncomparefiles msgid "Compare files (not for creating patches)" msgstr "Dosyaları karşılaştır (yamalar oluşturmak için değil)" #: lazarusidestrconsts.liscaptionofactivebuildmode msgid "Caption of active build mode" msgstr "" #: lazarusidestrconsts.liscbpfiles #, object-pascal-format msgid "%s (%s files)" msgstr "%s ( %s dosyaları)" #: lazarusidestrconsts.liscbpreallydeletesourcefiles #, object-pascal-format msgid "Really delete %s source files%s%s" msgstr "%s kaynak dosyaları gerçekten silinsin mi %s %s" #: lazarusidestrconsts.lisccdchangeclassof #, object-pascal-format msgid "Change Class of %s" msgstr "%s sınıfını değiştir" #: lazarusidestrconsts.lisccdnoclass msgid "no class" msgstr "sınıf yok" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "Belirsiz derleyici" #: lazarusidestrconsts.lisccochecktestdir #, object-pascal-format msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" msgstr "Lütfen %s Araçlar -> Seçenekler -> Dosyalar -> Yapı testi için Dizin altındaki Test dizini kontrol edin" #: lazarusidestrconsts.lisccocompilernotanexe #, object-pascal-format msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "Derleyici \"%s\" çalıştırılabilir bir dosya değil.%sDetaylar: %s" #: lazarusidestrconsts.lisccocontains msgid "contains " msgstr "içeriyor " #: lazarusidestrconsts.lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "Çıktıyı panoya kopyala" #: lazarusidestrconsts.lisccodatesdiffer #, object-pascal-format msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "FPC'nin .ppu dosyalarının tarihleri bir saatten fazla farklılık gösteriyor.%sBu, iki farklı kurulumdan oldukları anlamına gelebilir.%sDosya1: %s%sDosya2: %s" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " msgstr "HATA: " #: lazarusidestrconsts.lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "FPC birim yolu bir kaynak içeriyor: " #: lazarusidestrconsts.lisccohasnewline msgid "new line symbols" msgstr "yeni satır sembolleri" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " msgstr "İPUCU: " #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" msgstr "Geçersiz derleyici" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" msgstr "Geçersiz arama yolu" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "Geçersiz Test Dizini" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" msgstr "Eksik birim" #: lazarusidestrconsts.lisccomsgrtlunitnotfound #, object-pascal-format msgid "RTL unit not found: %s" msgstr "%s RTL birimi bulunamadı" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "birden fazla derleyici yapılandırması bulundu: " #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" msgstr "fpc.cfg bulunamadı" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" msgstr "aSCII değl" #: lazarusidestrconsts.lisccoppuexiststwice #, object-pascal-format msgid "ppu exists twice: %s, %s" msgstr "ppu iki kere var: %s, %s" #: lazarusidestrconsts.lisccoppuolderthancompiler #, object-pascal-format msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "Derleyici kendinden daha eski bir .ppu dosyası var: %s %s" #: lazarusidestrconsts.lisccortlunitnotfounddetailed #, object-pascal-format msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken." msgstr "%s RTL birimi bulunamadı.%s Bu tipik olarak %s cihazınızın yanlış birim yollarına sahip olduğu anlamına gelir. Veya kurulumunuz bozuldu." #: lazarusidestrconsts.lisccoseveralcompilers #, object-pascal-format msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "Yolunuzda birkaç tane Free Pascal Derleyicisi var.%s%s%sBelki eski bir derleyiciyi silmeyi unuttunuz?" #: lazarusidestrconsts.lisccoskip msgctxt "lazarusidestrconsts.lisccoskip" msgid "Skip" msgstr "Atla" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" msgstr "özel karakterler" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." msgstr "Bütün testler başarıyla tamamlandı." #: lazarusidestrconsts.lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "Test Dosyası Oluşturulamadı" #: lazarusidestrconsts.lisccounabletocreatetestpascalfile #, object-pascal-format msgid "Unable to create Test Pascal file \"%s\"." msgstr "Test Pascal dosyası \"%s\" oluşturulamadı." #: lazarusidestrconsts.lisccounusualchars msgid "unusual characters" msgstr "olağandışı karakterler" #: lazarusidestrconsts.lisccowarningcaption msgctxt "lazarusidestrconsts.lisccowarningcaption" msgid "Warning" msgstr "Uyarı" #: lazarusidestrconsts.lisccowarningmsg msgid "WARNING: " msgstr "UYARI: " #: lazarusidestrconsts.lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "yanlış yol sınırlayıcı" #: lazarusidestrconsts.liscecategories msgid "Categories" msgstr "Kategoriler" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" msgstr "Karmaşıklık" #: lazarusidestrconsts.lisceconstants msgid "Constants" msgstr "Sabitler" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" msgstr "Boş bloklar" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" msgstr "Boş sınıf bölümleri" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" msgstr "Boş yapıcılar" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" msgstr "Boş prosedürler" #: lazarusidestrconsts.liscefilter msgid "(filter)" msgstr "(Filtre)" #: lazarusidestrconsts.liscefollowcursor msgid "Follow cursor" msgstr "İmleci takip et" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" msgstr "Kök kontrol" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treated as \"many\"" msgstr "Parametreler \"çok\" olarak kabul edilir" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" msgstr "Uzun prosedürler" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" msgstr "\"Uzun\" olarak kabul edilen işlemin satır sayısı" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" msgstr "Birçok iç içe prosedür" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" msgstr "Birçok parametre" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" msgstr "Kategorileri Göster" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "Kaynak düğümleri göster" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treated as \"many\"" msgstr "Çok fazla İç içe geçmiş prosedürler" #: lazarusidestrconsts.liscenteralostwindow msgid "Center a lost window" msgstr "Kayıp bir pencereyi ortala" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored." msgstr "Verilen kardeşe göre kontrolü yatay olarak ortalayın. BorderSpacing yoksayılır." #: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored." msgstr "Verilen kardeşe göre kontrolü dikey olarak ortalayın. BorderSpacing yoksayılır." #: lazarusidestrconsts.liscenterform msgid "Center Form" msgstr "Formu ortala" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" msgstr "Pencerede ortala" #: lazarusidestrconsts.liscenters msgid "Centers" msgstr "Merkezi" #: lazarusidestrconsts.lisceomode msgid "Preferred exhibition mode" msgstr "Tercih edilen sergileme modu" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" msgstr "Kategori" #: lazarusidestrconsts.lisceomodesource msgctxt "lazarusidestrconsts.lisceomodesource" msgid "Source" msgstr "Kaynak" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" msgstr "Asla, yalnızca manuel" #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "Sadece kategori modunda kullanılır" #: lazarusidestrconsts.lisceoonidle msgid "On idle" msgstr "Boşta" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" msgstr "Otomatik olarak yenile" #: lazarusidestrconsts.lisceothergroup msgctxt "lazarusidestrconsts.lisceothergroup" msgid "Other" msgstr "Diğer" #: lazarusidestrconsts.lisceoupdate msgid "Update" msgstr "Güncelleştir" #: lazarusidestrconsts.lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "Kaynak düzenleyicide dosya değiştirilirken" #: lazarusidestrconsts.lisceprocedures msgid "Procedures" msgstr "Prosedürler" #: lazarusidestrconsts.lisceproperties msgctxt "lazarusidestrconsts.lisceproperties" msgid "Properties" msgstr "Özellikler" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" msgstr "Varsayılan olmadan yayınlanmış özellikler" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observations about" msgstr "Şununla ilgili gözlemleri göster" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" msgstr "Stil" #: lazarusidestrconsts.liscesurrounding msgid "Surrounding" msgstr "Çevreleyen" #: lazarusidestrconsts.liscetodos msgid "ToDos" msgstr "Yapılacaklar" #: lazarusidestrconsts.liscetypes msgid "Types" msgstr "Tipler(Types)" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" msgstr "İsimsiz sabitler" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" msgstr "Sıralanmamış üyeler" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" msgstr "Sıralanmamış görüntü" #: lazarusidestrconsts.lisceuses msgctxt "lazarusidestrconsts.lisceuses" msgid "Uses" msgstr "Uses" #: lazarusidestrconsts.liscevariables msgid "Variables" msgstr "Değişkenler" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" msgstr "Yanlış girinti" #: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof #, object-pascal-format msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s" msgstr "%s\"%s:%s\"%s%s öğesinin silinmesi sırasında bir istisna oluştu" #: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection msgid "Do not know how to copy this form editing selection" msgstr "Bu form düzenleme seçimini nasıl kopyalayacağımı bilmiyorum" #: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection msgid "Do not know how to cut this form editing selection" msgstr "Bu form düzenleme seçimini nasıl keseceğinizi bilmiyorum" #: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection msgid "Do not know how to delete this form editing selection" msgstr "Bu form düzenleme seçimini nasıl sileceğimi bilmiyorum" #: lazarusidestrconsts.liscfeerrorcreatingcomponent msgid "Error creating component" msgstr "Bileşen oluşturulurken hata oluştu" #: lazarusidestrconsts.liscfeerrorcreatingcomponent2 #, object-pascal-format msgid "Error creating component: %s%s%s" msgstr "Bileşen oluşturulurken hata oluştu: %s %s %s" #: lazarusidestrconsts.liscfeerrordestroyingcomponent msgid "Error destroying component" msgstr "Bileşeni yok ederken hata oluştu" #: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit #, object-pascal-format msgid "Error destroying component of type %s of unit %s:%s%s" msgstr "%s: %s %s biriminin %s türü bileşenini yok ederken hata oluştu" #: lazarusidestrconsts.liscfeerrordestroyingmediator msgid "Error destroying mediator" msgstr "Aracı yok edilirken hata oluştu" #: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit #, object-pascal-format msgid "Error destroying mediator %s of unit %s:%s%s" msgstr "Birim %s için aracı %s yok edildi: %s %s" #: lazarusidestrconsts.liscfeinfile #, object-pascal-format msgid "In file %s" msgstr "%s dosyasında" #: lazarusidestrconsts.liscfeinvalidcomponentowner msgid "Invalid component owner" msgstr "Geçersiz bileşen sahibi" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists msgid "TCustomFormEditor.CreateNonFormForm already exists" msgstr "TCustomFormEditor.CreateNonFormForm zaten var" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype #, object-pascal-format msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" msgstr "TCustomFormEditor.CreateNonFormForm Bilinmeyen tür %s" #: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn #, object-pascal-format msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" msgstr "TCustomFormEditor.DeleteComponent TCustomNonFormDesignerForm nerde? %s" #: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre #, object-pascal-format msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" msgstr "TCustomFormEditor.RegisterDesignerMeditor zaten kayıtlı: %s" #: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror #, object-pascal-format msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" msgstr "\"%s \"sınıfının bileşen düzenleyicisi şu hatayı oluşturdu:%s\"%s\"" #: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto #, object-pascal-format msgid "The component of type %s failed to set its owner to %s:%s" msgstr "%s türündeki bileşen sahibini %s:%s olarak ayarlayamadı" #: lazarusidestrconsts.liscfeunabletocleartheformeditingselection #, object-pascal-format msgid "Unable to clear the form editing selection%s%s" msgstr "Form düzenleme seçimi silinemiyor%s%s" #: lazarusidestrconsts.lischange msgctxt "lazarusidestrconsts.lischange" msgid "Change" msgstr "Değiştir" #: lazarusidestrconsts.lischangebuildmode msgid "Change build mode" msgstr "Yapı modunu değiştir" #: lazarusidestrconsts.lischangeclass msgid "Change Class" msgstr "Sınıfı Değiştir" #: lazarusidestrconsts.lischangedscoordofsfromdtodinsides #, object-pascal-format msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." msgstr "%s, %s \"%d\" den \"%d\" ye %s içindeki koordinatını değiştirildi." #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" msgstr "Kodlamayı Değiştir" #: lazarusidestrconsts.lischangefile msgid "Change file" msgstr "Dosyayı değiştir" #: lazarusidestrconsts.lischangeparent msgid "Change Parent" msgstr "Ebeveyn Değiştir" #: lazarusidestrconsts.lischangeswerenotsaved msgid "Changes were not saved" msgstr "Değişiklikler kaydedilmedi" #: lazarusidestrconsts.lischangetounix msgid "Change to Unix /" msgstr "Unix e göre değiştir /" #: lazarusidestrconsts.lischangetowindows msgid "Change to Windows \\" msgstr "Windows a göre değiştir \\" #: lazarusidestrconsts.lischeckall msgid "Check All" msgstr "Hepsini Kontrol Edin" #: lazarusidestrconsts.lischeckcompilerpath msgid "Please make sure that the path to the compiler in the IDE options is correct." msgstr "" #: lazarusidestrconsts.lischeckfordiskfilechangesviacontent msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent" msgid "Check for disk file changes via content rather than timestamp" msgstr "Disk dosyası değişikliklerini zaman damgası yerine içerik aracılığıyla kontrol edin" #: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil #, object-pascal-format msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source." msgstr ". %s paketinin %s.ppu dosyasını oluşturup oluşturmadığını kontrol edin, bu dosyayı hiçbir şeyin silmediğini kontrol edin ve iki paketin birim kaynağına erişimi olmadığını kontrol edin." #: lazarusidestrconsts.lischeckifpackageisinthedependencies #, object-pascal-format msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies" msgid ". Check if package %s is in the dependencies" msgstr "%s paketinin bağımlılıklarda olup olmadığını kontrol edin" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"." msgstr "Kaynaktaki bir sonraki belirtecin \"end\" olup olmadığını ve \"LineEnding + end; + LineEnding \" döndürülmemesini sağlayın." #: lazarusidestrconsts.lischeckoptions msgid "Check options" msgstr "Seçenekleri kontrol et" #: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme #, object-pascal-format msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections." msgstr ". %s paketinin arama yolunu kontrol edin, temiz bir yeniden oluşturmayı deneyin, implementation uses bölümünü kontrol edin." #: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded msgid "Check the next token in source and add a semicolon if needed." msgstr "Kaynaktaki bir sonraki belirteci kontrol edin ve gerekirse noktalı virgül ekleyin." #: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco #, object-pascal-format msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme" msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." msgstr "%s Hedefi kontrol edin (OS, CPU, LCL widget tipi). Belki bu hedef için paketi yeniden derlemeniz veya proje için başka bir hedef belirlemeniz gerekir." #: lazarusidestrconsts.lischeckuncheckall msgid "Check/uncheck all" msgstr "Hepsini kontrol / iptal et" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" msgstr "Farklı bir ad seçin" #: lazarusidestrconsts.lischooseafilewithcodetoolstemplates msgid "Choose a file with CodeTools templates" msgstr "CodeTools şablonlarıyla bir dosya seçin" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "Bir FPDoc bağlantısı seçin" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." msgstr "Bir tuş seç ..." #: lazarusidestrconsts.lischooseanameforthecomponent msgid "Choose a name for the component" msgstr "Bileşen için bir ad seçin" #: lazarusidestrconsts.lischooseanexamplefile msgid "Choose an example file" msgstr "Örnek bir dosya seçin" #: lazarusidestrconsts.lischooseanfpcmessagefile msgid "Choose an FPC message file" msgstr "Bir FPC mesaj dosyası seçin" #: lazarusidestrconsts.lischooseapascalfileforindentationexamples msgid "Choose a Pascal file for indentation examples" msgstr "Girinti örnekleri için bir Pascal dosyası seçin" #: lazarusidestrconsts.lischoosecompilerexecutable #, object-pascal-format msgid "Choose compiler executable (%s)" msgstr "Derleyici yürütülebilir dosyayı seçin ( %s)" #: lazarusidestrconsts.lischoosecompilermessages msgid "Choose compiler messages file" msgstr "Derleyici iletileri dosyasını seçin" #: lazarusidestrconsts.lischoosedebuggerexecutable msgid "Choose debugger executable" msgstr "Çalıştırılabilir hata ayıklayıcıyı seçin" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "Delphi paketini seçin (* .dpk)" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "Delphi proje seç (* .dpr)" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Delphi birimini seçin (* .pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" msgstr "Dizini seçin" #: lazarusidestrconsts.lischooseexecutable msgid "Choose an executable" msgstr "Çalıştırılabilir bir dosya seçin" #: lazarusidestrconsts.lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "FPC kaynak dizinini seçin" #: lazarusidestrconsts.lischoosefppkgconfigurationfile msgid "Choose the fppkg configuration file" msgstr "" "\n" "Fppkg yapılandırma dosyasını seçin" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "Lazarus Dizini Seçin" #: lazarusidestrconsts.lischoosemakeexecutable msgid "Choose \"make\" executable" msgstr "Çalıştırılabilir \"make\" i seçin" #: lazarusidestrconsts.lischoosenameandtext msgid "Choose name and text" msgstr "İsim ve metin seç" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "Yeni bir dosya oluşturmak için bu öğelerden birini seçin" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "Yeni bir paket oluşturmak için bu maddelerden birini seçin" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "Yeni bir proje oluşturmak için bu maddelerden birini seçin" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "Mevcut öğelerden miras almak için bu öğelerden birini seçin" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Program kaynağını seçin (* .pp, *. Pas, *. Lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Seçimi kapsayacak yapıyı seçin" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "Test dizini seç" #: lazarusidestrconsts.liscirculardependencydetected msgid "Circular dependency detected" msgstr "Dairesel bağımlılık algılandı" #: lazarusidestrconsts.lisclass msgid "&Class" msgstr "&Sınıf" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" msgstr "Sınıf Tamamlama" #: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked msgid "Classes and properties exist. Values were not checked." msgstr "Sınıflar ve özellikler mevcuttur. Değerler kontrol edilmedi." #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste #, object-pascal-format msgid "Class \"%s\" is not a registered component class.%sUnable to paste." msgstr "Class \"%s\" kayıtlı bir bileşen sınıfı değil %s yapıştırılamıyor." #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" msgstr "Sınıf bulunamadı" #: lazarusidestrconsts.lisclassnotfoundat #, object-pascal-format msgid "Class %s not found at %s(%s,%s)" msgstr "Sınıf %s %s ( %s, %s) bulunamadı" #: lazarusidestrconsts.lisclassofmethodnotfound #, object-pascal-format msgid "Class \"%s\" of method \"%s\" not found." msgstr "\"%s\" yönteminin \"%s\" sınıfı bulunamadı." #: lazarusidestrconsts.liscldirclean msgid "Clean" msgstr "Temizle" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" msgstr "Dizini Temizle" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" msgstr "Alt dizinleri temizle" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Tüm metin dosyalarını sakla" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "Dosyalarla eşleşen filtreyi koru" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "Filtreye uyan dosyaları kaldır" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Basit Sözdizimi (ör. *. * Yerine)" #: lazarusidestrconsts.liscleanall msgid "Clean all" msgstr "Hepsini temizle" #: lazarusidestrconsts.liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Lazarus Kaynağını Temizle" #: lazarusidestrconsts.liscleanonlyonce msgid "Switch after building to automatically" msgstr "Oluşturduktan sonra otomatik olarak geçiş yap" #: lazarusidestrconsts.liscleanup msgid "Clean up" msgstr "Temizle" #: lazarusidestrconsts.liscleanupandbuild msgctxt "lazarusidestrconsts.liscleanupandbuild" msgid "Clean up and build" msgstr "Temizle ve derle" #: lazarusidestrconsts.liscleanupandbuildproject msgid "Clean up and build project" msgstr "Temizle ve projeyi derle" #: lazarusidestrconsts.liscleanuplazbuild msgid "Clean up + lazbuild" msgstr "Temizle + lazbuild" #: lazarusidestrconsts.liscleanuppackage #, object-pascal-format msgid "Clean up package \"%s\"." msgstr "\"%s\" Paketini temizle ." #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" msgstr "Birim yolunu temizle?" #: lazarusidestrconsts.lisclear msgctxt "lazarusidestrconsts.lisclear" msgid "Clear" msgstr "Temizle" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" msgstr "Dizini Temizle?" #: lazarusidestrconsts.lisclearfilter msgid "Clear filter" msgstr "Filtreyi temizle" #: lazarusidestrconsts.lisclearthefilterforoptions msgid "Clear the filter for options" msgstr "Seçenekler için filtreyi temizle" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "Dosyaya gözatmak için burayı tıklayın" #: lazarusidestrconsts.lisclicktoseethechoices msgid "Click to see the choices" msgstr "Seçenekleri görmek için tıklayın" #: lazarusidestrconsts.lisclicktoselectpalettepage msgid "Click to Select Palette Page" msgstr "Palet Sayfasını Seçmek İçin Tıklayın" #: lazarusidestrconsts.lisclone msgid "Clone" msgstr "Klon" #: lazarusidestrconsts.lisclose msgctxt "lazarusidestrconsts.lisclose" msgid "Close" msgstr "Kapat" #: lazarusidestrconsts.liscloseallchecked msgid "Close All Checked" msgstr "Tüm İşaretlileri Kapat" #: lazarusidestrconsts.lisclosealltabsclose msgid "Close files" msgstr "Dosyaları kapat" #: lazarusidestrconsts.lisclosealltabshide msgctxt "lazarusidestrconsts.lisclosealltabshide" msgid "Hide window" msgstr "Pencereyi gizle" #: lazarusidestrconsts.lisclosealltabsquestion msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" msgstr "Bir Kaynak Düzenleyici Penceresini Kapatma. Tüm dosyaları kapatmak mı yoksa pencereyi gizlemek mi istiyorsunuz?" #: lazarusidestrconsts.lisclosealltabstitle msgid "Close Source Editor Window" msgstr "Kaynak Düzenleyici Penceresini Kapat" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "LCL Arayüze özel seçenekler:" #: lazarusidestrconsts.liscmparameter msgid "Parameter" msgstr "Parametre" #: lazarusidestrconsts.liscmplstcomponents msgctxt "lazarusidestrconsts.liscmplstcomponents" msgid "Components" msgstr "Bileşenler" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" msgstr "Kalıtım" #: lazarusidestrconsts.liscmplstlist msgid "List" msgstr "Liste" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" msgstr "Palet" #: lazarusidestrconsts.liscmppages msgid "Pages" msgstr "Sayfalar" #: lazarusidestrconsts.liscmppalettevisible msgid "Palette is &visible" msgstr "Palet &görünsün" #: lazarusidestrconsts.liscmprestoredefaults msgid "&Restore defaults" msgstr "&Varsayılanları geri yükle" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "Belirsiz ek derleyici yapılandırma dosyası" #: lazarusidestrconsts.liscocallon msgid "Call on:" msgstr "Çağrı:" #: lazarusidestrconsts.liscoclickokifaresuretodothat #, object-pascal-format msgid "%s%sClick OK if you definitely want to do that." msgstr "%s%sBunu kesinlikle yapmak istiyorsanız Tamam'ı tıklayın." #: lazarusidestrconsts.liscocommand msgctxt "lazarusidestrconsts.liscocommand" msgid "Command:" msgstr "Komut:" #: lazarusidestrconsts.liscode msgid "Code" msgstr "Kod" #: lazarusidestrconsts.liscodebrowser msgctxt "lazarusidestrconsts.liscodebrowser" msgid "Code Browser" msgstr "Kod Tarayıcı" #: lazarusidestrconsts.liscodecreationdialogcaption msgid "Code creation options" msgstr "Kod oluşturma seçenekleri" #: lazarusidestrconsts.liscodecreationdialogclasssection msgid "Class section" msgstr "Sınıf bölümü" #: lazarusidestrconsts.liscodecreationdialoglocation msgctxt "lazarusidestrconsts.liscodecreationdialoglocation" msgid "Location" msgstr "Yer" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" msgstr "Kod oluşturma seçenekleri" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" msgstr "Yol ekle" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" msgstr "Gözat" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" msgstr "Değiştirmeyi onayla" #: lazarusidestrconsts.liscodehelpcreatebutton msgid "Create help item" msgstr "Yardım öğesi oluştur" #: lazarusidestrconsts.liscodehelpdeletepathbutton msgid "Remove path" msgstr "Yolu kaldır" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" msgstr "Açıklama" #: lazarusidestrconsts.liscodehelperrorstag msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" msgstr "Hatalar" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" msgstr "Örnek" #: lazarusidestrconsts.liscodehelpgroupbox msgid "FPDoc settings" msgstr "FPDoc ayarları" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "Kalın biçimlendirme etiketi ekle" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "Kod biçimlendirme etiketi ekle" #: lazarusidestrconsts.liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "Eğik biçimlendirme etiketi ekle" #: lazarusidestrconsts.liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "Açıklama biçimlendirme etiketi ekle" #: lazarusidestrconsts.liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "Alt çizgi biçimlendirme etiketi ekle" #: lazarusidestrconsts.liscodehelphintvartag msgid "Insert var formatting tag" msgstr "Var biçimlendirme etiketini ekle" #: lazarusidestrconsts.liscodehelpinherited msgctxt "lazarusidestrconsts.liscodehelpinherited" msgid "Inherited" msgstr "Inherited" #: lazarusidestrconsts.liscodehelpinsertalink msgid "Insert a link ..." msgstr "Bir bağlantı ekle ..." #: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "Paragraf biçimlendirme etiketi ekleme" #: lazarusidestrconsts.liscodehelpmainformcaption msgctxt "lazarusidestrconsts.liscodehelpmainformcaption" msgid "FPDoc Editor" msgstr "FPDoc Editör" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "(Devralınan açıklama bulunamadı)" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" msgstr "" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" msgstr "Ayrıca bakınız" #: lazarusidestrconsts.liscodehelpshortdescriptionof msgid "Short description of" msgstr "Kısa açıklama" #: lazarusidestrconsts.liscodehelpshorttag msgid "Short" msgstr "Kısa" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" msgstr "Sonraki function larda sabitleri yoksay" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" msgstr "İsimlendirilmemiş karakter sabitlerinde arama" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" msgstr "Kod Gözlemci" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" msgstr "Sonraki adsız sabitleri yoksay" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" msgid "Add template" msgstr "Şablon ekle" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" msgstr "Kod şablonu ekle" #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on" msgstr "Otomatik Tamamlama açık" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" msgstr "Açıklama:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" msgstr "Kod şablonunu düzenle" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" msgid "Error" msgstr "Hata" #: lazarusidestrconsts.liscodetemplerroralreadyexists msgid "A token already exists." msgstr "Bir belirteç zaten mevcut." #: lazarusidestrconsts.liscodetemplerroremptyname msgid "The token cannot be empty." msgstr "Belirteç boş olamaz." #: lazarusidestrconsts.liscodetemplerrorinvalidname msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number." msgstr "Belirteç yalnızca Latin harfleri, sayılar ve alt çizgiler içerebilir ve bir sayı ile başlayamaz." #: lazarusidestrconsts.liscodetempltoken msgid "Token:" msgstr "Belirteç:" #: lazarusidestrconsts.liscodetoolsdefsaction #, object-pascal-format msgid "Action: %s" msgstr "Eylem: %s" #: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly #, object-pascal-format msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes." msgstr "Otomatik oluşturulan düğümler düzenlenemez, %sveya otomatik olarak oluşturulmamış alt düğümleri olabilir." #: lazarusidestrconsts.liscodetoolsdefsautogenerated #, object-pascal-format msgid "%s, auto generated" msgstr "%s, otomatik oluşturuldu" #: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes cannot be edited." msgstr "Otomatik oluşturulmuş düğümler düzenlenemez." #: lazarusidestrconsts.liscodetoolsdefsblock msgid "Block" msgstr "Blok" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "Kod Araçları Editörü Tanımları" #: lazarusidestrconsts.liscodetoolsdefscompilerpath msgid "Compiler path" msgstr "Derleyici yolu" #: lazarusidestrconsts.liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Düğümü dönüştür" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory #, object-pascal-format msgid "Create Defines for %s Directory" msgstr "%s Dizini için Tanımlar Oluştur" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "Free Pascal Derleyici için Tanımlar Oluştur" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal Git Sources" msgstr "Free Pascal Git Kaynakları için Tanımlar Oluştur" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject #, object-pascal-format msgid "Create Defines for %s Project" msgstr "%s Projesi için Tanımlar Oluştur" #: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "Bir fpc proje dizini için FPC Makroları ve yolları oluşturma" #: lazarusidestrconsts.liscodetoolsdefsdefine msgid "Define" msgstr "Tanımla" #: lazarusidestrconsts.liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "Özyinelemeyi Tanımla" #: lazarusidestrconsts.liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Düğümü sil" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "Borland'ın tüm %s kaynaklarını yüklediği %s %s ana dizini.%sÖrneğin: C:/Programlar/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "Borland'ın bu %s projesi tarafından kullanılan tüm %s %s kaynaklarını yüklediği %s ana dizini. %s %s Örneğin: C:/Programlar/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdescription msgid "Description:" msgstr "Açıklama:" #: lazarusidestrconsts.liscodetoolsdefsdirectory #, object-pascal-format msgid "%s directory" msgstr "%s dizini" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" msgstr "Else" #: lazarusidestrconsts.liscodetoolsdefselseif msgid "ElseIf" msgstr "ElseIf" #: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC Git source directory" msgstr "FPC Git kaynak dizini" #: lazarusidestrconsts.liscodetoolsdefsif msgid "If" msgstr "If" #: lazarusidestrconsts.liscodetoolsdefsifdef msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef" msgid "IfDef" msgstr "Ifdef" #: lazarusidestrconsts.liscodetoolsdefsifndef msgid "IfNDef" msgstr "IfNDef" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Dizin" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "Delphi 5 Derleyici Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "Delphi 5 Dizin Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "Delphi 5 Proje Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "Delphi 6 Derleyici Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "Delphi 6 Dizin Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "Delphi 6 Proje Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "Delphi 7 Derleyici Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "Delphi 7 Dizin Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "Delphi 7 Proje Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "Free Pascal Derleyici Şablonu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "Free Pascal Proje Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal Git Source Template" msgstr "Free Pascal Git Kaynak Şablonu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "Kylix 3 Derleyici Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "Kylix 3 Dizin Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "Kylix 3 Proje Şablonunu Ekle" #: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "Düğümü çocuk olarak yerleştir" #: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "Aşağıdaki düğümü ekleyin" #: lazarusidestrconsts.liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "Şablon Ekle" #: lazarusidestrconsts.liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "Geçersiz ebeveyn" #: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "Geçersiz üst düğüm" #: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "Geçersiz önceki düğüm" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "Borland'ın tüm %s kaynaklarını yüklediği %s %s ana dizini.%sÖrneğin: /home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject #, object-pascal-format msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "Borland'ın bu %s projesi tarafından kullanılan tüm %s %s kaynaklarını yüklediği %s %s ana dizini.%s Örneğin:/home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "Düğümü aşağıya taşı" #: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "Düğümü Bir seviye aşağıya taşı" #: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "Düğümü Bir seviye yukarı taşı" #: lazarusidestrconsts.liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "Düğümü yukarıya taşı" #: lazarusidestrconsts.liscodetoolsdefsname msgctxt "lazarusidestrconsts.liscodetoolsdefsname" msgid "Name:" msgstr "Ad:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" msgstr "NewNode" #: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "Düğüm salt okunur" #: lazarusidestrconsts.liscodetoolsdefsnoneselected msgid "none selected" msgstr "hiçbiri seçilmedi" #: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch msgid "Parent node cannot contain child nodes." msgstr "Üst düğüm alt düğümleri içeremez." #: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "Önceki düğüm alt düğümleri içeremez." #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" msgstr "Proje dizini" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 #, object-pascal-format msgid "%s project directory" msgstr "%s proje dizini" #: lazarusidestrconsts.liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Seçili Düğüm:" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging." msgstr "Free Pascal Git kaynak dizini. Gerekli değildir. Bu, bulma bildirimini ve hata ayıklamayı geliştirecektir." #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "Free Pascal proje dizini." #: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal Git source directory." msgstr "Free Pascal SVN kaynak dizini." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample #, object-pascal-format msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "Free Pascal derleyici yolu %s Örneğin %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros." msgstr "Bu proje için Free Pascal derleyicisine giden yol. Yalnızca aşağıda FPC Git kaynağını ayarladıysanız gereklidir. Makroları otomatik oluşturmak için kullanılır." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa #, object-pascal-format msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." msgstr "Bu kaynak için Free Pascal derleyicisinin yolu %s makroları otomatikleştirmek için kullanıldı." #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory #, object-pascal-format msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "dpr, dpk dosyasını içeren %s proje dizini,%s." #: lazarusidestrconsts.liscodetoolsdefsundefine msgid "Undefine" msgstr "Tanımsız" #: lazarusidestrconsts.liscodetoolsdefsundefineall msgid "Undefine All" msgstr "Hepsini tanımla" #: lazarusidestrconsts.liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "Tanımsız Özyineleme" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "Dosya Yolu Olarak Değer" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Metin Olarak Değer" #: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid #, object-pascal-format msgid "%s:%svalue \"%s\" is invalid." msgstr "%s: %sdeğer \"%s\" geçersiz." #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" msgstr "Değişken:" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" msgstr "At" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" msgstr "Parantez" #: lazarusidestrconsts.liscodetoolsoptscaret msgid "Caret (^)" msgstr "Şapka işareti (^)" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" msgstr "Kolon" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" msgstr "Virgül" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" msgid "Identifier" msgstr "Tanımlayıcı" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" msgstr "Anahtar kelime" #: lazarusidestrconsts.liscodetoolsoptsnewline msgid "Newline" msgstr "Yenisatır" #: lazarusidestrconsts.liscodetoolsoptsnone msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" msgid "None" msgstr "Yok" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" msgstr "Numara" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" msgstr "Nokta" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Noktalı virgül" #: lazarusidestrconsts.liscodetoolsoptsspace msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" msgid "Space" msgstr "Boşluk" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" msgstr "Sabit sitring" #: lazarusidestrconsts.liscodetoolsoptssymbol msgid "Symbol" msgstr "Sembol" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" msgstr "Sonra çalıştır" #: lazarusidestrconsts.liscoexecutebefore msgid "Execute before" msgstr "Önce çalıştır" #: lazarusidestrconsts.liscollapse msgid "Collapse" msgstr "Daralt" #: lazarusidestrconsts.liscollapseall msgid "Collapse All [Ctrl+Minus]" msgstr "Tümünü daralt [Ctrl+Minus]" #: lazarusidestrconsts.liscollapseall2 msgid "Collapse All" msgstr "Hepsini Daralt" #: lazarusidestrconsts.liscollapseallclasses msgid "Collapse all classes" msgstr "Tüm sınıfları daralt" #: lazarusidestrconsts.liscollapseallpackages msgid "Collapse all packages" msgstr "Tüm paketleri daralt" #: lazarusidestrconsts.liscollapseallunits msgid "Collapse all units" msgstr "Tüm birimleri daralt" #: lazarusidestrconsts.liscomboboxes msgid "Combo Boxes" msgstr "Açılır liste" #: lazarusidestrconsts.liscommandlineparameters msgctxt "lazarusidestrconsts.liscommandlineparameters" msgid "Command line parameters" msgstr "Komut satırı parametreleri" #: lazarusidestrconsts.liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Programın komut satırı parametreleri" #: lazarusidestrconsts.liscompile msgctxt "lazarusidestrconsts.liscompile" msgid "Compile" msgstr "Derle" #: lazarusidestrconsts.liscompileanddonotaskagain msgid "Compile and do not ask again" msgstr "Derle ve tekrar sorma" #: lazarusidestrconsts.liscompilefollowingmodes msgid "Compile the following modes" msgstr "Aşağıdaki modları derleyin" #: lazarusidestrconsts.liscompilenormally msgid "Compile normally" msgstr "Normal şekilde derle" #: lazarusidestrconsts.liscompileproject msgid "Compile Project" msgstr "Projeyi Derle" #: lazarusidestrconsts.liscompiler msgid "Compiler" msgstr "Derleyici" #: lazarusidestrconsts.liscompilercfgismissing #, object-pascal-format msgid "%s is missing." msgstr "%s kayıp." #: lazarusidestrconsts.liscompilerdoesnotsupporttarget #, object-pascal-format msgid "Compiler \"%s\" does not support target %s-%s" msgstr "Derleyici \"%s\" hedef %s- %s'yi desteklemez" #: lazarusidestrconsts.liscompilererrorinvalidcompiler #, object-pascal-format msgid "Error: invalid compiler: %s" msgstr "Hata: geçersiz derleyici: %s" #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" msgstr "Derleyici dosya adı" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" msgstr "İpucu: Araçlar -> Seçenekler -> Dosyalar -> Derleyici Yolu'nda derleyici yolunu ayarlayabilirsiniz" #: lazarusidestrconsts.liscompilermessagesfilenotfound #, object-pascal-format msgid "Compiler messages file not found:%s%s" msgstr "Derleyici mesajları dosyası bulunamadı: %s %s" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "NOT: codetools yapılandırma dosyası bulunamadı - varsayılanları kullanarak" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "NOT: eski codetools seçenek dosyaları yükleniyor: " #: lazarusidestrconsts.liscompilestage msgctxt "lazarusidestrconsts.liscompilestage" msgid "Compile" msgstr "Derle" #: lazarusidestrconsts.liscompilewithprojectsettings msgid "Compile with project settings" msgstr "Proje ayarlarıyla derle" #: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates msgid "Compile with -vd for more details. Check for duplicates." msgstr "Daha fazla ayrıntı için -vd ile derleyin.Yinelenenleri kontrol edin." #: lazarusidestrconsts.liscompiling #, object-pascal-format msgid "%s (compiling ...)" msgstr "%s (derleniyor ...)" #: lazarusidestrconsts.liscompletionlonglinehinttype msgid "Show long line hints" msgstr "Uzun satır ipuçlarını göster" #: lazarusidestrconsts.liscompletionlonglinehinttypefullleft msgid "Extend far left" msgstr "En sola doğru uzatın" #: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft msgid "Extend some left" msgstr "Biraz sola uzat" #: lazarusidestrconsts.liscompletionlonglinehinttypenone msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" msgid "Never" msgstr "Asla" #: lazarusidestrconsts.liscompletionlonglinehinttyperightonly msgid "Extend right only" msgstr "Yalnızca sağa uzat" #: lazarusidestrconsts.liscomponentnameiskeyword #, object-pascal-format msgid "Component name \"%s\" is keyword" msgstr "Bileşen adı \"%s\" anahtar kelime" #: lazarusidestrconsts.liscomppalcomponentlist msgid "View All" msgstr "Hepsini gör" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" msgstr "Paketi aç" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" msgstr "Birimi Aç" #: lazarusidestrconsts.liscompress msgid "Compress" msgstr "Sıkıştır" #: lazarusidestrconsts.liscompresshint msgid "The resulting directory will be compressed into a ZIP file." msgstr "Ortaya çıkan dizin bir ZIP dosyası halinde sıkıştırılacaktır." #: lazarusidestrconsts.liscomptest msgctxt "lazarusidestrconsts.liscomptest" msgid "&Test" msgstr "&Test" #: lazarusidestrconsts.liscondition msgid "Condition" msgstr "Şart" #: lazarusidestrconsts.lisconditionals msgctxt "lazarusidestrconsts.lisconditionals" msgid "Conditionals" msgstr "Şartlılar" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" msgstr "Lazarus yapılandırma dizini" #: lazarusidestrconsts.lisconfigfileofadditions msgid "Config file of additions:" msgstr "Eklerin yapılandırma dosyası:" #: lazarusidestrconsts.lisconfigurebuild #, object-pascal-format msgid "Configure Build %s" msgstr "%s Derlemeyi Yapılandır" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure \"Build Lazarus\"" msgstr "\"Lazarus Oluştur\" u yapılandır" #: lazarusidestrconsts.lisconfigureeditortoolbar msgid "Configure Toolbar" msgstr "Araç Çubuğunu Yapılandır" #: lazarusidestrconsts.lisconfigurelazaruside msgid "Configure Lazarus IDE" msgstr "Lazarus IDE yi Yapılandır" #: lazarusidestrconsts.lisconfirm msgid "Confirm" msgstr "Onayla" #: lazarusidestrconsts.lisconfirmation msgid "Confirmation" msgstr "Onayla" #: lazarusidestrconsts.lisconfirmbuildallprofiles #, object-pascal-format msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" msgstr "Lazarus aşağıdaki profillerle tekrar oluşturulacaktır: %sDevam edilsin mi?" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" msgstr "Değişiklikleri onayla" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" msgstr "Silmeyi onayla" #: lazarusidestrconsts.lisconfirmlazarusrebuild #, object-pascal-format msgid "Do you want to rebuild Lazarus with profile: %s?" msgstr "Lazarus'u profil ile yeniden oluşturmak ister misiniz: %s?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "IDE için yeni paket setini onaylayın" #: lazarusidestrconsts.lisconfirmpackageaction msgctxt "lazarusidestrconsts.lisconfirmpackageaction" msgid "Action" msgstr "Aksiyon" #: lazarusidestrconsts.lisconfirmpackagenewpackageset msgid "New package set" msgstr "Yeni paket seti" #: lazarusidestrconsts.lisconfirmpackageoldpackageset msgid "Old package set" msgstr "Eski paket seti" #: lazarusidestrconsts.lisconflict msgid "Conflict" msgstr "Çakışma" #: lazarusidestrconsts.lisconflictdetected msgid "Conflict detected" msgstr "Çakışma algılandı" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" msgstr "Konsol uygulaması" #: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc." msgstr "Komut satırı seçeneklerini, istisnaları işleme vb. kolayca kontrol etmek için TCustomApplication kullanan Free Pascal komut satırı programı." #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" msgstr "Yapıcı kodu" #: lazarusidestrconsts.liscontains msgid "contains" msgstr "içerir" #: lazarusidestrconsts.liscontents msgctxt "lazarusidestrconsts.liscontents" msgid "Contents" msgstr "İçerik" #: lazarusidestrconsts.liscontextsensitive msgid "Context sensitive" msgstr "İçeriğe duyarlı" #: lazarusidestrconsts.liscontinueanddonotaskagain msgid "Continue and do not ask again" msgstr "Devam et ve tekrar sorma" #: lazarusidestrconsts.liscontinuebuilding msgid "Continue building" msgstr "Yapılandırmaya devam et" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Formu yüklemeden devam et" #: lazarusidestrconsts.liscontributors msgid "Contributors" msgstr "Katkıda Bulunanlar" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" msgstr "Kontrolün ebeveynlere ihtiyacı var" #: lazarusidestrconsts.lisconvaddcommentafterreplacement msgid "Add comment after replacement" msgstr "Değiştirmeden sonra yorum ekle" #: lazarusidestrconsts.lisconvaddedmodedelphimodifier msgid "Added MODE Delphi syntax modifier after unit name." msgstr "Birim adından sonra MODE Delphi sözdizimi değiştiricisi eklendi." #: lazarusidestrconsts.lisconvaddingflagforregister #, object-pascal-format msgid "Adding flag for \"Register\" procedure in unit %s." msgstr "%s biriminde \"Register\" işlemi için bayrak eklendi." #: lazarusidestrconsts.lisconvbracketmissingfromreplfunc #, object-pascal-format msgid "\")\" is missing from replacement function: %s" msgstr "\")\" değiştirme fonksiyonunda eksik: %s" #: lazarusidestrconsts.lisconvbracketnotfound msgid "Bracket not found" msgstr "Parantez bulunamadı" #: lazarusidestrconsts.lisconvconvertedfrom #, object-pascal-format msgid " { *Converted from %s* }" msgstr " {*%s dan çevirildi *}" #: lazarusidestrconsts.lisconvcoordhint msgid "An offset is added to Top coordinate of controls inside visual containers" msgstr "Görsel kaplar içindeki kontrollerin Üst koordinatına bir ofset eklenir" #: lazarusidestrconsts.lisconvcoordoffs msgid "Coordinate offsets" msgstr "Koordinat ofsetleri" #: lazarusidestrconsts.lisconvdeletedfile #, object-pascal-format msgid "Deleted file %s" msgstr "%s dosyası silindi" #: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines #, object-pascal-format msgid "Added defines %s in custom options" msgstr "Eklenen %s, özel seçenekler" #: lazarusidestrconsts.lisconvdelphiaddedpackagedependency #, object-pascal-format msgid "Added Package %s as a dependency." msgstr "%s paketi bağımlılık olarak eklendi." #: lazarusidestrconsts.lisconvdelphiaddedunittousessection #, object-pascal-format msgid "Added unit \"%s\" to uses section." msgstr "USES bölümüne \"%s\" birimi eklendi." #: lazarusidestrconsts.lisconvdelphiallsubdirsscanned msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" msgid "All sub-directories will be scanned for unit files" msgstr "Tüm alt dizinler birim dosyaları için taranacak" #: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed msgid "BeginCodeTools failed!" msgstr "BeginCodeTools başarısız oldu!" #: lazarusidestrconsts.lisconvdelphicategories msgid "Categories:" msgstr "Kategoriler:" #: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 #, object-pascal-format msgid "Changed encoding from %s to UTF-8" msgstr "%s 'den UTF-8'e kodlama değiştirildi" #: lazarusidestrconsts.lisconvdelphiconversionaborted msgid "Conversion Aborted." msgstr "Dönüşüm Durduruldu." #: lazarusidestrconsts.lisconvdelphiconversionready msgid "Conversion Ready." msgstr "Dönüşüm Hazır." #: lazarusidestrconsts.lisconvdelphiconversiontook #, object-pascal-format msgid "Conversion took: %s" msgstr "Dönüşüm alındı: %s" #: lazarusidestrconsts.lisconvdelphiconvertdelphipackage msgid "Convert Delphi package" msgstr "Delphi paketini dönüştür" #: lazarusidestrconsts.lisconvdelphiconvertdelphiproject msgid "Convert Delphi project" msgstr "Delphi projesini dönüştür" #: lazarusidestrconsts.lisconvdelphiconvertdelphiunit msgid "Convert Delphi unit" msgstr "Delphi birimini dönüştür" #: lazarusidestrconsts.lisconvdelphiconvertingfoundunits msgid "*** Converting unit files found during conversion ***" msgstr "*** Dönüştürme sırasında bulunan birim dosyalarını dönüştürme ***" #: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits msgid "*** Converting unit files belonging to project/package ***" msgstr "*** Proje/pakete ait birim dosyalarının dönüştürülmesi ***" #: lazarusidestrconsts.lisconvdelphierror #, object-pascal-format msgid "Error=\"%s\"" msgstr "Hata = \"%s\"" #: lazarusidestrconsts.lisconvdelphiexceptionduringconversion msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." msgstr "Birim dönüştürme sırasında istisna oluştu. Halihazırda dönüştürülmüş birimlerin form dosyalarıyla devam ediliyor..." #: lazarusidestrconsts.lisconvdelphifailedconvertingunit msgid "Failed converting unit" msgstr "Birim dönüştürme başarısız oldu" #: lazarusidestrconsts.lisconvdelphifailedtoconvertunit #, object-pascal-format msgid "Failed to convert unit \"%s\"" msgstr "Birimi dönüştürme başarısız \"%s\"" #: lazarusidestrconsts.lisconvdelphifixedunitcase #, object-pascal-format msgid "Fixed character case of unit \"%s\" to \"%s\"." msgstr "Birmin sabit karakter durumu \"%s\" den \"%s\"." #: lazarusidestrconsts.lisconvdelphifoundallunitfiles msgid "Found all unit files" msgstr "Bulunan tüm birim dosyalar" #: lazarusidestrconsts.lisconvdelphifunc msgid "Delphi Function" msgstr "Delphi Fonksiyonu" #: lazarusidestrconsts.lisconvdelphimissingincludefile #, object-pascal-format msgid "%s(%s,%s) missing include file" msgstr "%s(%s,%s) eksik dosya içeriyor" #: lazarusidestrconsts.lisconvdelphiname msgid "Delphi Name" msgstr "Delphi Adı" #: lazarusidestrconsts.lisconvdelphipackagenameexists msgid "Package name exists" msgstr "Paket adı zaten var" #: lazarusidestrconsts.lisconvdelphipackagerequired #, object-pascal-format msgid "Package %s is required but not installed in Lazarus! Install it later." msgstr "%s paketi gerekli ancak Lazarus'ta yüklü değil! Daha sonra kurun." #: lazarusidestrconsts.lisconvdelphiprojomittedunit #, object-pascal-format msgid "Omitted unit %s from project" msgstr "Projeden %s birimi çıkarıldı" #: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection #, object-pascal-format msgid "Removed unit \"%s\" from uses section." msgstr "USES bölümünden \"%s\" birimi kaldırıldı." #: lazarusidestrconsts.lisconvdelphirepairingformfiles msgid "*** Fixing used units and Repairing form files ***" msgstr "*** Kullanılmış birimleri düzeltme ve form dosyalarını onarma ***" #: lazarusidestrconsts.lisconvdelphireplacedunitinusessection #, object-pascal-format msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" msgid "Replaced unit \"%s\" with \"%s\" in uses section." msgstr "Uses bölümünde \"%s\" birimi \"%s\" ile değiştirildi." #: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa #, object-pascal-format msgid "There is already a package with the name \"%s\"%sPlease close this package first." msgstr "Zaten \"%s\"%s adında bir paket var Lütfen önce bu paketi kapatın." #: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl msgid "Unitname exists in LCL" msgstr "Birimadı LCL'de var" #: lazarusidestrconsts.lisconvdelphiunitstoreplacein #, object-pascal-format msgid "Units to replace in %s" msgstr "%s olarak değiştirilecek birimler" #: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl #, object-pascal-format msgid "LCL already has a unit with name %s. Delete local file %s?" msgstr "LCL zaten %s ismine sahip bir birime sahip. Yerel dosya %s silinsin mi?" #: lazarusidestrconsts.lisconvdprojfilenotsupportedyet msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages." msgstr ".dproj dosyası henüz desteklenmiyor. Dosya Delphi 2007 ve daha yeni tarafından kullanılır. Lütfen projeler için bir .dpr dosyası veya paketler için .dpk dosyasını seçin." #: lazarusidestrconsts.lisconversionerror msgid "Conversion error" msgstr "Dönüşüm hatası" #: lazarusidestrconsts.lisconvert msgid "Convert" msgstr "Dönüştür" #: lazarusidestrconsts.lisconvertencoding msgid "Convert Encoding" msgstr "Kodlamayı Dönüştür" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" msgstr "Projelerin/paketlerin kodlamasını dönüştür" #: lazarusidestrconsts.lisconvertotherhint msgid "Other options affecting the conversion" msgstr "Dönüşümü etkileyen diğer seçenekler" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" msgstr "Proje veya paketi dönüştür" #: lazarusidestrconsts.lisconverttarget msgid "Target" msgstr "Hedef" #: lazarusidestrconsts.lisconverttargetcrossplatform msgid "Cross-platform" msgstr "Çapraz platform" #: lazarusidestrconsts.lisconverttargetcrossplatformhint msgid "Cross-platform versus Windows-only" msgstr "Yalnızca Windows'a karşı çapraz platform" #: lazarusidestrconsts.lisconverttargethint msgid "Converter adds conditional compilation to support different targets" msgstr "Dönüştürücü, farklı hedefleri desteklemek için koşullu derleme ekler" #: lazarusidestrconsts.lisconverttargetsamedfmfile msgid "Use the same DFM form file" msgstr "Aynı DFM form dosyasını kullan" #: lazarusidestrconsts.lisconverttargetsamedfmfilehint msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" msgstr "LFM'ye kopyalamak yerine Lazarus ve Delphi için aynı DFM dosyası" #: lazarusidestrconsts.lisconverttargetsupportdelphi msgid "Support Delphi" msgstr "Delphi desteği" #: lazarusidestrconsts.lisconverttargetsupportdelphihint msgid "Use conditional compilation to support Delphi" msgstr "Delphi'yi desteklemek için koşullu derleme kullanın" #: lazarusidestrconsts.lisconvfixedunitname #, object-pascal-format msgid "Fixed unit name from %s to %s." msgstr "%s ile %s arasındaki sabit birim adı." #: lazarusidestrconsts.lisconvfuncreplacements msgid "Function Replacements" msgstr "Fonksiyon Değişiklikleri" #: lazarusidestrconsts.lisconvfuncreplhint msgctxt "lazarusidestrconsts.lisconvfuncreplhint" msgid "Some Delphi functions can be replaced with LCL function" msgstr "Bazı Delphi fonksiyonları LCL fonksiyonuyla değiştirilebilir" #: lazarusidestrconsts.lisconvfuncstoreplace msgid "Functions / procedures to replace" msgstr "Değiştirilecek fonksiyonlar/prosedürler" #: lazarusidestrconsts.lisconvleftoff msgid "Left offset" msgstr "Sol ofset" #: lazarusidestrconsts.lisconvnewname msgid "New Name" msgstr "Yeni isim" #: lazarusidestrconsts.lisconvparentcontainer msgid "Parent Container" msgstr "Ebeveyn Konteyner" #: lazarusidestrconsts.lisconvproblemsfindingallunits #, object-pascal-format msgid "Problems when trying to find all units from project file %s" msgstr "%s proje dosyasındaki tüm birimleri bulmaya çalışırken karşılaşılan sorunlar" #: lazarusidestrconsts.lisconvproblemsfixingincludefile #, object-pascal-format msgid "Problems when fixing include files in file %s" msgstr "%s dosyasındaki dosyaları saptarken karşılaşılan sorunlar" #: lazarusidestrconsts.lisconvproblemsrepairingformfile #, object-pascal-format msgid "Problems when repairing form file %s" msgstr "%s form dosyasını onarırken oluşan sorunlar" #: lazarusidestrconsts.lisconvrepairingincludefiles msgid "Repairing include files : " msgstr "Dahil edilen dosyaları tamir et: " #: lazarusidestrconsts.lisconvreplacedcall #, object-pascal-format msgid "Replaced call %s with %s" msgstr "%s çağrısı %s ile değiştirildi" #: lazarusidestrconsts.lisconvreplfuncparameternum #, object-pascal-format msgid "Replacement function parameter number should be >= 1: %s" msgstr "Değiştirme fonksiyonu parametre numarası > = 1 olmalıdır: %s" #: lazarusidestrconsts.lisconvshouldbefollowedbynumber #, object-pascal-format msgid "\"$\" should be followed by a number: %s" msgstr "\"$\" Bir sayı ile takip edilmelidir: %s" #: lazarusidestrconsts.lisconvstoppedbecausethereispackage msgid "Stopped because there already is a package with the same name" msgstr "Zaten aynı isimde bir paket olduğu için durduruldu" #: lazarusidestrconsts.lisconvthislogwassaved #, object-pascal-format msgid "This log was saved to %s" msgstr "Bu günlük %s'ye kaydedildi" #: lazarusidestrconsts.lisconvtopoff msgid "Top offset" msgstr "Üst ofset" #: lazarusidestrconsts.lisconvtypereplacements msgid "Type Replacements" msgstr "Tip Değişiklikleri" #: lazarusidestrconsts.lisconvtypereplhint msgid "Unknown types in form file (DFM/LFM)" msgstr "Form dosyasında bilinmeyen türler (DFM / LFM)" #: lazarusidestrconsts.lisconvtypestoreplace msgid "Types to replace" msgstr "Değiştirilecek türler" #: lazarusidestrconsts.lisconvunitreplacements msgid "Unit Replacements" msgstr "Birim Değiştirme" #: lazarusidestrconsts.lisconvunitreplhint msgid "Unit names in uses section of a source unit" msgstr "Bir kaynak birimin uses bölümündeki birim adları" #: lazarusidestrconsts.lisconvunitstoreplace msgid "Units to replace" msgstr "Değiştirilecek birimler" #: lazarusidestrconsts.lisconvunknownprops msgid "Unknown properties" msgstr "Bilinmeyen özellikler" #: lazarusidestrconsts.lisconvuserselectedtoendconversion #, object-pascal-format msgid "User selected to end conversion with file %s" msgstr "Kullanıcı %s dosyası ile dönüşümü sonlandırmayı seçti" #: lazarusidestrconsts.liscoolbaraddconfigdelete msgid "Add/Config/Delete Toolbar(s)" msgstr "Araç Çubuğu Ekle/Düzenle/Sil" #: lazarusidestrconsts.liscoolbaradddivider msgid "Add Divider" msgstr "Bölücü Ekle" #: lazarusidestrconsts.liscoolbaraddselected msgid "Add selected item to toolbar" msgstr "Seçilen öğeyi araç çubuğuna ekle" #: lazarusidestrconsts.liscoolbaravailablecommands msgid "Available commands" msgstr "Kullanılabilir komutlar" #: lazarusidestrconsts.liscoolbarborderstyle msgid "Toolbars border style" msgstr "Araç çubukları kenarlık stili" #: lazarusidestrconsts.liscoolbarborderstyleitem0 msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0" msgid "None" msgstr "Yok" #: lazarusidestrconsts.liscoolbarborderstyleitem1 msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1" msgid "Single" msgstr "Tek" #: lazarusidestrconsts.liscoolbarcodeexplorer msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer" msgid "Code Explorer" msgstr "Kod Explorer" #: lazarusidestrconsts.liscoolbarcodetemplates msgctxt "lazarusidestrconsts.liscoolbarcodetemplates" msgid "Code Templates" msgstr "Kod Şablonları" #: lazarusidestrconsts.liscoolbarconfigure msgid "&Configure" msgstr "&Yapılandır" #: lazarusidestrconsts.liscoolbardeletetoolbar msgid "Are you sure you want to delete the selected toolbar?" msgstr "Seçili araç çubuğunu silmek istediğinizden emin misiniz?" #: lazarusidestrconsts.liscoolbardeletewarning msgid "There must be at least one toolbar!" msgstr "En az bir araç çubuğu olmalıdır!" #: lazarusidestrconsts.liscoolbardesigner msgid "Designer" msgstr "Tasarım" #: lazarusidestrconsts.liscoolbargeneralsettings msgid "General Coolbar Settings" msgstr "Genel Coolbar Ayarları" #: lazarusidestrconsts.liscoolbargrabstyle msgid "Toolbars grab style" msgstr "Araç çubukları yakalama stili" #: lazarusidestrconsts.liscoolbargrabstyleitem0 msgid "Simple" msgstr "Basit" #: lazarusidestrconsts.liscoolbargrabstyleitem1 msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1" msgid "Double" msgstr "Çift" #: lazarusidestrconsts.liscoolbargrabstyleitem2 msgid "HorLines" msgstr "Yatay çizgiler" #: lazarusidestrconsts.liscoolbargrabstyleitem3 msgid "VerLines" msgstr "Dikey çizgiler" #: lazarusidestrconsts.liscoolbargrabstyleitem4 msgid "Gripper" msgstr "Tutucu" #: lazarusidestrconsts.liscoolbargrabstyleitem5 msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5" msgid "Button" msgstr "Buton" #: lazarusidestrconsts.liscoolbargrabwidth msgid "Grab width" msgstr "Genişliği tut" #: lazarusidestrconsts.liscoolbaridemainmenu msgid "IDE Main Menu" msgstr "IDE Ana Menüsü" #: lazarusidestrconsts.liscoolbarmessages msgctxt "lazarusidestrconsts.liscoolbarmessages" msgid "Messages" msgstr "Mesajlar" #: lazarusidestrconsts.liscoolbarmoveselecteddown msgid "Move selected toolbar item down" msgstr "Seçilen araç çubuğu öğesini aşağı taşı" #: lazarusidestrconsts.liscoolbarmoveselectedup msgid "Move selected toolbar item up" msgstr "Seçilen araç çubuğu öğesini yukarı taşı" #: lazarusidestrconsts.liscoolbaroptions msgid "IDE CoolBar" msgstr "IDE Araç çubuğu" #: lazarusidestrconsts.liscoolbarpackageeditor msgid "Package Editor" msgstr "Paket Düzenleyici" #: lazarusidestrconsts.liscoolbarpackageeditorfiles msgid "Package Editor Files" msgstr "Paket Düzenleyici Dosyaları" #: lazarusidestrconsts.liscoolbarremoveselected msgid "Remove selected item from toolbar" msgstr "Seçilen öğeyi araç çubuğundan kaldır" #: lazarusidestrconsts.liscoolbarrestoredefaults msgid "Restore defaults" msgstr "Varsayılanları geri yükle" #: lazarusidestrconsts.liscoolbarselecttoolbar msgid "Please select a toolbar first!" msgstr "Lütfen öncelikle bir araç çubuğu seçin!" #: lazarusidestrconsts.liscoolbarsourceeditor msgctxt "lazarusidestrconsts.liscoolbarsourceeditor" msgid "Source Editor" msgstr "Kaynak Düzenleyici" #: lazarusidestrconsts.liscoolbarsourcetab msgid "Source Tab" msgstr "Kaynak Sekmesi" #: lazarusidestrconsts.liscoolbartoolbarcommands msgid "Toolbar commands" msgstr "Araç çubuğu komutları" #: lazarusidestrconsts.liscoolbarvisible msgid "Coolbar is &visible" msgstr "Araç çubuğu görünsün" #: lazarusidestrconsts.liscoolbarwidth msgid "Coolbar width" msgstr "Araç çubuğu genişliği" #: lazarusidestrconsts.liscopyallitemstoclipboard msgid "Copy All Items to Clipboard" msgstr "Tüm Öğeleri Panoya Kopyala" #: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard msgid "Copy All/Original Messages to Clipboard" msgstr "Tümünü Kopyala/Orijinal Mesajları Panoya Kopyala" #: lazarusidestrconsts.liscopyallshownmessagestoclipboard msgid "Copy All Shown Messages to Clipboard" msgstr "Gösterilen tüm mesajları Pano'ya Kopyala" #: lazarusidestrconsts.liscopydescription msgid "Copy description to clipboard" msgstr "Açıklamayı panoya kopyala" #: lazarusidestrconsts.liscopyerror2 msgid "Copy error" msgstr "Kopyalama hatası" #: lazarusidestrconsts.liscopyfilename #, object-pascal-format msgid "Copy Filename %s" msgstr "Dosya adını %s kopyala" #: lazarusidestrconsts.liscopyfilenametoclipboard msgid "Copy File Name to Clipboard" msgstr "Dosya Adını Panoya Kopyala" #: lazarusidestrconsts.liscopyfilesfailed msgid "Copying files failed." msgstr "Kopyalama başarısız oldu." #: lazarusidestrconsts.liscopyidentifier #, object-pascal-format msgid "Copy \"%s\" to clipboard" msgstr "\"%s\" panoya kopyala" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "Bütün bir formun kopyalanması uygulanmıyor." #: lazarusidestrconsts.liscopyitemtoclipboard msgid "Copy Item to Clipboard" msgstr "Öğe Pano'ya Kopyala" #: lazarusidestrconsts.liscopymovefiletodirectory msgid "Copy/Move File to Directory" msgstr "Dosyayı Dizine Kopyala / Taşı" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy Selected Items to Clipboard" msgstr "Seçili Öğeleri Panoya Kopyala" #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy Selected Messages to Clipboard" msgstr "Seçili İletileri Panoya Kopyala" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "FPC mesajları tara" #: lazarusidestrconsts.liscoscanformakemessages msgid "Scan for Make messages" msgstr "Make Mesajları için tara" #: lazarusidestrconsts.liscoskipcallingcompiler msgid "Skip calling compiler" msgstr "Çağıran derleyiciyi atla" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Uyarı: Ek derleyici yapılandırma dosyası, Free Pascal derleyicisinin aradığı standart yapılandırma dosya adlarından biriyle aynı ada sahiptir. Bu, SADECE ek yapılandırmanın ayrıştırılmasına ve standart yapılandırmanın atlanmasına neden olabilir." #: lazarusidestrconsts.liscpopenpackage #, object-pascal-format msgid "Open Package %s" msgstr "Paketi aç %s" #: lazarusidestrconsts.liscpopenunit #, object-pascal-format msgid "Open Unit %s" msgstr "Birimi aç %s" #: lazarusidestrconsts.liscpu #, object-pascal-format msgid ", CPU: %s" msgstr ", CPU: %s" #: lazarusidestrconsts.liscreateandedit msgid "Create and edit" msgstr "Oluştur ve düzenle" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" msgstr "Önce bir proje oluştur!" #: lazarusidestrconsts.liscreatedebugandreleasemodes msgid "Create Debug and Release modes" msgstr "Hata ayıklama ve çıkış modları oluştur" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" msgstr "Dizin oluşturulsun mu?" #: lazarusidestrconsts.liscreatefilter msgid "Create Filter" msgstr "Filtre Oluştur" #: lazarusidestrconsts.liscreatefppkgconfig msgid "Restore Fppkg configuration" msgstr "Fppkg yapılandırmasını geri yükle" #: lazarusidestrconsts.liscreatefunction msgid "Create function" msgstr "Fonksiyon oluştur" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" msgstr "Yardım oluştur düğüm" #: lazarusidestrconsts.liscreateit msgid "Create it" msgstr "Oluştur" #: lazarusidestrconsts.liscreatelocalvariable #, object-pascal-format msgid "Create local variable \"%s\"" msgstr "Yerel değişken \"%s\" oluştur" #: lazarusidestrconsts.liscreatenewaddition msgid "Create new addition" msgstr "Yeni ek oluştur" #: lazarusidestrconsts.liscreatenewpackage msgid "(Create new package)" msgstr "(Yeni paket oluştur)" #: lazarusidestrconsts.liscreatenewpackagecomponent msgid "Create new package component" msgstr "Yeni paket bileşeni oluştur" #: lazarusidestrconsts.liscreateproject msgid "Create project" msgstr "Proje oluştur" #: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile msgid "Create/update .po file when saving a lfm file" msgstr "Bir lfm dosyası kaydederken .po dosyası oluştur/güncelle" #: lazarusidestrconsts.liscreatingfileindexoffpcsources #, object-pascal-format msgid "Creating file index of FPC sources %s ..." msgstr "FPC kaynaklarının dosya dizini oluşturuluyor %s ..." #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" msgstr "Dizin Seç" #: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "Kod Araçları Dizin Değerleri" #: lazarusidestrconsts.lisctdefdefinetemplates msgid "Define templates" msgstr "Şablonları tanımla" #: lazarusidestrconsts.lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts.lisctdefsopenpreview msgid "Open Preview" msgstr "Önizlemeyi Aç" #: lazarusidestrconsts.lisctdefstools msgid "Tools" msgstr "Araçlar" #: lazarusidestrconsts.lisctdefvariable #, object-pascal-format msgid "Variable: %s" msgstr "Değişken: %s" #: lazarusidestrconsts.lisctdefvariablename msgid "Variable Name" msgstr "Değişken Adı" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" msgstr "Şablonlar" #: lazarusidestrconsts.lisctoupdateallmethodsignatures msgid "Update all method signatures" msgstr "Tüm yöntem imzalarını güncelle" #: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures msgid "Update multiple procedure signatures" msgstr "Birden çok prosedür imzasını güncelle" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" msgstr "lütfen bir makro seçin" #: lazarusidestrconsts.lisctselectcodemacro msgid "Select Code Macro" msgstr "Kod Makrosu Seç" #: lazarusidestrconsts.liscurrentlclwidgetset #, object-pascal-format msgid "Current LCL widgetset: \"%s\"" msgstr "Geçerli LCL widget'ları: \"%s\"" #: lazarusidestrconsts.liscurrentstate msgid "Current state: " msgstr "Mevcut durum: " #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Geçerli düzenleyicideki imleç sütunu" #: lazarusidestrconsts.liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "Geçerli düzenleyicideki imleç satırı" #: lazarusidestrconsts.liscustomopthint msgid "These options are passed to the compiler after macros are replaced." msgstr "Bu seçenekler makrolar değiştirildikten sonra derleyiciye aktarılır." #: lazarusidestrconsts.liscustomoptions msgid "custom options" msgstr "özel seçenekler" #: lazarusidestrconsts.liscustomoptions2 msgid "Custom options" msgstr "Özel seçenekler" #: lazarusidestrconsts.liscustomoptions3 msgid "Custom Options" msgstr "Özel Seçenekler" #: lazarusidestrconsts.liscustomprogram msgid "Custom Program" msgstr "Özel Program" #: lazarusidestrconsts.liscustomprogramprogramdescriptor msgid "A Custom Free Pascal program." msgstr "Özel Free Pascal programı." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" msgstr "Veri modülü" #: lazarusidestrconsts.lisdbgenbreakpointevaluation msgid "Breakpoint Evaluation" msgstr "Kesme noktası değerlendirmesi" #: lazarusidestrconsts.lisdbgenbreakpointhit msgid "Breakpoint Hit" msgstr "Kesme Noktası Vuruşu" #: lazarusidestrconsts.lisdbgenbreakpointmessage msgid "Breakpoint Message" msgstr "Kesme Mesaj" #: lazarusidestrconsts.lisdbgenbreakpointstackdump msgid "Breakpoint Stack Dump" msgstr "Kesme Noktası Yığın Dökümü" #: lazarusidestrconsts.lisdbgendefaultcolor msgid "Default Color" msgstr "Varsayılan Renk" #: lazarusidestrconsts.lisdbgenexceptionraised msgid "Exception Raised" msgstr "İstisna Yükseltildi" #: lazarusidestrconsts.lisdbgenmoduleload msgid "Module Load" msgstr "Modül Yükle" #: lazarusidestrconsts.lisdbgenmoduleunload msgid "Module Unload" msgstr "Modül Kaldır" #: lazarusidestrconsts.lisdbgenoutputdebugstring msgid "Output Debug String" msgstr "Hata Ayıklama String Çıktısı" #: lazarusidestrconsts.lisdbgenprocessexit msgid "Process Exit" msgstr "İşlem Çıkışı" #: lazarusidestrconsts.lisdbgenprocessstart msgid "Process Start" msgstr "Süreç Başlat" #: lazarusidestrconsts.lisdbgenthreadexit msgid "Thread Exit" msgstr "Thread Çıkışı" #: lazarusidestrconsts.lisdbgenthreadstart msgid "Thread Start" msgstr "Thread Başlat" #: lazarusidestrconsts.lisdbgenwindowsmessageposted msgid "Windows Message Posted" msgstr "Windows Mesajı Gönderildi" #: lazarusidestrconsts.lisdbgenwindowsmessagesent msgid "Windows Message Sent" msgstr "Windows Mesajı Gönderildi" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "Belirtilen hata ayıklayıcı yok" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "Kesme noktasını yine de ayarla" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno #, object-pascal-format msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu." msgstr "Belirtilmiş bir hata ayıklayıcı yok.%sMenüdeki hata ayıklayıcı seçenekleri iletişim kutusunda bir Hata Ayıklayıcı ayarlayana kadar kesme noktalarının ayarlanmasının hiçbir etkisi yoktur." #: lazarusidestrconsts.lisdebug msgctxt "lazarusidestrconsts.lisdebug" msgid "Debug" msgstr "Hata ayıklama" #: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks msgid "Confirm to delete all Breakpoints" msgstr "Tüm Kesme Noktalarını silmek için onaylayın" #: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile msgid "Confirm to delete Breakpoints in same file" msgstr "Aynı dosyadaki Kesme Noktalarını silmek için onaylayın" #: lazarusidestrconsts.lisdebugdialogconfirmdelhistory msgid "Confirm to clear History" msgstr "Geçmişi temizlemek için onaylayın" #: lazarusidestrconsts.lisdebugdialogconfirmdelwatches msgid "Confirm to delete all Watches" msgstr "Tüm izlemeleri silmek için onaylayın" #: lazarusidestrconsts.lisdebugger msgctxt "lazarusidestrconsts.lisdebugger" msgid "Debugger" msgstr "Hata ayıklayıcı" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate #, object-pascal-format msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session." msgstr "Hata ayıklayıcı dahili bir hatayla karşılaştı.%0:s%0:sÇalışmanızı kaydedin.%0:sDaha sonra hata ayıklama oturumunu sonlandırmak için \"Durdur\" veya \"Hata ayıklayıcıyı sıfırla\" düğmesine basabilirsiniz." #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" msgstr "Geçersiz Hata ayıklayıcı" #: lazarusidestrconsts.lisdebugging #, object-pascal-format msgid "%s (debugging ...)" msgstr "%s (hata ayıklanıyor ...)" #: lazarusidestrconsts.lisdebughintautotypecastclass msgid "Automatic typecast for objects" msgstr "Nesneler için otomatik tip analizi" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" msgstr "İstisna Ekle" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Ek arama yolu" #: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls msgid "BETA: Allow function calls in watches (if supported by backend)" msgstr "BETA: Eşleşmelerde fonksiyon çağrılarına izin ver (arka uç tarafından destekleniyorsa)" #: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm msgid "Automatically close the assembler window, after source not found" msgstr "Kaynak bulunamadıktan sonra assembler penceresini otomatik olarak kapatın" #: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass msgid "Automatically set \"use instance class type\" for new watches" msgstr "Yeni eşleşmelerde için \"örnek sınıfı türünü kullan\"ı otomatik olarak ayarla" #: lazarusidestrconsts.lisdebugoptionsfrmbackend msgid "Debugger backend" msgstr "Hata ayıklayıcı arka ucu" #: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Kırılma noktası" #: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Çalıştırma günlüğü temizle" #: lazarusidestrconsts.lisdebugoptionsfrmdebugger msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" msgid "Debugger" msgstr "Hata ayıklayıcı" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend msgid "Debugger Backend:" msgstr "Hata ayıklayıcı arka ucu:" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings msgid "Debugger dialogs" msgstr "Hata ayıklayıcı diyalogları" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Genel Hata ayıklayıcı seçenekleri" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "Hata ayıklayıcıya özgü seçenekler (hata ayıklayıcı türüne bağlıdır)" #: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront msgid "Always bring debug-windows (watches, locals) to front when adding items" msgstr "Öğe eklerken her zaman hata ayıklama pencerelerini (saatler, yereller) öne getirin" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" msgstr "İstisna adı çoğalt" #: lazarusidestrconsts.lisdebugoptionsfrmeditclass msgid "Change type" msgstr "Tür Değiştir" #: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type." msgstr "Geçerli hata ayıklayıcı arka ucunun türünü değiştirme. Yeni bir türle yeni bir arka uç oluşturmak için \"Ekle\" veya \"Kopyala\"yı kullanın." #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" msgstr "İstisnanın adını gir" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" msgid "Event Log" msgstr "Olay günlüğü" #: lazarusidestrconsts.lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "Tarafından işlenir" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "Hata Ayıklayıcı Tarafından işlenir" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "Program tarafından işlenir" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "Bu istisnaları yoksay" #: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "Dil İstisnaları" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto msgid "Limit line count to" msgstr "Satır sayısını sınırla" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" msgstr "Modül" #: lazarusidestrconsts.lisdebugoptionsfrmname msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" msgid "Name:" msgstr "Ad:" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Exceptions" msgstr "Lazarus İstisnalarına Haber Verin" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "İşletim Sistemi İstisnaları" #: lazarusidestrconsts.lisdebugoptionsfrmoutput msgid "Output" msgstr "Çıktı" #: lazarusidestrconsts.lisdebugoptionsfrmprocess msgid "Process" msgstr "Süreç" #: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun msgid "Reset Debugger after each run" msgstr "Her çalıştırmadan sonra hata ayıklayıcıyı sıfırla" #: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop msgid "Show message on stop with Error (Exit-code <> 0)" msgstr "Hata ile durdurma mesajını göster (Çıkış kodu <> 0)" #: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "Durduğunda mesaj göster" #: lazarusidestrconsts.lisdebugoptionsfrmsignals msgid "Signals" msgstr "Sinyaller" #: lazarusidestrconsts.lisdebugoptionsfrmthread msgid "Thread" msgstr "Thread" #: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke #, object-pascal-format msgid "Unknown Debugger backend \"%s\"" msgstr "Bilinmeyen Hata Ayıklama arka ucu \"%s\"" #: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors msgid "Use event log colors" msgstr "Olay günlüğü renklerini kullan" #: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger msgid "-- Use IDE default Debugger --" msgstr "-- IDE varsayılan Hata Ayıklama kullan --" #: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger msgid "-- Use project Debugger --" msgstr "-- Proje Hata Ayıklayıcısını Kullan --" #: lazarusidestrconsts.lisdebugoptionsfrmwindows msgid "Windows" msgstr "Windows" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" msgstr "Dosya yüklenemiyor" #: lazarusidestrconsts.lisdebugunabletoloadfile2 #, object-pascal-format msgid "Unable to load file \"%s\"." msgstr "Dosya \"%s\" yüklenemedi." #: lazarusidestrconsts.lisdefault msgctxt "lazarusidestrconsts.lisdefault" msgid "Default" msgstr "Varsayılan" #: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl msgid "Default class visibility section of new methods. For example code completion on OnShow:=" msgstr "Yeni yöntemlerin varsayılan sınıf görünürlüğü bölümü. Örneğin OnShow'da kod tamamlama:=" #: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse msgid "The default is ComboBox with \"True\" and \"False\" selections" msgstr "Varsayılan, \"Doğru\" ve \"Yanlış\" seçimleri olan ComboBox'tur" #: lazarusidestrconsts.lisdefaultplaceholder msgid "(default)" msgstr "(varsayılan)" #: lazarusidestrconsts.lisdefaultsectionofmethods msgid "Default section of methods" msgstr "Yöntemlerin varsayılan bölümü" #: lazarusidestrconsts.lisdelayforcompletionbox msgid "Delay for completion box" msgstr "Tamamlama kutusu gecikmesi" #: lazarusidestrconsts.lisdelayforcompletionlonglinehint msgid "Delay for long line hints in completion box" msgstr "Tamamlama kutusundaki uzun satır ipuçları için gecikme" #: lazarusidestrconsts.lisdelayforhints msgid "Delay for hints" msgstr "İpucu geçikmesi" #: lazarusidestrconsts.lisdelete2 msgid "Delete?" msgstr "Sil?" #: lazarusidestrconsts.lisdeleteaddition #, object-pascal-format msgid "Delete addition \"%s\"?" msgstr "\"%s\" ek silinsin mi?" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" msgstr "&Hepsini sil" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Tüm dosyalar silinsin mi?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "Belirsiz dosya silinsin mi?" #: lazarusidestrconsts.lisdeletemacro #, object-pascal-format msgid "Delete macro \"%s\"?" msgstr "Makro silinsin mi \"%s\"?" #: lazarusidestrconsts.lisdeletemode #, object-pascal-format msgid "Delete mode \"%s\"" msgstr "Modu sil \"%s\"" #: lazarusidestrconsts.lisdeleteoldfile #, object-pascal-format msgid "Delete old file \"%s\"?" msgstr "Eski dosyayı sil \"%s\"?" #: lazarusidestrconsts.lisdeleteselectedmacro msgid "Delete selected macro?" msgstr "Seçili makro silinsin mi?" #: lazarusidestrconsts.lisdeletethisaddition msgid "Delete this addition" msgstr "Bu eklemeyi sil" #: lazarusidestrconsts.lisdeletevalue #, object-pascal-format msgid "Delete value \"%s\"?" msgstr "%s değeri silinsin mi?" #: lazarusidestrconsts.lisdeletevalue2 #, object-pascal-format msgid "Delete value %s" msgstr "%s değerini sil" #: lazarusidestrconsts.lisdelimiterissemicolon msgid "Delimiter is semicolon." msgstr "Sınırlayıcı noktalı virgüldür." #: lazarusidestrconsts.lisdelphicompatibleresources msgid "Delphi compatible resources. Recommended." msgstr "Delphi uyumlu kaynaklar. Önerilir." #: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project." msgstr "\"Tasarım zamanı\" paketleri, IDE'ye bileşenler ve menü öğeleri ekler. Projeler tarafından kullanılabilirler ancak projede derlenmezler. Derleyici projeyi derlerken bu paketin birimlerini bulamaz." #: lazarusidestrconsts.lisdesktops msgid "Desktops ..." msgstr "Masaüstleri..." #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" msgstr "Hedef klasör" #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" msgstr "Destructor kodu" #: lazarusidestrconsts.lisdfileswererenamedtol #, object-pascal-format msgid "%d files were renamed to lowercase." msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "Büyük/Küçük Harfe Duyarlı" #: lazarusidestrconsts.lisdiffdlgfile1 msgid "File1" msgstr "Dosya1" #: lazarusidestrconsts.lisdiffdlgfile2 msgid "File2" msgstr "Dosya2" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "Boş satırların eklenip eklenmediğini veya kaldırıldığını yoksay" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "Satır sonlarındaki farkı yok sayın (ör. # 10 = # 13 # 10)" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "Boşluk karakterlerinin miktarını yoksay" #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "Boşlukları yoksay (satırsonu karakterleri dahil değil)" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "Satırın sonundaki boşlukları yoksay" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "Satırın başındaki boşlukları yoksay" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" msgstr "Sadece seçilen" #: lazarusidestrconsts.lisdiffdlgopendiffineditor msgid "Open difference in editor" msgstr "Farklı Editörde aç" #: lazarusidestrconsts.lisdifferentunitfoundatnewposition #, object-pascal-format msgid "different unit %s found at new position \"%s\"" msgstr "farklı birim %s yeni \"%s\" konumunda bulundu" #: lazarusidestrconsts.lisdirectives msgid "Directives" msgstr "Direktifler" #: lazarusidestrconsts.lisdirectivesfornewunit msgid "Directives for new unit" msgstr "Yeni birim için direktifler" #: lazarusidestrconsts.lisdirectories msgid "Directories" msgstr "Dizinler" #: lazarusidestrconsts.lisdirectory msgid "Directory: " msgstr "Dizin: " #: lazarusidestrconsts.lisdirectorynotfound #, object-pascal-format msgid "Directory \"%s\" not found." msgstr "Dizin \"%s\" bulunamadı." #: lazarusidestrconsts.lisdirectorynotfound2 #, object-pascal-format msgid "directory %s not found" msgstr "dizin %s bulunamadı" #: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles msgid "Directory where the IDE puts the .po files" msgstr "IDE'nin .po dosyalarını koyduğu dizin" #: lazarusidestrconsts.lisdisablei18nforlfm msgid "Disable I18N for LFM" msgstr "LFM için I18N'yi devre dışı bırak" #: lazarusidestrconsts.lisdisableoptionxg msgid "Disable Option -Xg?" msgstr "-Xg Seçeneğini Devre Dışı Bırak?" #: lazarusidestrconsts.lisdisableoptionxg2 msgid "Disable option -Xg" msgstr "-Xg Seçeneğini Devre Dışı Bırak" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" msgstr "Değişiklikleri gözardı et" #: lazarusidestrconsts.lisdiscardchangesall msgid "Discard all changes" msgstr "Tüm değişiklikleri gözardı et" #: lazarusidestrconsts.lisdiscardchangesandopenproject msgid "Discard changes and open project" msgstr "Değişiklikleri sil ve projeyi aç" #: lazarusidestrconsts.lisdiscardchangesandquit msgid "Discard changes and quit" msgstr "Değişiklikleri sil ve çık" #: lazarusidestrconsts.lisdiscardchangescreatenewproject msgid "Discard changes, create new project" msgstr "Değişiklikleri sil, yeni proje oluştur" #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Farkı görmek için yukarıdaki öğelerden birini tıklayın" #: lazarusidestrconsts.lisdiskdifferrorreadingfile #, object-pascal-format msgid "Error reading file: %s" msgstr "Dosya okunurken hata oluştu: %s" #: lazarusidestrconsts.lisdiskdiffignorealldiskchanges msgid "Ignore all disk changes" msgstr "Tüm değişiklikleri yoksay" #: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk msgid "Reload checked files from disk" msgstr "Kontrol edilen dosyaları diskten yeniden yükle" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "Bazı dosyalarda değişiklik yapıldı:" #: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges msgid "Some files have local changes. Either local or external changes will be overwritten." msgstr "Bazı dosyalar yerel değişikliklere sahiptir. Yerel veya harici değişikliklerin üzerine yazılacaktır." #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Büyük ve küçük harfleri ayırt et, örn. A ve a" #: lazarusidestrconsts.lisdlgalloptions msgid "All options ..." msgstr "Tüm seçenekler ..." #: lazarusidestrconsts.lisdlgchangeclass msgid "Change Class ..." msgstr "Sınıf değiştir ..." #: lazarusidestrconsts.lisdlgdefines msgid "Defines ..." msgstr "Tanımlar ..." #: lazarusidestrconsts.lisdlgedit msgctxt "lazarusidestrconsts.lisdlgedit" msgid "Edit ..." msgstr "Düzen ..." #: lazarusidestrconsts.lisdlgexport msgctxt "lazarusidestrconsts.lisdlgexport" msgid "Export ..." msgstr "Dışa Aktar ..." #: lazarusidestrconsts.lisdlgimport msgctxt "lazarusidestrconsts.lisdlgimport" msgid "Import ..." msgstr "İçe aktar ..." #: lazarusidestrconsts.lisdlgmore msgctxt "lazarusidestrconsts.lisdlgmore" msgid "More ..." msgstr "Daha fazla..." #: lazarusidestrconsts.lisdlgopen msgctxt "lazarusidestrconsts.lisdlgopen" msgid "Open ..." msgstr "Aç ..." #: lazarusidestrconsts.lisdoesnotexists #, object-pascal-format msgid "%s does not exist: %s" msgstr "%s yok: %s" #: lazarusidestrconsts.lisdonotchange msgid "Do not change" msgstr "Değiştirme" #: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning msgid "Do not check if another IDE instance is already running." msgstr "Başka bir IDE örneğinin zaten çalışıp çalışmadığını kontrol etmeyin." #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" msgstr "Projeyi kapatma" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "Do not compile dependencies." msgstr "Bağımlılıkları derlemeyin." #: lazarusidestrconsts.lisdonotshowsplashscreen msgid "Do not show splash screen." msgstr "Açılış ekranı gösterme." #: lazarusidestrconsts.lisdonotshowthisdialogforthisproject msgid "Do not show this dialog for this project" msgstr "Bu iletişim kutusunu bu proje için gösterme" #: lazarusidestrconsts.lisdonotshowthismessageagain msgid "Do not show this message again" msgstr "Bu mesajı tekrar gösterme" #: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured." msgstr "Derlemeden sonra güncellenmiş proje bilgi dosyasını yazmayın. Belirtilmezse, yapılandırılırsa yapı numarası artırılır." #: lazarusidestrconsts.lisdonwloadonlinepackages #, object-pascal-format msgid "" "The following package(s) are not available locally: %s.\n" "In order to install it, you must download them first. Download now?" msgstr "" "Aşağıdaki paket(ler) yerel olarak mevcut değil: %s.\n" "Yüklemek için önce onları indirmelisiniz. Şimdi indireyim mi?" #: lazarusidestrconsts.lisdown msgctxt "lazarusidestrconsts.lisdown" msgid "Down" msgstr "Aşağı" #: lazarusidestrconsts.lisdowngrade msgid "Downgrade" msgstr "Düşürme" #: lazarusidestrconsts.lisdowngradeconfiguration msgid "Downgrade configuration" msgstr "Düşen konfigürasyon" #: lazarusidestrconsts.lisdownload msgid "Download" msgstr "İndir" #: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject msgid "Do you still want to create the new project?" msgstr "Hala yeni proje oluşturmak istiyor musunuz?" #: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject msgid "Do you still want to open another project?" msgstr "Yine de başka bir proje açmak istiyor musunuz?" #: lazarusidestrconsts.lisdoyoustillwanttoquit msgid "Do you still want to quit?" msgstr "Hala ayrılmak istiyor musun?" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" msgstr "Izgara çizgileri çiz" #: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing." msgstr "Mesajlar penceresinin odağı olmasa bile seçimi odaklanmış olarak çizin. Temanızda zar zor görünen odaklanmamış bir çizim varsa bunu kullanın." #: lazarusidestrconsts.lisdropdowncount msgid "Drop Down Count" msgstr "Aşağı açılır sayısı" #: lazarusidestrconsts.lisdropdowncounthint msgid "Used for all ComboBoxes in IDE dialogs" msgstr "IDE diyalog pencerelerindeki tüm ComboBox'lar için kullanılır" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Seçilen bileşenleri panoya kopyala" #: lazarusidestrconsts.lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Seçilen bileşenleri panoya kopyala" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" msgstr "Bileşeni bir geriye taşıyın" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" msgstr "Bileşeni bir ileriye taşıyın" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" msgstr "Bileşeni arkaya taşı" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" msgstr "Bileşeni öne taşıyın" #: lazarusidestrconsts.lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Seçilen bileşenleri panodan yapıştırın" #: lazarusidestrconsts.lisdsgselectparentcomponent msgid "Select parent component" msgstr "Üst bileşen seç" #: lazarusidestrconsts.lisdsgshownonvisualcomponents msgid "Show nonvisual components" msgstr "Görsel olmayan bileşenleri göster" #: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents msgid "Toggle showing nonvisual components" msgstr "Görsel olmayan bileşenleri göstermeyi Aç/Kapat" #: lazarusidestrconsts.lisduplicate msgid "Duplicate" msgstr "Aynı" #: lazarusidestrconsts.lisduplicateentry msgid "Duplicate entry" msgstr "Yinelenen giriş" #: lazarusidestrconsts.lisduplicatefilename msgid "Duplicate File Name" msgstr "Yinelenen Dosya Adı" #: lazarusidestrconsts.lisduplicatefoundofvalue #, object-pascal-format msgid "Duplicate found of value \"%s\"." msgstr "Yinelenen değer \"%s\" bulundu." #: lazarusidestrconsts.lisduplicatemodename #, object-pascal-format msgid "Mode \"%s\" is already present in the list." msgstr "\"%s\" modu listede zaten var." #: lazarusidestrconsts.lisduplicatename msgid "Duplicate Name" msgstr "Yinelenen ad" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe #, object-pascal-format msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" msgstr "Yinelenen ad: \"%s\" adlı bir bileşen, devralınan bileşen %s içinde zaten var" #: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "Yinelenen ppu dosyaları. Birini silin veya tüm arama yollarının doğru sırada olduğundan emin olun (İpucu: FPC önce son yolu kullanır)." #: lazarusidestrconsts.lisduplicatesearchpath msgid "Duplicate search path" msgstr "Arama yolunu çoğalt" #: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "Yinelenen kaynaklar. Birini silin veya tüm arama yollarının doğru sırada olduğundan emin olun (İpucu: FPC önce son yolu kullanır)." #: lazarusidestrconsts.lisduplicateunit msgid "Duplicate Unit" msgstr "Birim Çoğalt" #: lazarusidestrconsts.lisduplicateunitin #, object-pascal-format msgid "Duplicate unit \"%s\" in \"%s\"" msgstr "\"%s\" ile \"%s\" aynı birim" #: lazarusidestrconsts.lisdynpkgamounttoscrollin msgid "Amount to scroll in" msgstr "Kaydırılacak miktar" #: lazarusidestrconsts.lisdynpkgamounttoscrollin2 msgid "Amount to scroll in (%)" msgstr "Kaydırılacak miktar (%)" #: lazarusidestrconsts.lisdynpkgamounttoscrollinmax msgid "Amount to scroll in (Max)" msgstr "Kaydırılacak miktar (Maks)" #: lazarusidestrconsts.lisdynpkgautoscrollondeletepa msgid "Auto Scroll on delete past left border" msgstr "Sol kenarlığı silerken Otomatik Kaydırma" #: lazarusidestrconsts.lisdynpkgautoscrollontypepast msgid "Auto Scroll on type past right border" msgstr "Sağ kenarlığı geçtikten sonra otomatik kaydırma" #: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw msgid "Trigger on min chars (% of width)" msgstr "Minimum karakterlerde tetikleme (genişliğin %'si)" #: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis msgid "Trigger on min chars visible" msgstr "Görünür minimum karakterlerde tetikleme" #: lazarusidestrconsts.lisedit msgctxt "lazarusidestrconsts.lisedit" msgid "Edit" msgstr "Düzen" #: lazarusidestrconsts.liseditadditionalhelpformessages msgid "Edit additional help for messages" msgstr "Mesajlar için ek yardım düzenleme" #: lazarusidestrconsts.liseditbuildmodes msgid "Edit build modes" msgstr "Yapı modlarını düzenleme" #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" msgstr "Bağlam yardımını düzenle" #: lazarusidestrconsts.lisedithelp msgid "Edit help" msgstr "Yardım düzenle" #: lazarusidestrconsts.liseditkey msgid "Edit Key" msgstr "Tuş Düzenle" #: lazarusidestrconsts.liseditorcolors msgid "Editor Colors" msgstr "Editör Renkleri" #: lazarusidestrconsts.liseditormacros msgctxt "lazarusidestrconsts.liseditormacros" msgid "Editor Macros" msgstr "Editör makroları" #: lazarusidestrconsts.liseditortoolbar msgid "Editor ToolBar" msgstr "Editör Araç Çubuğu" #: lazarusidestrconsts.liseditortoolbarsettings msgid "Editor Toolbar Settings" msgstr "Editör Araç Çubuğu Ayarları" #: lazarusidestrconsts.liseditortoolbarvisible msgid "Editor Toolbar is &visible" msgstr "Editör &Araç Çubuğu görünsün" #: lazarusidestrconsts.lisedoptsloadascheme msgid "Load a scheme" msgstr "Bir şema yükle" #: lazarusidestrconsts.lisedtdefcurrentproject msgid "Current Project" msgstr "Mevcut Proje" #: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Geçerli bir araç en az bir başlık ve bir dosya adı gerekiyor." #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" msgstr "Aracı Düzenle" #: lazarusidestrconsts.lisedtexttoolkey msgctxt "lazarusidestrconsts.lisedtexttoolkey" msgid "Key" msgstr "Tuş" #: lazarusidestrconsts.lisedtexttoolmacros msgctxt "lazarusidestrconsts.lisedtexttoolmacros" msgid "Macros" msgstr "Makro" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" msgstr "Parametreler:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Program Adı:" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for FPC messages" msgstr "Free Pascal Derleyici mesajları için tarama çıktısı" #: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages msgid "Scan output for \"make\" messages" msgstr "Make mesajları için tarama çıktısı" #: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Başlık ve Dosya Adı Gerekli" #: lazarusidestrconsts.lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Çalışma dizini:" #: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")" msgstr "Mesaj önceliğini her zaman gösterecek şekilde yükseltin (varsayılan olarak düşük öncelikli \" ayrıntılı \\ \")" #: lazarusidestrconsts.lisemdall msgctxt "lazarusidestrconsts.lisemdall" msgid "All" msgstr "Tümü" #: lazarusidestrconsts.lisemdemptymethods msgctxt "lazarusidestrconsts.lisemdemptymethods" msgid "Empty Methods" msgstr "Boş Yöntemler" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" msgstr "Bulunan boş metodlar:" #: lazarusidestrconsts.lisemdnoclass msgid "No class" msgstr "Sınıf yok" #: lazarusidestrconsts.lisemdnoclassat #, object-pascal-format msgid "No class at %s(%s,%s)" msgstr "Sınıf %s yok (%s,%s)" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" msgstr "Sadece Published" #: lazarusidestrconsts.lisemdpublic msgid "Public" msgstr "Halka açık" #: lazarusidestrconsts.lisemdpublished msgid "Published" msgstr "Published" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" msgstr "Metodları kaldır" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "Bu sınıf bölümlerinde ara:" #: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause #, object-pascal-format msgid "Unable to show empty methods of the current class, because%s%s" msgstr "Geçerli sınıfın boş yöntemleri gösterilemiyor, çünkü%s%s" #: lazarusidestrconsts.lisempty msgid "Empty" msgstr "Boş" #: lazarusidestrconsts.lisemptydestinationforpublishing msgid "Destination directory for publishing is either a relative path or empty." msgstr "Yayımlama için hedef dizin göreceli bir yoldur veya boştur." #: lazarusidestrconsts.lisenabledonlyforpackages msgid "Enabled only for packages." msgstr "Sadece paketler için etkin." #: lazarusidestrconsts.lisenableflaguseunitofunitinpackage #, object-pascal-format msgid ". Enable flag \"Use Unit\" of unit %s in package %s" msgstr ". Paket %s içindeki %s birimi \" Birimi kullan\" bayrağını etkinleştir" #: lazarusidestrconsts.lisenablei18nforlfm msgid "Enable I18N for LFM" msgstr "LFM için I18N'yi etkinleştir" #: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport msgid "Enable internationalization and translation support" msgstr "Uluslararasılaştırma ve çeviri desteğini etkinleştir" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" msgstr "Makroları Etkinleştir" #: lazarusidestrconsts.lisenableoptiondwarf2 msgid "Enable Dwarf 2 (-gw)" msgstr "(-gw) Dwarf 2 aktifleştir" #: lazarusidestrconsts.lisenableoptiondwarf2sets msgid "Enable Dwarf 2 with sets" msgstr "Ayarlarla Dwarf 2 aktifleştir" #: lazarusidestrconsts.lisenableoptiondwarf3 msgid "Enable Dwarf 3 (-gw3)" msgstr "(-gw3) Dwarf 3 etkinleştir" #: lazarusidestrconsts.lisenableoptionxg msgid "Enable Option -Xg?" msgstr "-Xg seçeneğini etkinleştir?" #: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier" msgstr "Etkinleştir = Return'e basılması tüm tanımlayıcının yerini alır ve Shift+Return öneki değiştirir, Disable = Return'e basıldığında önek değiştirilir ve Shift+Return tüm tanımlayıcının yerini alır" #: lazarusidestrconsts.lisencloseinifdef msgid "Enclose in $IFDEF" msgstr "$IFDEF içine al" #: lazarusidestrconsts.lisencodingnumberoffilesfailed #, object-pascal-format msgid "Number of files failed to convert: %d" msgstr "Dönüştürülemeyen dosya sayısı: %d" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis #, object-pascal-format msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." msgstr "Diskteki \"%s\"%s dosyasının kodlaması%s. Yeni kodlama%s." #: lazarusidestrconsts.lisenternewnameformacros #, object-pascal-format msgid "Enter new name for Macro \"%s\"" msgstr "Makro için \"%s\"\" yeni ad girin" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" msgstr "Ortam değişkeni, parametrenin adı" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "Geçersiz hata ayıklayıcı dosya adı" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg #, object-pascal-format msgid "The debugger file \"%s\" is not an executable." msgstr "\"%s\" hata ayıklayıcı dosyası yürütülebilir değildir." #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg #, object-pascal-format msgid "Test directory \"%s\" not found." msgstr "Test dizini \"%s\" bulunamadı." #: lazarusidestrconsts.liserrinvalidoption #, object-pascal-format msgid "Invalid option at position %d: \"%s\"" msgstr "%d konumundaki geçersiz seçenek: \"%s\"" #: lazarusidestrconsts.liserrnooptionallowed #, object-pascal-format msgid "Option at position %d does not allow an argument: %s" msgstr "%d konumundaki seçenek bir bağımsız değişkene izin vermiyor: %s" #: lazarusidestrconsts.liserroptionneeded #, object-pascal-format msgid "Option at position %d needs an argument : %s" msgstr "%d konumundaki seçeneğin bir bağımsız değişkene ihtiyacı var: %s" #: lazarusidestrconsts.liserror msgid "Error: " msgstr "Hata: " #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" msgstr "Dosya oluşturulurken hata oluştu" #: lazarusidestrconsts.liserrordeletingfile msgid "Error deleting file" msgstr "Dosya silinirken hata oluştu" #: lazarusidestrconsts.liserrorin #, object-pascal-format msgid "Error in %s" msgstr "%s hatası" #: lazarusidestrconsts.liserrorinthecompilerfilename msgid "Error in the compiler file name:" msgstr "Derleyici dosya adında hata:" #: lazarusidestrconsts.liserrorinthecustomcompileroptionsother msgid "Error in the custom compiler options (Other):" msgstr "Özel derleyici seçeneklerinde hata (Diğer):" #: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):" msgstr "Özel bağlayıcı seçeneklerinde hata (Derleyiciye derleme ve Bağlama/Geçiş seçenekleri):" #: lazarusidestrconsts.liserrorinthedebuggerpathaddition msgid "Error in the \"Debugger path addition\":" msgstr "\"Hata ayıklayıcı yolu ekinde\" hata:" #: lazarusidestrconsts.liserrorinthesearchpathforincludefiles msgid "Error in the search path for \"Include files\":" msgstr "\"Dosya ekle\" için arama yolunda hata var:" #: lazarusidestrconsts.liserrorinthesearchpathforlibraries msgid "Error in the search path for \"Libraries\":" msgstr "\"Kitaplıklar\" için arama yolunda hata:" #: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles msgid "Error in the search path for \"Object files\":" msgstr "\"Nesne dosyaları\" arama yolunda hata:" #: lazarusidestrconsts.liserrorinthesearchpathforothersources msgid "Error in the search path for \"Other sources\":" msgstr "\"Diğer kaynaklar\" arama yolunda hata:" #: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles msgid "Error in the search path for \"Other unit files\":" msgstr "\"Diğer birim dosyaları\" arama yolunda hata:" #: lazarusidestrconsts.liserrorintheunitoutputdirectory msgid "Error in the \"unit output directory\":" msgstr "\"Birim çıktı dizininde\" hata:" #: lazarusidestrconsts.liserrorinvalidbuildmode #, object-pascal-format msgid "Error: invalid build mode \"%s\"" msgstr "Hata: geçersiz derleme modu \"%s\"" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" msgstr "Dosya yüklenirken hata oluştu" #: lazarusidestrconsts.liserrorloadingfile2 #, object-pascal-format msgid "Error loading file \"%s\":" msgstr "\"%s\" dosyasını yüklerken hata oluştu:" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" msgstr "Bileşeni hareket ettirirken hata oluştu" #: lazarusidestrconsts.liserrormovingcomponent2 #, object-pascal-format msgid "Error moving component %s:%s" msgstr "%s bileşenini taşıma hatası: %s" #: lazarusidestrconsts.liserrornamingcomponent msgid "Error naming component" msgstr "Bileşen adlandırma hatası" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" msgstr "Bileşen açılırken hata oluştu" #: lazarusidestrconsts.liserroropeningform msgid "Error opening form" msgstr "Form açma hatası" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "Lfm bileşen akışının ayrıştırılması sırasında hata oluştu." #: lazarusidestrconsts.liserrorreadingpackagelistfromfile #, object-pascal-format msgid "Error reading package list from file%s%s%s%s" msgstr "%s%s%s%s dosyasından paket listesi okunurken hata oluştu" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" msgstr "XML okunurken hata oluştu" #: lazarusidestrconsts.liserrorreadingxmlfile #, object-pascal-format msgid "Error reading xml file \"%s\"%s%s" msgstr "Xml dosyası okunurken hata oluştu \"%s\" %s %s" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" msgstr "Dosya yeniden adlandırılırken bir hata oluştu" #: lazarusidestrconsts.liserrors msgctxt "lazarusidestrconsts.liserrors" msgid "Errors" msgstr "Hatalar" #: lazarusidestrconsts.liserrors2 #, object-pascal-format msgid ", Errors: %s" msgstr ", Hatalar: %s" #: lazarusidestrconsts.liserrorsavingform msgid "Error saving form" msgstr "Form kaydetme hatası" #: lazarusidestrconsts.liserrorsettingthenameofacomponentto #, object-pascal-format msgid "Error setting the name of a component %s to %s" msgstr "%s bileşeninin adını %s olarak ayarlama hatası" #: lazarusidestrconsts.liserrorwritingfile #, object-pascal-format msgid "Error writing file \"%s\"" msgstr "Dosya \"%s\" yazarken hata oluştu" #: lazarusidestrconsts.liserrorwritingpackagelisttofile #, object-pascal-format msgid "Error writing package list to file%s%s%s%s" msgstr "%s %s %s %s dosyasına paket listesi yazarken hata oluştu" #: lazarusidestrconsts.liseverynthlinenumber msgid "Show every n-th line number" msgstr "Her n-satır numarasını göster." #: lazarusidestrconsts.lisexamplefile msgid "Example file:" msgstr "Örnek dosya:" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac #, object-pascal-format msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "Örnekler: %sIdentifier %sTMyEnum.Enum %sUnitname.Identifier %s # PackageName.UnitName.Identifier" #: lazarusidestrconsts.lisexclude msgid "Exclude" msgstr "Hariç" #: lazarusidestrconsts.lisexcludedatruntime #, object-pascal-format msgid "%s excluded at run time" msgstr "%s çalışma zamanında hariç tutuldu" #: lazarusidestrconsts.lisexcludesforstars msgid "Excludes for * and ** in unit and include search paths" msgstr "Birimdeki * ve ** hariç tutulur ve arama yolları dahil edilir" #: lazarusidestrconsts.lisexecutableisadirectory #, object-pascal-format msgid "executable \"%s\" is a directory" msgstr "çalıştırılabilir \"%s\" bir dizin" #: lazarusidestrconsts.lisexecutablelacksthepermissiontorun #, object-pascal-format msgid "executable \"%s\" lacks the permission to run" msgstr "çalıştırılabilir \"%s\" çalıştırılacak izin yok" #: lazarusidestrconsts.lisexecuteafter msgid "Execute After" msgstr "" #: lazarusidestrconsts.lisexecutebefore msgid "Execute Before" msgstr "" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" msgstr "Yürütme durduruldu" #: lazarusidestrconsts.lisexecutionstoppedexitcode #, object-pascal-format msgid "Execution stopped with exit-code %1:d ($%2:s)" msgstr "%1:d ($%2:s) çıkış koduyla yürütme durduruldu" #: lazarusidestrconsts.lisexit msgctxt "lazarusidestrconsts.lisexit" msgid "Exit" msgstr "Çıkış" #: lazarusidestrconsts.lisexitcode #, object-pascal-format msgid "Exit code %s" msgstr "Çıkış kodu %s" #: lazarusidestrconsts.lisexpand msgid "Expand" msgstr "Genişlet" #: lazarusidestrconsts.lisexpandall msgid "Expand All [Ctrl+Plus]" msgstr "Hepsini genişlet [Ctrl+Plus]" #: lazarusidestrconsts.lisexpandall2 msgid "Expand All" msgstr "Hepsini genişlet" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" msgstr "Tüm sınıfları genişlet" #: lazarusidestrconsts.lisexpandallpackages msgid "Expand all packages" msgstr "Tüm paketleri genişlet" #: lazarusidestrconsts.lisexpandallunits msgid "Expand all units" msgstr "Tüm birimleri genişlet" #: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "Geçerli düzenleyici dosyasının genişletilmiş dosya adı" #: lazarusidestrconsts.lisexport msgctxt "lazarusidestrconsts.lisexport" msgid "Export" msgstr "Dışa Aktar" #: lazarusidestrconsts.lisexportall msgid "Export all" msgstr "Tümünü dışa aktar" #: lazarusidestrconsts.lisexportallitemstofile msgid "Export All Items to File" msgstr "Tüm Öğeleri Dosyaya Ver" #: lazarusidestrconsts.lisexportenvironmentoptions msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" msgid "Export environment options" msgstr "Dışa aktarma ortamı seçenekleri" #: lazarusidestrconsts.lisexporthtml msgid "Export as HTML" msgstr "HTML olarak dışa aktarma" #: lazarusidestrconsts.lisexportimport msgid "Export / Import" msgstr "Dışa/İçe aktar" #: lazarusidestrconsts.lisexportpackagelistxml msgid "Export package list" msgstr "Paket listesini dışa aktar" #: lazarusidestrconsts.lisexportselected msgid "Export selected" msgstr "Seçilenleri dışa aktar" #: lazarusidestrconsts.lisexportsub msgid "Export >>" msgstr "Dışa Aktar >>" #: lazarusidestrconsts.lisextract msgid "Extract" msgstr "Çıkart" #: lazarusidestrconsts.lisextractprocedure msgctxt "lazarusidestrconsts.lisextractprocedure" msgid "Extract Procedure" msgstr "Prosedürü çıkart" #: lazarusidestrconsts.lisextraopts msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them." msgstr "" #: lazarusidestrconsts.lisextremelyverbose msgid "Extremely Verbose" msgstr "Son derece ayrıntılı" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External Tools" msgstr "Harici Araçlar" #: lazarusidestrconsts.lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "Maksimum Araçlar ulaştı" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools #, object-pascal-format msgid "There is a maximum of %s tools." msgstr "En fazla %s araç var." #: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources #, object-pascal-format msgid "Failed to add %d not unique resource(s)" msgstr "%d benzersiz kaynak (lar) eklenemedi" #: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor #, object-pascal-format msgid "Failed to create Application Bundle for \"%s\"" msgstr "\"%s\" için Uygulama Paketi oluşturulamadı." #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" msgstr "Katlama durumu yüklenemedi" #: lazarusidestrconsts.lisfailedtoresolvemacros msgid "failed to resolve macros" msgstr "makroları çözemedi" #: lazarusidestrconsts.lisfailedtosavefile msgid "Failed to save file." msgstr "Dosya kaydedilemedi." #: lazarusidestrconsts.lisfatal msgctxt "lazarusidestrconsts.lisfatal" msgid "Fatal" msgstr "Ölümcül" #: lazarusidestrconsts.lisfile msgctxt "lazarusidestrconsts.lisfile" msgid "File" msgstr "Dosya" #: lazarusidestrconsts.lisfile2 msgid "File: " msgstr "Dosya: " #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" msgstr "Programların dosya uzantıları" #: lazarusidestrconsts.lisfilefilter msgid "File filter" msgstr "Dosya filtresi" #: lazarusidestrconsts.lisfilefilters msgid "File Filters" msgstr "Dosya Filtreleri" #: lazarusidestrconsts.lisfilefiltersaddrow msgid "Add Row" msgstr "Satır ekle" #: lazarusidestrconsts.lisfilefiltersdeleterow msgid "Delete Row" msgstr "Satırı Sil" #: lazarusidestrconsts.lisfilefiltersinsertrow msgid "Insert Row" msgstr "Satır Ekle" #: lazarusidestrconsts.lisfilefiltersmask msgid "File mask" msgstr "Dosya maskesi" #: lazarusidestrconsts.lisfilefilterssetdefaults msgid "Set defaults" msgstr "Varsayılanları ayarla" #: lazarusidestrconsts.lisfilefilterstitle msgid "These are file filters that will appear in all File Open dialogs" msgstr "Bunlar, tüm Dosya Aç iletişim kutularında görünecek olan dosya filtreleridir" #: lazarusidestrconsts.lisfilefound msgid "File found" msgstr "Dosya bulundu" #: lazarusidestrconsts.lisfilehaschangedsave #, object-pascal-format msgid "File \"%s\" has changed. Save?" msgstr "Dosya \"%s\" değiştirildi.Değişiklikler kaydedilsin mi?" #: lazarusidestrconsts.lisfilehasnoproject msgid "File has no project" msgstr "Dosyanın projesi yok" #: lazarusidestrconsts.lisfileisdirectory msgid "File is directory" msgstr "Dosya dizin" #: lazarusidestrconsts.lisfileisnotanexecutable msgid "File is not an executable" msgstr "Dosya yürütülebilir değil" #: lazarusidestrconsts.lisfileisvirtual #, object-pascal-format msgid "File \"%s\" is virtual." msgstr "Dosya \"%s\" sanal." #: lazarusidestrconsts.lisfilenamestyle msgid "Filename Style" msgstr "Dosya Adı Stili" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "Dosya bulunamadı" #: lazarusidestrconsts.lisfilenotfound3 #, object-pascal-format msgid "file %s not found" msgstr "dosya %s bulunamadı" #: lazarusidestrconsts.lisfilenotfound4 msgid "file not found" msgstr "dosya bulunamadı" #: lazarusidestrconsts.lisfilenotfound5 #, object-pascal-format msgid "File not found:%s%s" msgstr "Dosya bulunamadı: %s %s" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit #, object-pascal-format msgid "File \"%s\" not found.%sDo you want to create it?" msgstr "Dosya \"%s\" bulunamadı %s Oluşturmak ister misiniz?" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" msgstr "Dosya küçük harf değil" #: lazarusidestrconsts.lisfilescountconvertedtotextformat #, object-pascal-format msgid "%d files were converted to text format." msgstr "%d dosya metin biçimine dönüştürüldü." #: lazarusidestrconsts.lisfilesettings msgid "File Settings" msgstr "Dosya Ayarları" #: lazarusidestrconsts.lisfileshasincorrectsyntax #, object-pascal-format msgid "File %s has incorrect syntax." msgstr "Dosyada %s yanlış sözdizimi var." #: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection #, object-pascal-format msgid "Files: %s, has Register procedure: %s, in package uses section: %s" msgstr "Dosyalar: %s, Kayıt işlemi var: %s, içinde paket kullanıyor: %s" #: lazarusidestrconsts.lisfileshaverightencoding msgid "*** All found files already have the right encoding ***" msgstr "*** Bulunan tüm dosyalarda zaten doğru kodlama var ***" #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" msgstr "ASCII veya UTF-8 kodlamalı dosyalar" #: lazarusidestrconsts.lisfilesisconvertedtotextformat #, object-pascal-format msgid "File %s was converted to text format." msgstr "Dosya %s metin formatına dönüştürülür." #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" msgstr "ASCII'de değil UTF-8 kodlamalı dosyalar" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "File where debug output is written to. Default is write to the console." msgstr "Hata ayıklama çıktısının yazılacağı dosya. Varsayılan değer konsola yazmaktır." #: lazarusidestrconsts.lisfilter msgid "Filter" msgstr "Filtre" #: lazarusidestrconsts.lisfilter3 #, object-pascal-format msgid "Filter: %s" msgstr "Filtre: %s" #: lazarusidestrconsts.lisfilterallmessagesofcertaintype msgid "Filter all messages of certain type" msgstr "Belli türdeki tüm iletileri filtreleyin" #: lazarusidestrconsts.lisfilterallmessagesoftype #, object-pascal-format msgid "Filter all messages of type %s" msgstr "%s türündeki tüm iletileri filtreleyin" #: lazarusidestrconsts.lisfilteralreadyexists msgid "Filter already exists" msgstr "Filtre zaten var" #: lazarusidestrconsts.lisfilterdebugmessagesandbelow msgid "Filter Debug Messages and below" msgstr "Hata Ayıklama Mesajlarını ve altındakileri filtreleyin" #: lazarusidestrconsts.lisfilterhintsandbelow msgid "Filter Hints and below" msgstr "İpuçlarını ve altındakileri filtrele" #: lazarusidestrconsts.lisfilterhintswithoutsourceposition msgid "Filter Hints without Source Position" msgstr "Kaynak Konumu Olmayan İpuçlarını Filtrele" #: lazarusidestrconsts.lisfilternonedonotfilterbyurgency msgid "Filter None, do not filter by urgency" msgstr "Filtre Yok, aciliyete göre filtrelemeyin" #: lazarusidestrconsts.lisfilternonurgentmessages msgid "Filter non urgent Messages" msgstr "Acil olmayan mesajları filtrele" #: lazarusidestrconsts.lisfilternotesandbelow msgid "Filter Notes and below" msgstr "Notları ve altını filtrele" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" msgstr "Filtre Ayarları" #: lazarusidestrconsts.lisfiltertheavailableoptionslist msgid "Filter the available options list" msgstr "Kullanılabilir seçenekler listesini filtrele" #: lazarusidestrconsts.lisfilterverbosemessagesandbelow msgid "Filter Verbose Messages and below" msgstr "Ayrıntılı Mesajları ve Altını Filtrele" #: lazarusidestrconsts.lisfilterwarningsandbelow msgid "Filter Warnings and below" msgstr "Uyarıları ve altını filtrele" #: lazarusidestrconsts.lisfind msgid "Find ..." msgstr "Bul ..." #: lazarusidestrconsts.lisfinddeclarationof #, object-pascal-format msgid "Find Declaration of %s" msgstr "%s deklarasyonunu Bul" #: lazarusidestrconsts.lisfindfiledirectories msgid "D&irectories" msgstr "Kl&asör" #: lazarusidestrconsts.lisfindfilefilemask msgid "Fi&le mask" msgstr "D&osya maskesi" #: lazarusidestrconsts.lisfindfileincludesubdirectories msgid "Include &sub directories" msgstr "&Alt dizinleri dahil et" #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "&Çok satırlı desen" #: lazarusidestrconsts.lisfindfilereplacementisnotpossible msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:" msgstr "Bu dosya, büyük ve küçük harflerde farklı uzunluklara sahip karakterler içerir. Mevcut uygulama bu durumda doğru değiştirmeye izin vermez (ancak büyük/küçük harfe duyarlı değiştirme kullanabilirsiniz). Bu dosyanın atlanması gerekecektir:" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "all files in &project" msgstr "projedeki tüm dosyalar" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "all &open files" msgstr "tüm açı&k dosyalar" #: lazarusidestrconsts.lisfindfilesearchinactivefile msgid "&active file" msgstr "ak&tif dosya" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "&directories" msgstr "&dizinlerde" #: lazarusidestrconsts.lisfindfilessearchinprojectgroup msgid "project &group" msgstr "p&roje grubu" #: lazarusidestrconsts.lisfindfilewhere msgid "Search location" msgstr "Arama lokasyonu" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" msgstr "Tuş kombinasyonunu bul" #: lazarusidestrconsts.lisfindmissingunit msgid "Find missing unit" msgstr "Eksik birimi bul" #: lazarusidestrconsts.lisfindoption msgid "Find option" msgstr "Seçenek bul" #: lazarusidestrconsts.lisfirst msgid "First" msgstr "İlk" #: lazarusidestrconsts.lisfirsttest msgid "&First test" msgstr "&İlk test" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" msgstr "LFM dosyasını düzelt" #: lazarusidestrconsts.lisfocushint msgid "Focus hint" msgstr "İpucuna odaklan" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" msgstr "Yeniden adlandırmayı zorla" #: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units" msgstr "\"Kapsamlı\" sıralama en üstte yerel değişkenleri, ardından geçerli sınıfın üyelerini, ardından ataların üyelerini, ardından geçerli birimi ve ardından kullanılan birimleri gösterecektir." #: lazarusidestrconsts.lisform msgid "Form" msgstr "Form" #: lazarusidestrconsts.lisformacosdarwin msgid "For macOS (Darwin)" msgstr "MacOs(Darwin) için" #: lazarusidestrconsts.lisformaterror msgid "Format error" msgstr "Format hatası" #: lazarusidestrconsts.lisforwindows msgid "For Windows" msgstr "Windows için" #: lazarusidestrconsts.lisfoundversionexpected #, object-pascal-format msgid "Found version %s, expected %s" msgstr "%s sürümü bulundu, %s bekleniyor" #: lazarusidestrconsts.lisfpcfullversioneg20701 msgid "FPC version as one number (e.g. 20701)" msgstr "Bir sayı olarak FPC sürümü (ör. 20701)" #: lazarusidestrconsts.lisfpcmessagefile2 msgid "FPC message file:" msgstr "FPC ileti dosyası:" #: lazarusidestrconsts.lisfpcmessagesappendix msgid "FPC messages: Appendix" msgstr "FPC mesajları: Ek" #: lazarusidestrconsts.lisfpcresources msgid "FPC resources (.res)" msgstr "FPC kaynakları (.res)" #: lazarusidestrconsts.lisfpcsources msgid "FPC sources" msgstr "FPC kaynakları" #: lazarusidestrconsts.lisfpctooold msgid "FPC too old" msgstr "FPC çok eski" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " msgstr "FPC Sürümü: " #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "FPC Sürümü (ör. 2.2.2)" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" msgid "FPDoc Editor" msgstr "FPDoc Editör" #: lazarusidestrconsts.lisfpdocerrorwriting #, object-pascal-format msgid "Error writing \"%s\"%s%s" msgstr "\"%s\"%s%s yazılırken hata oluştu" #: lazarusidestrconsts.lisfpdocfpdocsyntaxerror msgid "FPDoc syntax error" msgstr "FPDoc sözdizimi hatası" #: lazarusidestrconsts.lisfpdocpackagename msgid "FPDoc package name:" msgstr "FPDoc paket adı:" #: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename msgid "FPDoc package name. Default is project file name." msgstr "FPDoc paket adı, varsayılan proje dosyası adıdır." #: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement #, object-pascal-format msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" msgstr "\"%s\":%s%s fpdoc öğesinde bir sözdizimi hatası var" #: lazarusidestrconsts.lisfppkgcompilerproblem msgid "there is a problem with the Free Pascal compiler executable, " msgstr "free Pascal derleyicisinin çalıştırılabilirliği ile ilgili bir sorun var, " #: lazarusidestrconsts.lisfppkgconfgenproblems msgid "Warnings have to be resolved first" msgstr "İlk önce uyarılar çözülmek zorunda" #: lazarusidestrconsts.lisfppkgconfiguration msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default." msgstr "Yapılandırma dosyası tipik olarak \"fppkg.cfg\" adını taşır. Yanlış olduğunda Free Pascal paketlerindeki bağımlılıkları çözmek imkansız olabilir. Varsayılanı kullanmak için boş bırakın." #: lazarusidestrconsts.lisfppkgconfigurationfilenotfound #, object-pascal-format msgid "Fppkg configuration file not found:%s%s" msgstr "Fppkg yapılandırma dosyası bulunamadı:%s%s" #: lazarusidestrconsts.lisfppkgcreatefilefailed #, object-pascal-format msgid "Failed to generate the configuration file \"%s\": %s" msgstr "\"%s\" yapılandırma dosyası oluşturulamadı: %s" #: lazarusidestrconsts.lisfppkgfilestobewritten msgid "Files to be written:" msgstr "Yazılacak dosyalar:" #: lazarusidestrconsts.lisfppkgfixconfiguration msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually." msgstr "Yapılandırma dosyalarını otomatik olarak geri yüklemeyi deneyebilir veya yapılandırma dosyasını manuel olarak uyarlayabilirsiniz." #: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed msgid "Failed to retrieve the version of the fpcmkcfg configuration tool." msgstr "Fpcmkcfg yapılandırma aracının sürümü alınamadı." #: lazarusidestrconsts.lisfppkgfpcmkcfgmissing msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files." msgstr "Yapılandırma dosyalarını oluşturmak için gereken fpcmkcfg yapılandırma aracı bulunamadı." #: lazarusidestrconsts.lisfppkgfpcmkcfgneeded msgid "An up-to-date version is needed to create the configuration files." msgstr "Yapılandırma dosyalarını oluşturmak için güncel bir sürüm gerekir." #: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold msgid "It is probably too old to create the configuration files." msgstr "Konfigürasyon dosyalarını oluşturmak için muhtemelen çok eski." #: lazarusidestrconsts.lisfppkgfpcmkcfgtooold #, object-pascal-format msgid "The fpcmkcfg configuration tool it too old [%s]." msgstr "Fpcmkcfg yapılandırma aracı çok eski [%s]." #: lazarusidestrconsts.lisfppkginstallationpath #, object-pascal-format msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\"" msgstr "Free Pascal Derleyici kurulumunun öneki gereklidir. Örneğin, \"%s\" ve/veya \"%s\" birimlerine sahiptir." #: lazarusidestrconsts.lisfppkglibprefix #, object-pascal-format msgid "Fpc library prefix: %s" msgstr "Fpc kütüphane öneki: %s" #: lazarusidestrconsts.lisfppkgprefix #, object-pascal-format msgid "Fpc prefix: %s" msgstr "Fpc öneki: %s" #: lazarusidestrconsts.lisfppkgproblem msgid "Problem with Fppkg configuration" msgstr "Fppkg yapılandırmasıyla ilgili sorun" #: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable." msgstr "Son sürümün yüklendiğinden ve yolun mevcut olduğundan veya derleyici tarafından çalıştırılabilir olduğundan emin olun." #: lazarusidestrconsts.lisfppkgwriteconfexception #, object-pascal-format msgid "A problem occurred while trying to create a new Fppkg configuration: %s" msgstr "Yeni bir Fppkg yapılandırması oluşturmaya çalışırken bir sorun oluştu: %s" #: lazarusidestrconsts.lisfppkgwriteconffailed #, object-pascal-format msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal." msgstr "Yeni bir Fppkg yapılandırması oluşturulamadı (%s) Yapılandırmayı el ile düzeltmeniz veya Free Pascal'ı yeniden yüklemeniz gerekir." #: lazarusidestrconsts.lisfppkgwriteconfigfile msgid "Write new configuration files" msgstr "Yeni yapılandırma dosyaları yaz" #: lazarusidestrconsts.lisframe msgid "Frame" msgstr "Frame" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" msgstr "&Öncekini ara" #: lazarusidestrconsts.lisfreeingbufferlines #, object-pascal-format msgid "freeing buffer lines: %s" msgstr "arabellek satırlarını boşaltma: %s" #: lazarusidestrconsts.lisfreepascalcompilermessages msgid "Free Pascal Compiler messages" msgstr "Free Pascal Derleyici mesajları" #: lazarusidestrconsts.lisfreepascalprefix msgid "Free Pascal compiler prefix" msgstr "Free Pascal derleyici öneki" #: lazarusidestrconsts.lisfreepascalsourcedirectory msgid "Free Pascal source directory" msgstr "Free Pascal kaynak dizini" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" msgstr "&Sonrakini Ara" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Aranacak diğer dosyalar (ör. /path/*.pas ;/path2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "Tanımlayıcıyı Bul veya Yeniden Adlandır" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" msgstr "Referanslarda Bul" #: lazarusidestrconsts.lisfriidentifier #, object-pascal-format msgid "Identifier: %s" msgstr "Tanımlayıcı: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "açık paket ve projelerde" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" msgstr "geçerli birimde" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" msgstr "ana projede" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "projede/pakette mevcut birimde" #: lazarusidestrconsts.lisfriinvalididentifier msgid "Invalid Identifier" msgstr "Geçersiz Tanımlayıcı" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" msgstr "Tüm başvuruları yeniden adlandır" #: lazarusidestrconsts.lisfrirenaming msgid "Renaming" msgstr "Yeniden adlandır" #: lazarusidestrconsts.lisfrisearch msgid "Search" msgstr "Ara" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Yorumlarda ara" #: lazarusidestrconsts.lisfull msgid "Full" msgstr "Tam" #: lazarusidestrconsts.lisfunction msgctxt "lazarusidestrconsts.lisfunction" msgid "Function" msgstr "Fonksiyon" #: lazarusidestrconsts.lisgeneral msgctxt "lazarusidestrconsts.lisgeneral" msgid "General" msgstr "Genel" #: lazarusidestrconsts.lisgeneratefppkgcfg #, object-pascal-format msgid "Fppkg configuration: %s" msgstr "Fppkg yapılandırması: %s" #: lazarusidestrconsts.lisgeneratefppkgcompcfg #, object-pascal-format msgid "Fppkg compiler configuration: %s" msgstr "Fppkg derleyici yapılandırması: %s" #: lazarusidestrconsts.lisgeneratefppkgconfiguration msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool." msgstr "Fpcmkcfg aracıyla yeni Fppkg yapılandırma dosyaları oluşturmak için bu ekranı kullanın." #: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption msgid "Generate new Fppkg configuration files" msgstr "Yeni Fppkg yapılandırma dosyaları oluşturun" #: lazarusidestrconsts.lisgetbuildmodes msgid "Print a list of build modes in the project. Active mode is listed first." msgstr "Projedeki derleme modlarının bir listesini yazdırır. İlk olarak etkin mod listelenir." #: lazarusidestrconsts.lisgetexpandtext #, fuzzy #| msgid "Print the result of substituting macros in the text. The absence of macros in the text means the name of the macro. By default, active build mode is used." msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode." msgstr "Metinde makroları değiştirmenin sonucunu yazdırır. Metinde makro olmaması, makronun adı anlamına gelir. Varsayılan olarak, etkin derleme modu kullanılır." #: lazarusidestrconsts.lisgetwordatcurrentcursorposition msgid "get word at current cursor position" msgstr "mevcut imleç konumundan kelime alın" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition2 msgid "Get word at current cursor position." msgstr "Mevcut imleç konumundan kelime alın." #: lazarusidestrconsts.lisglobalsettings msgid "Global settings" msgstr "Genel Ayarlar" #: lazarusidestrconsts.lisgotoline msgid "Goto Line" msgstr "Satıra Git" #: lazarusidestrconsts.lisgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" "\n" "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" "\n" "A copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" "\n" "\n" "Telif Hakkı (C) \n" "\n" "Bu kaynak ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; Lisansın 2. sürümü veya (isteğe bağlı olarak) daha sonraki bir sürüm.\n" "\n" "Bu kod faydalı olacağı umuduyla dağıtılmıştır, ancak HİÇBİR GARANTİ YOKTUR; HİÇBİR AMAÇLI OLMAK İÇİN TİCARİRLİK veya FİTNESS'in zımni garantisi olmadan. Daha fazla bilgi için GNU Genel Kamu Lisansına bakınız.\n" "\n" "GNU Genel Kamu Lisansının bir kopyası World Wide Web'de adresinde bulunmaktadır. Ayrıca, Free Software Foundation, Inc.'e, 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazarak da elde edebilirsiniz." #: lazarusidestrconsts.lisgroup msgid "Group" msgstr "Grup" #: lazarusidestrconsts.lisgrouplocalvariables msgid "Group automatically defined local variables" msgstr "Otomatik olarak tanımlanmış yerel değişkenleri gruplandırın" #: lazarusidestrconsts.lisgroupsfordebugoutput msgid "Enable or disable groups of debug output. Valid options are:" msgstr "Hata ayıklama çıktısı gruplarını etkinleştirin veya devre dışı bırakın. Geçerli seçenekler şunlardır:" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" msgstr "En büyüğe büyümek" #: lazarusidestrconsts.lisgutterpartmargin msgid "Margin" msgstr "Kenar boşluğu" #: lazarusidestrconsts.lisgutterpartvisible msgid "Visible" msgstr "Görünür" #: lazarusidestrconsts.lisgutterpartwidth msgid "Width" msgstr "Genişlik" #: lazarusidestrconsts.lishashelp msgid "Has Help" msgstr "Yardım var" #: lazarusidestrconsts.lisheadercolors msgid "Header colors" msgstr "Başlık renkleri" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" msgstr "Sınıf için üstbilgi açıklaması" #: lazarusidestrconsts.lishelpentries msgid "Help entries" msgstr "Yardım girdileri" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" msgstr "Seçici yardım" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage msgid "Help for Free Pascal Compiler message" msgstr "Free Pascal Derleyici mesajı için yardım" #: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh msgid "Hide all hints and warnings by inserting IDE directives {%H-}" msgstr "IDE yönergeleri {% H-}\" ekleyerek tüm ipuçlarını ve uyarılarını gizle" #: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh msgid "Hide message at %s by inserting IDE directive {%H-}" msgstr "%s adresindeki mesajı IDE yönergesi {% H-}\" ekleyerek gizle" #: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh msgid "Hide message by inserting IDE directive {%H-}" msgstr "IDE direktifi {% H-}\" ekleyerek mesajları gizle" #: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit #, object-pascal-format msgid "Hide message by inserting {$warn %s off} to unit \"%s\"" msgstr "{$warn %s off} ünitesini \"%s\" birimine ekleyerek mesajı gizle" #: lazarusidestrconsts.lishidesearch msgid "Hide Search" msgstr "Aramayı Gizle" #: lazarusidestrconsts.lishidewindow msgctxt "lazarusidestrconsts.lishidewindow" msgid "Hide window" msgstr "Pencereyi gizle" #: lazarusidestrconsts.lishidewithpackageoptionvm #, object-pascal-format msgid "Hide with package option (-vm%s)" msgstr "Paket seçeneğiyle gizle (-vm %s)" #: lazarusidestrconsts.lishidewithprojectoptionvm #, object-pascal-format msgid "Hide with project option (-vm%s)" msgstr "Proje seçeneğiyle gizle (-vm %s)" #: lazarusidestrconsts.lishint msgctxt "lazarusidestrconsts.lishint" msgid "Hint" msgstr "İpucu" #: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals msgid "Hint: A default value can be defined in the conditionals." msgstr "İpucu: Koşullarda varsayılan bir değer tanımlanabilir." #: lazarusidestrconsts.lishintatpropertysnameshowsdescription msgid "A hint at property's name shows its description." msgstr "Property adına verilen bir ipucu onun açıklamasını göstermektedir." #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "İpucu: İki paketin aynı ada sahip bir birimi olup olmadığını kontrol edin." #: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from." msgstr "İpucu: inherited den Miras alınan yolların nereden geldiğini öğrenmek için \"Seçenekleri Göster\" i tıklayın." #: lazarusidestrconsts.lishints #, object-pascal-format msgid ", Hints: %s" msgstr ", İpuçları: %s" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon #, object-pascal-format msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "İpucu: \"Make Resourcestring\" fonksiyonu bir sitringin sabit olmasını bekliyor.%s Lütfen ifadeyi seçin ve tekrar deneyin." #: lazarusidestrconsts.lishintviewforms msgid "View Forms" msgstr "Formları Görüntüle" #: lazarusidestrconsts.lishintviewunits msgid "View Units" msgstr "Birimleri Görüntüle" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" msgstr "Veritabanları" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" msgstr "Yardım Seçenekleri" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" msgstr "Özellikler:" #: lazarusidestrconsts.lishlpoptsviewers msgid "Viewers" msgstr "İzleyiciler" #: lazarusidestrconsts.lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "FPC Doc HTML Yolu" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" msgstr "Yatay" #: lazarusidestrconsts.lishorizontallinesbetweenproperties msgid "Horizontal lines between properties." msgstr "Özellikler arasında yatay çizgiler var." #: lazarusidestrconsts.lisid msgctxt "lazarusidestrconsts.lisid" msgid "ID" msgstr "ID" #: lazarusidestrconsts.lisidcaddition msgid "Addition" msgstr "İlave" #: lazarusidestrconsts.lisidcopening msgid "Opening" msgstr "Açılıyor" #: lazarusidestrconsts.liside msgid "IDE" msgstr "IDE" #: lazarusidestrconsts.lisidebuildoptions msgid "IDE build options" msgstr "IDE kurulum seçenekleri" #: lazarusidestrconsts.lisidecaptioncustomhint msgid "Additional info to display in the IDE title" msgstr "" #: lazarusidestrconsts.lisidecompileandrestart msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages." msgstr "Paketlerin yüklenmesi/kaldırılması sırasında IDE yeniden derlenecek ve yeniden başlatılacaktır." #: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus #, object-pascal-format, fuzzy, badformat msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s" msgstr "Lazarus'a hoş geldiniz.%0:sBulunan IDE yapılandırması daha önce başka bir Lazarus yüklemesi tarafından kullanılmış.%0:sİki veya daha fazla ayrı Lazarus yüklemeniz varsa, aynı yapılandırmayı paylaşmamalıdırlar. Bu, çakışmalara yol açabilir ve Lazarus kurulumlarınız kullanılamaz hale gelebilir.%0:s%0:sSadece bir kurulumunuz varsa ve Lazarus yürütülebilir dosyasını kopyaladıysanız veya taşıdıysanız, bu yapılandırmayı yükseltebilirsiniz.%0:s%1:s%0:s%0:sSeçin:%0:s%0:s* Bilgileri güncelle: Bu yapılandırmayı kullanın ve gelecekte bu Lazarus ile kullanılmak üzere güncelleyin. Eski kurulum artık bunu kullanmayacaktır.%0:s* Yoksay: Bu yapılandırmayı kullanın ancak uyarıyı saklayın. Bu, diğer kurulumla çakışmalara yol açabilir.%0:s* Abort: Şimdi çıkın. Daha sonra bu Lazarus'u doğru yapılandırmayla başlatarak sorunu çözebilirsiniz.%0:s%0:sEk bilgi:%0:sBu yapılandırma şu adreste: 2:s%0:s adresindeki Lazarus kurulumuna aittir: 3:s%0:sGeçerli IDE şuradan başlatıldı: %4:s%0:s" #: lazarusidestrconsts.lisideinfoinformationabouttheide msgid "Information about the IDE" msgstr "IDE hakkında bilgi" #: lazarusidestrconsts.lisidemacros msgid "IDE Macros" msgstr "IDE Makroları" #: lazarusidestrconsts.lisidemaintainsscaledinmainunit msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit." msgstr "IDE, ana ünitede Application.Scaled (Hi-DPI) özelliğini korur." #: lazarusidestrconsts.lisidemaintainsthetitleinmainunit msgid "The IDE maintains the title in main unit." msgstr "IDE ana ünitedeki başlığı korur." #: lazarusidestrconsts.lisidentifier msgid "identifier" msgstr "tanımlayıcı" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "Tanımlayıcı başlıyor ..." #: lazarusidestrconsts.lisidentifiercontains msgid "Identifier contains ..." msgstr "Tanımlayıcı içeriyor ..." #: lazarusidestrconsts.lisideoptions msgid "IDE Options:" msgstr "IDE Seçenekleri:" #: lazarusidestrconsts.lisidetitlecustom msgid "Custom IDE title" msgstr "" #: lazarusidestrconsts.lisidetitleoptions msgid "IDE main window and taskbar title" msgstr "" #: lazarusidestrconsts.lisidetitlestartswithprojectname #, fuzzy #| msgid "IDE title starts with project name" msgid "Show custom IDE title before built-in IDE title or info" msgstr "IDE başlığı proje adı ile başlasın" #: lazarusidestrconsts.lisiecoallbuildmodes msgid "All build modes" msgstr "Tüm yapı modları" #: lazarusidestrconsts.lisiecocompileroptionsof msgid "Compiler options of" msgstr "Derleyici seçenekleri" #: lazarusidestrconsts.lisiecocurrentbuildmode msgid "Current build mode" msgstr "Geçerli kurulum modu" #: lazarusidestrconsts.lisiecoerroropeningxml msgid "Error opening XML" msgstr "XML açılırken hata oluştu" #: lazarusidestrconsts.lisiecoerroropeningxmlfile #, object-pascal-format msgid "Error opening XML file \"%s\":%s%s" msgstr "XML dosyası \"%s\"açılırken hata oluştu: %s %s" #: lazarusidestrconsts.lisiecoexportcompileroptions msgid "Export Compiler Options" msgstr "Derleyici Seçeneklerini Dışa Aktar" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "Dışa aktarma dosyası var" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti #, object-pascal-format msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "\"%s\" dışa aktarma dosyası var.%sDosyayı aç ve yalnızca derleyici seçeneklerini değiştir?%s(Diğer ayarlar korunacak.)" #: lazarusidestrconsts.lisiecoimportcompileroptions msgid "Import Compiler Options" msgstr "Derleyici Seçeneklerini İçe Aktar" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" msgstr "Dosyadan yükle" #: lazarusidestrconsts.lisieconocompileroptionsinfile #, object-pascal-format msgid "File \"%s\" does not contain compiler options." msgstr "Dosya \"%s\" derleyici seçenekleri içermiyor." #: lazarusidestrconsts.lisiecosavetofile msgid "Save to file" msgstr "Dosyayı kaydet" #: lazarusidestrconsts.lisifnotchecked msgid "If not checked:" msgstr "Kontrol edilmediyse:" #: lazarusidestrconsts.lisifonlysessioninfochangedthenask msgid "If only the session info changed, ask about saving it." msgstr "Yalnızca oturum bilgileri değiştiyse, kaydetme hakkında bilgi isteyin." #: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst #, object-pascal-format msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" msgstr "İki farklı Lazarus sürümü kullanmak istiyorsanız, ikinci Lazarus'a birincil-config-path veya pcp.%s komut satırı parametresi ile başlatmalısınız. Örneğin:" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" msgstr "Hepsini Yoksay" #: lazarusidestrconsts.lisignoreuseasancestor #, object-pascal-format msgid "Ignore, use %s as ancestor" msgstr "Yoksay, %s atası olarak kullan" #: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage msgid "Imitate indentation of current unit, project or package" msgstr "Geçerli birim, proje veya paketin girintisini taklit edin" #: lazarusidestrconsts.lisimplementationcommentforclass msgid "Implementation comment for class" msgstr "Sınıf için uygulama yorumu" #: lazarusidestrconsts.lisimport msgctxt "lazarusidestrconsts.lisimport" msgid "Import" msgstr "İçe aktar" #: lazarusidestrconsts.lisimportant msgctxt "lazarusidestrconsts.lisimportant" msgid "Important" msgstr "Önemli" #: lazarusidestrconsts.lisimportenvironmentoptions msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" msgid "Import environment options" msgstr "İçe aktarma ortamı seçenekleri" #: lazarusidestrconsts.lisimportfromfile msgid "Import from File" msgstr "Dosyayı İçe Aktar" #: lazarusidestrconsts.lisimportingbuildmodesnotsupported msgid "Importing BuildModes is not supported for packages." msgstr "Yapı Modellerini İçe Aktarma, paketler için desteklenmiyor." #: lazarusidestrconsts.lisimportpackagelistxml msgid "Import package list" msgstr "Paketi listesi içe aktar" #: lazarusidestrconsts.lisimpossible msgid "Impossible" msgstr "İmkansız" #: lazarusidestrconsts.lisinasourcedirectoryofthepackage #, object-pascal-format msgid "In a source directory of the package \"%s\"." msgstr "Paketin kaynak dizininde \"%s\"." #: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates msgid "In a source directory of the project. Check for duplicates." msgstr "Projenin kaynak dizininde. Yinelenenleri kontrol edin." #: lazarusidestrconsts.lisincludepath msgid "include path" msgstr "yolu ekle" #: lazarusidestrconsts.lisincludepaths msgid "Include paths" msgstr "Yolları ekle" #: lazarusidestrconsts.lisincluderecursive msgid "Include, recursive" msgstr "Dahil et, tekrarlı" #: lazarusidestrconsts.lisincompatibleppu #, object-pascal-format msgid ", incompatible ppu=%s" msgstr ", Uyumsuz ppu = %s" #: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound msgid "Incorrect configuration directory found" msgstr "Yanlış yapılandırma dizini bulundu" #: lazarusidestrconsts.lisincorrectfppkgconfiguration #, object-pascal-format msgid "there is a problem with the Fppkg configuration. (%s)" msgstr "fppkg yapılandırmasında bir sorun var. (%s)" #: lazarusidestrconsts.lisindentationforpascalsources msgid "Indentation for Pascal sources" msgstr "Pascal kaynakları için girinti" #: lazarusidestrconsts.lisinformation msgid "Information" msgstr "Bilgi" #: lazarusidestrconsts.lisinformationaboutunit #, object-pascal-format msgid "Information about %s" msgstr "%s hakkında bilgi" #: lazarusidestrconsts.lisinformationaboutusedfpc msgid "Information about used FPC" msgstr "Kullanılmış FPC hakkında bilgi" #: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." msgstr "FPC biriminde arama yolu. Muhtemelen FPC paketi tarafından yüklenmiştir. Derleyici ve ppu dosyasının aynı kurulumdan olup olmadığını kontrol edin." #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" msgstr "İlişkili olarak" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" msgstr "Devralınan Öğe" #: lazarusidestrconsts.lisinheritedparameters msgid "Inherited parameters" msgstr "Devralınan parametreler" #: lazarusidestrconsts.lisinheritedprojectcomponent msgid "Inherited project component" msgstr "Devralınan proje bileşeni" #: lazarusidestrconsts.lisinitialchecks msgid "Initial Checks" msgstr "İlk Kontroller" #: lazarusidestrconsts.lisinitializelocalvariable msgid "Initialize Local Variable" msgstr "Yerel Değişken Başlat" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil #, object-pascal-format msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" msgstr "Projenin/paketin temiz bir kopyasını oluşturmak için, aşağıdaki dizindeki tüm dosyalar silinecek ve tüm içeriği kaybolacak.%s \"%s\" içindeki tüm dosyalar silinsin mi?" #: lazarusidestrconsts.lisinsert msgctxt "lazarusidestrconsts.lisinsert" msgid "Insert" msgstr "Ekle" #: lazarusidestrconsts.lisinsertassignment #, object-pascal-format msgid "Insert Assignment %s := ..." msgstr "Atama Ekle %s: = ..." #: lazarusidestrconsts.lisinsertdate msgid "insert date" msgstr "tarih ekle" #: lazarusidestrconsts.lisinsertdateandtime msgid "insert date and time" msgstr "tarih ve saat ekle" #: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring msgid "Insert date and time. Optional: format string." msgstr "Zaman ve tarih ekleyin. İsteğe bağlı: biçim dizesi." #: lazarusidestrconsts.lisinsertdateoptionalformatstring msgid "Insert date. Optional: format string." msgstr "Tarih ekleyin. İsteğe bağlı: biçim dizesi." #: lazarusidestrconsts.lisinsertendifneeded msgid "insert end if needed" msgstr "gerekirse end if ekleyin" #: lazarusidestrconsts.lisinsertheaderofcurrentprocedure msgid "" "Insert header of current procedure.\n" "\n" "Optional Parameters (comma separated):\n" "WithStart, // proc keyword e.g. 'function', 'class procedure'\n" "WithoutClassKeyword,// without 'class' proc keyword\n" "AddClassName, // extract/add ClassName.\n" "WithoutClassName, // skip classname\n" "WithoutName, // skip function name\n" "WithoutParamList, // skip param list\n" "WithVarModifiers, // extract 'var', 'out', 'const'\n" "WithParameterNames, // extract parameter names\n" "WithoutParamTypes, // skip colon, param types and default values\n" "WithDefaultValues, // extract default values\n" "WithResultType, // extract colon + result type\n" "WithOfObject, // extract 'of object'\n" "WithCallingSpecs, // extract cdecl; inline;\n" "WithProcModifiers, // extract forward; alias; external;\n" "WithComments, // extract comments and spaces\n" "InUpperCase, // turn to uppercase\n" "CommentsToSpace, // replace comments with a single space\n" " // (default is to skip unnecessary space,\n" " // e.g 'Do ;' normally becomes 'Do;'\n" " // with this option you get 'Do ;')\n" "WithoutBrackets, // skip start- and end-bracket of parameter list\n" "WithoutSemicolon, // skip semicolon at end\n" msgstr "" "Geçerli prosedürün başlığını yerleştirin.\n" "\n" "İsteğe bağlı Parametreler (virgülle ayrılmış):\n" "WithStart, // proc anahtar kelimesi ör. 'function', 'sınıf prosedürü'\n" "WithoutClassKeyword, // 'class' proc anahtar sözcüğü olmadan\n" "AddClassName, // özüt / ClassName ekleyin.\n" "WithoutClassName, // sınıf adını atla\n" "WithoutName, // işlev adını atla\n" "WithoutParamList, // param listesini atla\n" "WithVarModifiers, // 'var', 'out', 'const' ifadesini çıkarın.\n" "WithParameterNames, // parametre adlarını çıkarın\n" "WithoutParamTypes, // kolon atla, param tipleri ve varsayılan değerler\n" "WithDefaultValues, // varsayılan değerleri al\n" "WithResultType, // kolon + sonuç türünü çıkarın\n" "WithOfObject, // 'nesne' ayıkla\n" "WithCallingSpecs, // extract cdecl; Çizgide;\n" "WithProcModifiers, // öne çıkar; takma; dış;\n" "WithComments, // yorumları ve boşlukları çıkart\n" "InUpperCase, // büyük harfe dön\n" "CommentsToSpace, // yorumları bir boşlukla değiştirin\n" " // (varsayılan olarak gereksiz yere atlamak,\n" " // e.g 'Do;' normalde 'Yap;'\n" " // bu seçenekle 'Yap;'\n" "WithoutBrackets, // parametre listesinin başlangıç ​​ve bitiş dirseklerini atlayın\n" "WithoutSemicolon, // sonunda noktalı virgül atla\n" #: lazarusidestrconsts.lisinsertmacro msgctxt "lazarusidestrconsts.lisinsertmacro" msgid "Insert Macro" msgstr "Makro ekle" #: lazarusidestrconsts.lisinsertnameofcurrentprocedure msgid "Insert name of current procedure." msgstr "Geçerli procedure adını ekleyin." #: lazarusidestrconsts.lisinsertprintshorttag2 msgid "Insert printshort tag" msgstr "Yazdırma kısayolu ekle" #: lazarusidestrconsts.lisinsertprocedurehead msgid "insert procedure head" msgstr "prosedür başlığı ekleyin" #: lazarusidestrconsts.lisinsertprocedurename msgid "insert procedure name" msgstr "procedure adını girin" #: lazarusidestrconsts.lisinsertsemicolonifneeded msgid "Insert semicolon if needed" msgstr "Gerekirse noktalı virgül ekleyin" #: lazarusidestrconsts.lisinserttime msgid "insert time" msgstr "zaman ekle" #: lazarusidestrconsts.lisinserttimeoptionalformatstring msgid "Insert time. Optional: format string." msgstr "Zaman ekleyin. İsteğe bağlı: biçim dizesi." #: lazarusidestrconsts.lisinserturltag msgid "Insert url tag" msgstr "URL etiketi ekle" #: lazarusidestrconsts.lisinsession msgid "In session" msgstr "Oturumda" #: lazarusidestrconsts.lisinstalled msgid "installed" msgstr "yüklü" #: lazarusidestrconsts.lisinstallitilikethefat msgid "Install it, I like the fat" msgstr "Yükle, şişkin seviyorum" #: lazarusidestrconsts.lisinstallpackagesmsg #, object-pascal-format msgid "" "The following packages are not installed, but available in the main repository: %s.\n" "Do you wish to install missing packages?" msgstr "" "Aşağıdaki paketler yüklü değil, ancak ana depoda mevcut: %s.\n" "Eksik paketleri yüklemek istiyor musunuz?" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" msgstr "Seçimi yükle" #: lazarusidestrconsts.lisinstalluninstallpackages msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" msgid "Install/Uninstall Packages" msgstr "Paketleri Yükle/Kaldır" #: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile msgid "Instead of compiling a package create a simple Makefile." msgstr "Bir paketi derlemek yerine basit bir Makefile oluşturun." #: lazarusidestrconsts.lisinsufficientencoding msgid "Insufficient encoding" msgstr "Yetersiz kodlama" #: lazarusidestrconsts.lisinteractive msgid "Interactive" msgstr "Etkileşimli" #: lazarusidestrconsts.lisinternalerror #, object-pascal-format msgid "internal error: %s" msgstr "dahili hata: %s" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" msgstr "Geçersiz silme" #: lazarusidestrconsts.lisinvalidexecutable msgid "Invalid Executable" msgstr "Geçersiz Yürütülebilir" #: lazarusidestrconsts.lisinvalidexecutablemessagetext #, object-pascal-format msgid "The file \"%s\" is not executable." msgstr "\"%s\" dosyası çalıştırılabilir değil." #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction #, object-pascal-format msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "Geçersiz ifade.%s İpucu: \"Make Resourcestring\" foksiyonu, tek bir dosyada bir sabit stringi bekliyor. Lütfen ifadeyi seçin ve tekrar deneyin." #: lazarusidestrconsts.lisinvalidfilename msgid "Invalid file name" msgstr "Geçersiz dosya adı" #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" msgstr "Geçersiz filtre" #: lazarusidestrconsts.lisinvalidlinecolumninmessage #, object-pascal-format msgid "Invalid line, column in message%s%s" msgstr "Geçersiz satır, ileti %s %s sütundaki sütun" #: lazarusidestrconsts.lisinvalidmacrosin #, object-pascal-format msgid "Invalid macros in \"%s\"" msgstr "\"%s\" daki geçersiz makrolar" #: lazarusidestrconsts.lisinvalidmacrosinexternaltool #, object-pascal-format msgid "Invalid macros \"%s\" in external tool \"%s\"" msgstr "Harici araç \"%s\" daki \"%s\" geçersiz makrolar" #: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie #, object-pascal-format msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." msgstr "%s geçersiz makro. Makro adı Pascal tanımlayıcı olmalı." #: lazarusidestrconsts.lisinvalidmacrothenameisakeyword #, object-pascal-format msgid "Invalid macro name \"%s\". The name is a keyword." msgstr "Geçersiz makro adı \"%s\". Ad bir anahtar kelimedir." #: lazarusidestrconsts.lisinvalidmask msgid "Invalid Mask" msgstr "Geçersiz Maske" #: lazarusidestrconsts.lisinvalidmode #, object-pascal-format msgid "Invalid mode %s" msgstr "Geçersiz mod %s" #: lazarusidestrconsts.lisinvalidmultiselection msgid "Invalid multiselection" msgstr "Geçersiz çoklu seçim" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "Geçersiz Pascal Tanımlayıcı" #: lazarusidestrconsts.lisinvalidpascalidentifiername #, object-pascal-format msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?" msgstr "\"%s\" ismi geçerli bir Pascal tanımlayıcısı değil.%s Yine de kullanılsın mı?" #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" msgstr "Geçersiz proc adı" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" msgstr "Geçersiz proje dosyası" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "Geçersiz yayınlama Dizini" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" msgstr "Geçersiz seçim" #: lazarusidestrconsts.lisinvalidversionin #, object-pascal-format msgid "invalid version in %s" msgstr "%s sürümü geçersiz" #: lazarusidestrconsts.lisisalreadypartoftheproject #, object-pascal-format msgid "%s is already part of the Project." msgstr "%s zaten Projenin bir parçası." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject #, object-pascal-format msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "\"%s\" geçersiz bir proje adı %sLütfen başka birini seçin (ör. Project1.lpi)" #: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed #, object-pascal-format msgid "%s is a %s.%sThis circular dependency is not allowed." msgstr "%s bir %s.%sBu döngüsel bağımlılığa izin verilmedi." #: lazarusidestrconsts.lisisddirectorynotfound msgid "directory not found" msgstr "dizin bulunamadı" #: lazarusidestrconsts.lisissues msgid "Issues" msgstr "Sorunlar" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe #, object-pascal-format msgid "I wonder how you did that. Error in the %s:" msgstr "Bunu nasıl yaptığını merak ediyorum, %s hatası:" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory msgid "I wonder how you did that: Error in the base directory:" msgstr "Bunu nasıl yaptığını merak ediyorum: Temel dizindeki hata:" #: lazarusidestrconsts.lisjhjumphistory msgctxt "lazarusidestrconsts.lisjhjumphistory" msgid "Jump History" msgstr "Geçmişe atla" #: lazarusidestrconsts.lisjumptoerror msgid "Jump to error" msgstr "Hataya atla" #: lazarusidestrconsts.lisjumptoerroratidentifiercompletion msgid "When an error in the sources is found at identifier completion, jump to it." msgstr "Tanımlayıcı tamamlandığında kaynaklarda bir hata bulunduğunda, buna atlayın." #: lazarusidestrconsts.lisjumptoprocedure #, object-pascal-format msgid "Jump to procedure %s" msgstr "%s prosedüre atla" #: lazarusidestrconsts.liskb #, object-pascal-format msgid "%s KB" msgstr "%s KB" #: lazarusidestrconsts.liskeep2 msgid "Keep" msgstr "Tut" #: lazarusidestrconsts.liskeepfileopen msgid "Keep converted files open in editor" msgstr "Dönüştürülen dosyaları düzenleyicide açık tut" #: lazarusidestrconsts.liskeepfileopenhint msgid "All project files will be open in editor after conversion" msgstr "Tüm proje dosyaları dönüştürmeden sonra editörde açılacaktır" #: lazarusidestrconsts.liskeepname msgid "Keep name" msgstr "Adı sakla" #: lazarusidestrconsts.liskeepopen msgid "Keep open" msgstr "Açık tut" #: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate msgid "Keep absolute indentation, regardless of the current cursor indentation in the text." msgstr "Metindeki geçerli imleç girintisinden bağımsız olarak mutlak girintiyi korur." #: lazarusidestrconsts.liskeepsubindentation msgid "Absolute indentation" msgstr "Mutlak girinti" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" msgstr "Onları sakla ve devam et" #: lazarusidestrconsts.liskey msgctxt "lazarusidestrconsts.liskey" msgid "Key" msgstr "Tuş" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" msgstr "Özel komutlar" #: lazarusidestrconsts.liskeycatdesigner msgid "Designer commands" msgstr "Tasarımcı komutları" #: lazarusidestrconsts.liskeycatobjinspector msgid "Object Inspector commands" msgstr "Nesne Denetleyici komutları" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "Tuş (veya 2 tuş dizisi)" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" msgstr "İnşaadan vazgeç" #: lazarusidestrconsts.liskmaddbpaddress msgid "Add Address Breakpoint" msgstr "Adres Kesme Noktası Ekle" #: lazarusidestrconsts.liskmaddbpsource msgid "Add Source Breakpoint" msgstr "Kaynak kesme noktası ekle" #: lazarusidestrconsts.liskmaddbpwatchpoint msgid "Add Data/WatchPoint" msgstr "Veri/İzleme Noktası Ekle" #: lazarusidestrconsts.liskmaddwatch msgctxt "lazarusidestrconsts.liskmaddwatch" msgid "Add watch" msgstr "İzleme ekle" #: lazarusidestrconsts.liskmbuildmanymodes msgid "Build many modes" msgstr "Birçok modda oluştur" #: lazarusidestrconsts.liskmbuildprojectprogram msgid "Build project/program" msgstr "Proje/program oluştur" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "Tuş haritası şemasını seçin" #: lazarusidestrconsts.liskmclassic msgid "Classic" msgstr "Klasik" #: lazarusidestrconsts.liskmcleanupandbuild msgctxt "lazarusidestrconsts.liskmcleanupandbuild" msgid "Clean up and build" msgstr "Temizle ve derle" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" msgstr "Projeyi kapat" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "CodeTools editörü tanımları" #: lazarusidestrconsts.liskmcompileprojectprogram msgid "Compile project/program" msgstr "Proje/program derle" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config \"Build File\"" msgstr "\"Dosya derleme\" Yapılandırması" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure Custom Components" msgstr "Özel Bileşenleri Yapılandırma" #: lazarusidestrconsts.liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "Bağlama duyarlı yardım" #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "Delphi paketini Lazarus paketine dönüştürme" #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi Project to Lazarus Project" msgstr "Delphi Projesini Lazarus Projesine Dönüştürme" #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit msgid "Convert Delphi Unit to Lazarus Unit" msgstr "Delphi Birimini Lazarus Birimine Dönüştür" #: lazarusidestrconsts.liskmconvertdfmfiletolfm msgid "Convert DFM File to LFM" msgstr "DFM Dosyasını LFM'ye Dönüştür" #: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard msgid "Copy selected components" msgstr "Seçili Bileşenleri panoya kopyala" #: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard msgid "Cut selected components" msgstr "Seçili Bileşenleri panoya kopyala" #: lazarusidestrconsts.liskmdefaulttoosx msgid "Default adapted to macOS" msgstr "MacOS'a uyarlanmış varsayılan" #: lazarusidestrconsts.liskmdeletelastchar msgid "Delete last char" msgstr "Son harfi sil" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff Editor Files" msgstr "Diff Editör Dosyaları" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" msgstr "Kod Şablonlarını Düzenle" #: lazarusidestrconsts.liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "Bağlama duyarlı yardımını düzenle" #: lazarusidestrconsts.liskmencloseselection msgid "Enclose Selection" msgstr "Seçimi Dahil Et" #: lazarusidestrconsts.liskmevaluatemodify msgid "Evaluate/Modify" msgstr "Değiştir / değerlendirin" #: lazarusidestrconsts.liskmexternaltoolssettings msgid "External Tools settings" msgstr "Harici Araçlar ayarları" #: lazarusidestrconsts.liskmfindincremental msgid "Find Incremental" msgstr "Artımlı Bul" #: lazarusidestrconsts.liskmgotomarker0 msgid "Go to bookmark 0" msgstr "0 işaretine git" #: lazarusidestrconsts.liskmgotomarker1 msgid "Go to bookmark 1" msgstr "İşaretleyiciye git 1" #: lazarusidestrconsts.liskmgotomarker2 msgid "Go to bookmark 2" msgstr "2. işaretçiye git" #: lazarusidestrconsts.liskmgotomarker3 msgid "Go to bookmark 3" msgstr "3. işaretçiye git" #: lazarusidestrconsts.liskmgotomarker4 msgid "Go to bookmark 4" msgstr "4 numaralı işaretçiye git" #: lazarusidestrconsts.liskmgotomarker5 msgid "Go to bookmark 5" msgstr "İşaretleyiciye git 5" #: lazarusidestrconsts.liskmgotomarker6 msgid "Go to bookmark 6" msgstr "İşaretleyiciye git 6" #: lazarusidestrconsts.liskmgotomarker7 msgid "Go to bookmark 7" msgstr "İşaretçiye git 7" #: lazarusidestrconsts.liskmgotomarker8 msgid "Go to bookmark 8" msgstr "İşaretleyiciye git 8" #: lazarusidestrconsts.liskmgotomarker9 msgid "Go to bookmark 9" msgstr "İşaretleyiciye git 9" #: lazarusidestrconsts.liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "Kaynak editöre git 1" #: lazarusidestrconsts.liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "Kaynak editöre git 10" #: lazarusidestrconsts.liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "Kaynak editörüne git 2" #: lazarusidestrconsts.liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "Kaynak editöre git 3" #: lazarusidestrconsts.liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "Kaynak editörüne git 4" #: lazarusidestrconsts.liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "Kaynak editöre git 5" #: lazarusidestrconsts.liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "Kaynak editöre git 6" #: lazarusidestrconsts.liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "Kaynak editöre git 7" #: lazarusidestrconsts.liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "Kaynak editöre git 8" #: lazarusidestrconsts.liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "Kaynak editöre git 9" #: lazarusidestrconsts.liskminsertdateandtime msgid "Insert date and time" msgstr "Tarih ve saat ekle" #: lazarusidestrconsts.liskminsertusername msgid "Insert username" msgstr "Kullanıcı adını ekle" #: lazarusidestrconsts.liskminspect msgid "Inspect" msgstr "Denetle" #: lazarusidestrconsts.liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "Tuş Haritası Şeması" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus default" msgstr "Lazarus (varsayılan)" #: lazarusidestrconsts.liskmmacosxapple msgid "macOS, Apple style" msgstr "mac OS X (Apple stili)" #: lazarusidestrconsts.liskmmacosxlaz msgid "macOS, Lazarus style" msgstr "mac OS X (Lazarus tarzı)" #: lazarusidestrconsts.liskmnewpackage msgid "New package" msgstr "Yeni paket" #: lazarusidestrconsts.liskmnewproject msgid "New project" msgstr "Yeni proje" #: lazarusidestrconsts.liskmnewprojectfromfile msgid "New project from file" msgstr "Dosyadan yeni proje" #: lazarusidestrconsts.liskmnewunit msgctxt "lazarusidestrconsts.liskmnewunit" msgid "New Unit" msgstr "Yeni Birim" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." msgstr "Not: Tüm tuşlar, seçilen şema değerlerine ayarlanacaktır." #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" msgstr "Paket dosyası aç" #: lazarusidestrconsts.liskmopenrecent msgctxt "lazarusidestrconsts.liskmopenrecent" msgid "Open Recent" msgstr "Son Açılanlar" #: lazarusidestrconsts.liskmopenrecentpackage msgid "Open recent package" msgstr "Son açılan paket" #: lazarusidestrconsts.liskmopenrecentproject msgid "Open recent project" msgstr "Son açılan proje" #: lazarusidestrconsts.liskmpastecomponentsfromclipboard msgid "Paste Components" msgstr "Bileşenleri panodan yapıştır" #: lazarusidestrconsts.liskmpauseprogram msgid "Pause program" msgstr "Programı duraklat" #: lazarusidestrconsts.liskmpublishproject msgid "Publish project" msgstr "Projeyi yayınla" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "Hızlı derleme, bağlama yok" #: lazarusidestrconsts.liskmremoveactivefilefromproject msgid "Remove Active File from Project" msgstr "Aktif Dosyayı Projeden Kaldır" #: lazarusidestrconsts.liskmrunprogram msgid "Run program" msgstr "Programı çalıştır" #: lazarusidestrconsts.liskmsaveall #, fuzzy #| msgid "SaveAll" msgctxt "lazarusidestrconsts.liskmsaveall" msgid "Save All" msgstr "Hepsini kaydet" #: lazarusidestrconsts.liskmsaveas #, fuzzy #| msgid "SaveAs" msgid "Save As" msgstr "Farklı kaydet" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" msgstr "Projeyi kaydet" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" msgstr "Projeyi farklı kaydet" #: lazarusidestrconsts.liskmselectlineend msgctxt "lazarusidestrconsts.liskmselectlineend" msgid "Select Line End" msgstr "Satır Sonunu Seçin" #: lazarusidestrconsts.liskmselectlinestart msgctxt "lazarusidestrconsts.liskmselectlinestart" msgid "Select Line Start" msgstr "Satır Başlamasını Seç" #: lazarusidestrconsts.liskmselectpagebottom msgctxt "lazarusidestrconsts.liskmselectpagebottom" msgid "Select Page Bottom" msgstr "Sayfa Altını Seç" #: lazarusidestrconsts.liskmselectpagetop msgctxt "lazarusidestrconsts.liskmselectpagetop" msgid "Select Page Top" msgstr "Sayfa Üstünü Seç" #: lazarusidestrconsts.liskmselectwordleft msgctxt "lazarusidestrconsts.liskmselectwordleft" msgid "Select Word Left" msgstr "Soldan Sözcük Seçin" #: lazarusidestrconsts.liskmselectwordright msgctxt "lazarusidestrconsts.liskmselectwordright" msgid "Select Word Right" msgstr "Sağdan Sözcük Seçin" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" msgstr "Serbest yer imi ayarla" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set bookmark 0" msgstr "Yer imini ayarla 0" #: lazarusidestrconsts.liskmsetmarker1 msgid "Set bookmark 1" msgstr "Yer imini ayarla 1" #: lazarusidestrconsts.liskmsetmarker2 msgid "Set bookmark 2" msgstr "Yer imini ayarla 2" #: lazarusidestrconsts.liskmsetmarker3 msgid "Set bookmark 3" msgstr "Yer imini ayarla 3" #: lazarusidestrconsts.liskmsetmarker4 msgid "Set bookmark 4" msgstr "Yer imini ayarla 4" #: lazarusidestrconsts.liskmsetmarker5 msgid "Set bookmark 5" msgstr "Yer imini ayarla 5" #: lazarusidestrconsts.liskmsetmarker6 msgid "Set bookmark 6" msgstr "Yer imini ayarla 6" #: lazarusidestrconsts.liskmsetmarker7 msgid "Set bookmark 7" msgstr "Yer imini ayarla 7" #: lazarusidestrconsts.liskmsetmarker8 msgid "Set bookmark 8" msgstr "Yer imini ayarla 8" #: lazarusidestrconsts.liskmsetmarker9 msgid "Set bookmark 9" msgstr "Yer imini ayarla 9" #: lazarusidestrconsts.liskmstopprogram msgid "Stop Program" msgstr "Programı Durdur" #: lazarusidestrconsts.liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "Birim ve Form arasında geçiş yap" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle bookmark 0" msgstr "Yer imini değiştir 0" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle bookmark 1" msgstr "Yer imini değiştir 1" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle bookmark 2" msgstr "Yer imini değiştir 2" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle bookmark 3" msgstr "Yer imini değiştir 3" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle bookmark 4" msgstr "Yer imini değiştir 4" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle bookmark 5" msgstr "Yer imini değiştir 5" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle bookmark 6" msgstr "Yer imini değiştir 6" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle bookmark 7" msgstr "Yer imini değiştir 7" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle bookmark 8" msgstr "Yer imini değiştir 8" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle bookmark 9" msgstr "Yer imini değiştir 9" #: lazarusidestrconsts.liskmtoggleviewassembler msgctxt "lazarusidestrconsts.liskmtoggleviewassembler" msgid "View Assembler" msgstr "Assembler Görüntüle" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "View Breakpoints" msgstr "Kesme noktalarını görüntüle" #: lazarusidestrconsts.liskmtoggleviewcallstack msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack" msgid "View Call Stack" msgstr "Çağrı Yığını Göster" #: lazarusidestrconsts.liskmtoggleviewcodebrowser msgid "Toggle view Code Browser" msgstr "Kod Tarayıcısı görünümü Aç/Kapat" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "Kod Gezgini görünümünü Aç/Kapat" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle View Component Palette" msgstr "Bileşen Paleti görünümü Aç/Kapat" #: lazarusidestrconsts.liskmtoggleviewdebugevents msgid "View Debuger Event Log" msgstr "Hata Ayıklama Olay Günlüğünü Göster" #: lazarusidestrconsts.liskmtoggleviewdebuggeroutput msgid "View Debugger Output" msgstr "Hata Ayıklayıcı Çıktısı görüntüle" #: lazarusidestrconsts.liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "Belge Düzenleyicisi görünümüne geçiş yap" #: lazarusidestrconsts.liskmtoggleviewhistory msgctxt "lazarusidestrconsts.liskmtoggleviewhistory" msgid "View History" msgstr "Geçmişi Görüntüle" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "IDE hızlı düğmeleri görünümü Aç/Kapat" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "View Local Variables" msgstr "Yerel Değişkenleri Görüntüle" #: lazarusidestrconsts.liskmtoggleviewmemviewer msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer" msgid "View Mem viewer" msgstr "" #: lazarusidestrconsts.liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "Mesajları görüntülemeyi aç / kapat" #: lazarusidestrconsts.liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "esne denetçisini görüntülemeyi aç / kapat" #: lazarusidestrconsts.liskmtoggleviewpseudoterminal msgid "View Console In/Output" msgstr "Terminal Çıkışını Görüntüle" #: lazarusidestrconsts.liskmtoggleviewregisters msgid "View Registers" msgstr "Kayıtları Görüntüle" #: lazarusidestrconsts.liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "Arama Sonuçlarını Görüntüle/Kapat" #: lazarusidestrconsts.liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "Kaynak Düzenleyici görünümünü değiştir" #: lazarusidestrconsts.liskmtoggleviewthreads msgctxt "lazarusidestrconsts.liskmtoggleviewthreads" msgid "View Threads" msgstr "Threads Görüntüle" #: lazarusidestrconsts.liskmtoggleviewwatches msgid "View Watches" msgstr "İzlemeleri Görüntüle" #: lazarusidestrconsts.liskmviewjumphistory msgid "View jump history" msgstr "Atlama geçmişini görüntüle" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" msgstr "Proje seçeneklerini görüntüle" #: lazarusidestrconsts.liskmviewprojectsource msgid "View Project Source" msgstr "Proje Kaynağını Görüntüle" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" msgstr "Birim Bilgisini Görüntüle" #: lazarusidestrconsts.lislastopened msgid "Last opened" msgstr "Son açılan" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "Başlatma uygulaması geçersiz" #: lazarusidestrconsts.lislaunchingcmdline msgid "Launching target command line" msgstr "Hedef komut satırı başlatılıyor" #: lazarusidestrconsts.lislazarusdefault msgid "Lazarus Default" msgstr "Lazarus Varsayılan" #: lazarusidestrconsts.lislazarusdirectory msgid "Lazarus directory" msgstr "Lazarus dizini" #: lazarusidestrconsts.lislazarusdirhint #, object-pascal-format msgid "Lazarus sources. This path is relative to primary config directory (%s)." msgstr "Lazarus kaynakları. Bu yol, birincil yapılandırma dizinine (%s) bağlıdır." #: lazarusidestrconsts.lislazarusdiroverride msgid "Directory to be used as a basedirectory." msgstr "Basedirectory olarak kullanılacak dizin." #: lazarusidestrconsts.lislazaruseditorv #, object-pascal-format msgid "Lazarus IDE v%s" msgstr "Lazarus IDE v%s" #: lazarusidestrconsts.lislazaruside msgid "Lazarus IDE" msgstr "Lazarus IDE" #: lazarusidestrconsts.lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "Lazarus dil kimliği (ör. En, de, tr, fi)" #: lazarusidestrconsts.lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "Lazarus dil adı (ör. Ingilizce, türkçe)" #: lazarusidestrconsts.lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [seçenekler] " #: lazarusidestrconsts.lislazbuild msgid "lazbuild" msgstr "lazbuild" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "IDE yürütülebilir dosyasının çıktı dizinini seçin " #: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile msgid "Are you sure you want to delete this build profile?" msgstr "Bu yapı profilini silmek istediğinizden emin misiniz?" #: lazarusidestrconsts.lislazbuildbuildmany msgid "Build Many" msgstr "Birçok inşa" #: lazarusidestrconsts.lislazbuildcommonsettings msgid "Common Settings" msgstr "Ortak Ayarlar" #: lazarusidestrconsts.lislazbuildconfirmbuild msgid "Confirm before build" msgstr "İnşaa öncesi onaylayın" #: lazarusidestrconsts.lislazbuildconfirmdeletion msgid "Confirm deletion" msgstr "Silmeyi onayla" #: lazarusidestrconsts.lislazbuilddebugide msgid "Debug IDE" msgstr "IDE hata ayıklama" #: lazarusidestrconsts.lislazbuilddefines msgid "Defines" msgstr "Tanımlar" #: lazarusidestrconsts.lislazbuilddefineswithoutd msgid "Defines without -d" msgstr "-d olmadan tanımlar" #: lazarusidestrconsts.lislazbuildeditdefines msgid "Edit Defines" msgstr "Tanımları Düzenle" #: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile msgid "Edit list of defines which can be used by any profile" msgstr "Herhangi bir profil tarafından kullanılabilecek tanımların listesini düzenleyin" #: lazarusidestrconsts.lislazbuilderrorwritingfile msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" msgid "Error writing file" msgstr "Dosya yazarken hata oluştu" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow #, object-pascal-format msgid "%s%s%s%slazbuild is non interactive, aborting now." msgstr "%s %s %s %slazbuild etkileşimli değil, şimdi iptal ediliyor." #: lazarusidestrconsts.lislazbuildmanageprofiles msgid "Manage Build Profiles" msgstr "Yapı Profillerini Yönet" #: lazarusidestrconsts.lislazbuildmanageprofiles2 msgid "Manage profiles" msgstr "Profilleri yönet" #: lazarusidestrconsts.lislazbuildnameoftheactiveprofile msgid "Name of the active profile" msgstr "Etkin profilin adı" #: lazarusidestrconsts.lislazbuildnewprof msgid "Add New Profile" msgstr "Yeni Profil Ekle" #: lazarusidestrconsts.lislazbuildnewprofinfo msgid "Current build options will be associated with:" msgstr "Mevcut derleme seçenekleri şunlarla ilişkilendirilecektir:" #: lazarusidestrconsts.lislazbuildnormalide msgid "Normal IDE" msgstr "Normal IDE" #: lazarusidestrconsts.lislazbuildoptimizedide msgid "Optimized IDE" msgstr "İyileştirilmiş IDE" #: lazarusidestrconsts.lislazbuildoptions msgid "Options:" msgstr "Seçenekler:" #: lazarusidestrconsts.lislazbuildoptionspassedtocompiler msgid "Options passed to compiler" msgstr "Derleyiciye geçirilen seçenekler" #: lazarusidestrconsts.lislazbuildoptionssyntax msgid "lazbuild [options] " msgstr "lazbuild [options] " #: lazarusidestrconsts.lislazbuildprofile msgid "Profile to build" msgstr "Profile göre derle" #: lazarusidestrconsts.lislazbuildrenameprof msgid "Rename Profile" msgstr "Profili Yeniden Adlandır" #: lazarusidestrconsts.lislazbuildrenameprofinfo msgid "New name for profile:" msgstr "Profilin yeni adı:" #: lazarusidestrconsts.lislazbuildrestartafterbuild msgid "Restart after building IDE" msgstr "IDE kurduktan sonra yeniden başlatın" #: lazarusidestrconsts.lislazbuildrestartlazarusautomatically msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" msgstr "IDE'yi oluşturduktan sonra Lazarus'u otomatik olarak yeniden başlatın (diğer parçaları oluştururken hiçbir etkisi yoktur)" #: lazarusidestrconsts.lislazbuildselectprofilestobuild msgid "Select profiles to build" msgstr "Oluşturulacak profilleri seçin" #: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding msgid "Show confirmation dialog when building directly from Tools menu" msgstr "Doğrudan Araçlar menüsünden oluştururken onay iletişim kutusunu göster" #: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline msgid "Show options and defines for command line" msgstr "Komut satırı için seçenekleri ve tanımları göster" #: lazarusidestrconsts.lislazbuildtargetcpu msgid "Target CPU:" msgstr "Hedef CPU:" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" msgstr "Hedef klasör:" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" msgstr "Hedef İşletim Sistemi:" #: lazarusidestrconsts.lislazbuildunabletowritefile #, object-pascal-format msgid "Unable to write file \"%s\":%s" msgstr "Dosya \"%s\" yazamadı: %s" #: lazarusidestrconsts.lislazbuildupdaterevinc msgid "Update revision.inc" msgstr "Güncelle revizyon.inc" #: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog msgid "Update revision info in \"About Lazarus\" dialog" msgstr "\"Lazarus Hakkında\" iletişim kutusundaki düzeltme bilgisini güncelle" #: lazarusidestrconsts.lislazcleanupbuildall msgid "Clean Up + Build all" msgstr "Temizle + Hepsini kur" #: lazarusidestrconsts.lislazver msgid "Lazarus Version (e.g. 1.2.4)" msgstr "Lazarus Sürümü (ör. 1.2.4)" #: lazarusidestrconsts.lislclwidgettype msgid "LCL widget type" msgstr "LCL widget türü" #: lazarusidestrconsts.lisldaddlinktoinherited msgid "Add link to inherited" msgstr "Devralınan bağlantı ekle" #: lazarusidestrconsts.lisldcopyfrominherited msgid "Copy from inherited" msgstr "Devralınandan kopyala" #: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo #, object-pascal-format msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s" msgstr "%s geçerli bir FPDoc yolu yok.%s %s için fpdoc dosyası oluşturmaktan vazgeç" #: lazarusidestrconsts.lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "Girişleri devralınanlara taşı" #: lazarusidestrconsts.lisldnovalidfpdocpath msgid "No valid FPDoc path" msgstr "Geçerli FPDoc yolu yok" #: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe #, object-pascal-format msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "%s birimi herhangi bir paket veya proje değil.%sLütfen birimi bir pakete veya projeye ekleyin.%s fpdoc dosyası oluşturulamadı." #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" msgid "Left" msgstr "Sol" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "Sol sınır alanı. Bu değer base borderspace'e eklenir ve kontrole bırakılan boşluk için kullanılır." #: lazarusidestrconsts.lisleftgroupboxcaption msgid "Left anchoring" msgstr "Sola tuttur" #: lazarusidestrconsts.lisleftgutter #, fuzzy #| msgid "Left Gutter" msgctxt "lazarusidestrconsts.lisleftgutter" msgid "Left" msgstr "Sol Oluk" #: lazarusidestrconsts.lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "Bu, sol tarafın tutturulduğu kardeş kontroldür. Delphi stilinde ebeveyne sabitlemek için boş bırakın (BorderSpacing ve ReferenceSide önemli değildir)." #: lazarusidestrconsts.lisleftsides msgid "Left sides" msgstr "Sol taraf" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" msgstr "Sol boşluk eşit" #: lazarusidestrconsts.lisless msgid "Less" msgstr "Az" #: lazarusidestrconsts.lislevels msgctxt "lazarusidestrconsts.lislevels" msgid "Levels" msgstr "Seviyeler" #: lazarusidestrconsts.lislfmfile msgid "LFM file" msgstr "LFM dosyası" #: lazarusidestrconsts.lislfmfilecontainsinvalidproperties msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." msgstr "LFM dosyası, LCL'de bulunmayan bilinmeyen özellikler / sınıflar içeriyor. Bunlar değiştirilebilir veya kaldırılabilir." #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" msgstr "LFM dosyası bozuk" #: lazarusidestrconsts.lislfmisok msgid "LFM is ok" msgstr "LFM tamam" #: lazarusidestrconsts.lislgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" "\n" "\n" "Telif Hakkı (C) \n" "\n" "Bu kütüphane ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Kütüphanesi Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; Lisansın 2. sürümü veya (isteğe bağlı olarak) daha sonraki bir sürüm.\n" "\n" "Bu program faydalı olacağı umuduyla dağıtılmıştır; HİÇBİR AMAÇLI OLMAK İÇİN TİCARİRLİK veya FİTNESS'in zımni garantisi olmadan. Daha fazla bilgi için GNU Kütüphanesi Genel Kamu Lisansına bakınız.\n" "\n" "Bu kütüphaneyle birlikte GNU Kütüphanesi Genel Kamu Lisansının bir kopyasını almış olmalısınız; değilse, Özgür Yazılım Vakfı, Inc., 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazınız." #: lazarusidestrconsts.lislibrarypath msgid "library path" msgstr "kütüphane yolu" #: lazarusidestrconsts.lislibraryprogramdescriptor msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)." msgstr "Free Pascal paylaşılan kütüphanesi (Windows altında .dll, Linux'ta .so, MacOS X altında .dylib)." #: lazarusidestrconsts.lislink msgid "Link:" msgstr "Bağlantı:" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" msgstr "bağlayıcı seçenekleri" #: lazarusidestrconsts.lislinktarget msgid "Link target" msgstr "Bağlantı hedefi" #: lazarusidestrconsts.lislistofallcasevalues msgid "list of all case values" msgstr "tüm case değerlerinin listesi" #: lazarusidestrconsts.lisloadingfailed #, object-pascal-format msgid "Loading %s failed." msgstr "%s yüklemesi başarısız oldu." #: lazarusidestrconsts.lisloadmacrofrom msgid "Load macro from" msgstr "Makroyu yükle" #: lazarusidestrconsts.lislocal msgid "&Local" msgstr "&Yerel" #: lazarusidestrconsts.lislowercasestring msgid "lowercase string" msgstr "küçük harfli string" #: lazarusidestrconsts.lislowercasestringgivenasparameter msgid "Lowercase string given as parameter." msgstr "Parametre olarak verilen küçük harfli string." #: lazarusidestrconsts.lislpicompatibilitymodecheckbox msgid "Maximize compatibility of project files (LPI and LPS)" msgstr "Proje dosyalarının uyumluluğunu en üst düzeye çıkarın (LPI ve LPS)" #: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions." msgstr "Projenizi eski (2.0 ve daha eski) Lazarus sürümlerinde açmak istiyorsanız bunu kontrol edin." #: lazarusidestrconsts.lislpkcompatibilitymodecheckbox msgid "Maximize compatibility of package file (LPK)" msgstr "Paket dosyasının (LPK) uyumluluğunu en üst düzeye çıkarın" #: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions." msgstr "Projenizi eski (2.0 ve daha eski) Lazarus sürümlerinde açmak istiyorsanız bunu kontrol edin." #: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative #, object-pascal-format msgid "lpk has vanished on disk. Using as alternative%s" msgstr "lpk disk üzerinde kayboldu, alternatif olarak kullan %s" #: lazarusidestrconsts.lislpkismissing msgid "lpk is missing" msgstr "lpk eksik" #: lazarusidestrconsts.lislrsincludefiles msgid "Lazarus resources (.lrs) include files" msgstr "Lazarus kaynakları (.lrs)" #: lazarusidestrconsts.lismacpreferences msgid "Preferences..." msgstr "Seçenekler.." #: lazarusidestrconsts.lismacro #, object-pascal-format msgid "Macro %s" msgstr "Makro %s" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" msgstr "Verileri girin" #: lazarusidestrconsts.lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Çalıştırma parametrelerini girin" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject msgid "Main unit has Uses section containing all units of project" msgstr "Ana birim, tüm proje birimlerini içeren Uses bölümüne sahiptir" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main unit is Pascal source" msgstr "Ana ünite Pascal kaynağı" #: lazarusidestrconsts.lismainunitispascalsourcehint msgid "Assume Pascal even if it does not end with .pas/.pp suffix." msgstr "Pascal'ı .pas / .pp son ekiyle bitmese bile varsayın." #: lazarusidestrconsts.lismajorchangesdetected msgid "Major changes detected" msgstr "Büyük değişiklikler tespit edildi" #: lazarusidestrconsts.lismakecurrent msgctxt "lazarusidestrconsts.lismakecurrent" msgid "Current" msgstr "Geçerli" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" msgstr "Yürütülebilir Dosyayı Yap" #: lazarusidestrconsts.lismakenotfound msgid "Make not found" msgstr "Make Bulunamadı" #: lazarusidestrconsts.lismakeresourcestring msgid "Make ResourceString" msgstr "Make ResourceString" #: lazarusidestrconsts.lismakeresstrappendtosection msgid "Append to section" msgstr "Bölümüne ekle" #: lazarusidestrconsts.lismakeresstrchooseanothername #, object-pascal-format msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "\"%s\" kaynak zaten var.%sLütfen başka bir ad seçin.%s Yine de eklemek için Yoksay'ı kullanın." #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" msgstr "Dönüşüm Seçenekleri" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "Özel tanımlayıcı" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" msgid "Identifier" msgstr "Tanıtıcı" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" msgstr "Tanımlayıcı uzunluğu:" #: lazarusidestrconsts.lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "Tanımlayıcı öneki:" #: lazarusidestrconsts.lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "Alfabetik olarak ekle" #: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "İçeriğe duyarlı ekle" #: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "Geçersiz Kaynak string seçimi" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "Lütfen listeden bir kaynak dizisi bölümü seçin." #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "Kaynak string zaten var" #: lazarusidestrconsts.lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "Kaynak string seçimi:" #: lazarusidestrconsts.lismakeresstrsourcepreview msgid "Source preview" msgstr "Kaynak önizleme" #: lazarusidestrconsts.lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "Kaynaktaki string sabiti" #: lazarusidestrconsts.lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Aynı değere sahip stringler:" #: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto msgid "Make sure all ppu files of a package are in its output directory." msgstr "Bir paketin tüm ppu dosyalarının çıkış dizininde olduğundan emin olun." #: lazarusidestrconsts.lismanagesourceeditors msgid "Manage Source Editors ..." msgstr "Kaynak Düzenleyicileri Yönet ..." #: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system." msgstr "Paralel derleme için maksimum iş parçacığı sayısı. Varsayılan değer 0'dır ve sistemdeki çekirdek sayısını tahmin eder." #: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault #, object-pascal-format msgid "Maximum parallel processes, 0 means default (%s)" msgstr "Maksimum paralel işlemler, 0 varsayılan (%s) anlamına gelir" #: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage #, object-pascal-format msgid "%s Maybe you have to recompile the package." msgstr "%s Belki de paketi yeniden derlemelisiniz." #: lazarusidestrconsts.lismb #, object-pascal-format msgid "%s MB" msgstr "%s MB" #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" msgstr "Yapımı iptal et" #: lazarusidestrconsts.lismenuaboutfpc msgid "About FPC" msgstr "FPC Hakkında" #: lazarusidestrconsts.lismenuaddbreakpoint msgid "Add &Breakpoint" msgstr "Ekle ve Kesme Noktası" #: lazarusidestrconsts.lismenuaddcurfiletopkg msgid "Add Active File to Package ..." msgstr "Aktif Dosya Paketine Ekle ..." #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add Jump Point to History" msgstr "Geçmişe Atlama Noktası Ekle" #: lazarusidestrconsts.lismenuaddtoproject msgid "Add Editor File to Project" msgstr "Editör Dosyasını Projeye Ekle" #: lazarusidestrconsts.lismenuaddwatch msgid "Add &Watch ..." msgstr "&İzleme Ekle ..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in Selection" msgstr "Seçimde Kesme Hatları" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" msgstr "Dosya Oluştur" #: lazarusidestrconsts.lismenubuildlazarus msgid "Build Lazarus with Current Profile" msgstr "Mevcut Profille Lazarus Oluştur" #: lazarusidestrconsts.lismenubuildlazarusprof #, object-pascal-format msgid "Build Lazarus with Profile: %s" msgstr "Lazarus'u Profille oluştur: %s" #: lazarusidestrconsts.lismenuchecklfm msgid "Check LFM File in Editor" msgstr "Düzenleyicide LFM Dosyasını Denetle" #: lazarusidestrconsts.lismenucleandirectory msgid "Clean Directory ..." msgstr "Klasörü temizle ..." #: lazarusidestrconsts.lismenucleanupandbuild msgid "Clean up and Build ..." msgstr "Temizle ve kur ..." #: lazarusidestrconsts.lismenucloseeditorfile msgid "&Close Editor File" msgstr "&Editör Dosyasını Kapat" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" msgstr "Projeyi Kapat" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools Defines Editor ..." msgstr "Kod Araçları Tanımları Düzenleyici..." #: lazarusidestrconsts.lismenucommentselection msgid "Comment Selection" msgstr "Yorum Seçimi" #: lazarusidestrconsts.lismenucomparefiles msgid "Compare files ..." msgstr "Dosyaları karşılaştır ..." #: lazarusidestrconsts.lismenucompilemanymodes msgid "Compile many Modes ..." msgstr "Birçok Modda Derleyin ..." #: lazarusidestrconsts.lismenucompletecode msgid "Complete Code" msgstr "Kodu Tamamla" #: lazarusidestrconsts.lismenucompletecodeinteractive msgid "Complete Code (with dialog)" msgstr "Kodu Tamamla (iletişim kutusuyla)" #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Yapı Yapı + Dosyayı Çalıştır ..." #: lazarusidestrconsts.lismenuconfigcustomcomps msgid "Configure Custom Components ..." msgstr "Özel Bileşenleri Yapılandır ..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure External Tools ..." msgstr "Dış Araçları Yapılandır ..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "\"Lazarus oluşturmayı\" Yapılandır..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" msgstr "Bağlama duyarlı Yardım" #: lazarusidestrconsts.lismenuconvertdelphipackage msgid "Convert Delphi Package to Lazarus Package ..." msgstr "Delphi Paketini Lazarus Paketine Dönüştür ..." #: lazarusidestrconsts.lismenuconvertdelphiproject msgid "Convert Delphi Project to Lazarus Project ..." msgstr "Delphi Projesini Lazarus Projesine Dönüştür ..." #: lazarusidestrconsts.lismenuconvertdelphiunit msgid "Convert Delphi Unit to Lazarus Unit ..." msgstr "Delphi Birimini Lazarus Birimine Dönüştür ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm msgid "Convert Binary DFM to LFM ..." msgstr "İkili DFM'yi Metin LFM'ye Dönüştür..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert Encoding of Projects/Packages ..." msgstr "Projelerin / Paketlerin Kodlamasını Dönüştür ..." #: lazarusidestrconsts.lismenudebugwindows msgid "Debug Windows" msgstr "Hata Ayıklama penceresi" #: lazarusidestrconsts.lismenudelphiconversion msgid "Delphi Conversion" msgstr "Delphi Dönüşümü" #: lazarusidestrconsts.lismenuedit msgid "&Edit" msgstr "&Düzen" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." msgstr "Kod Şablonları ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "Bağlama duyarlı Yardımını düzenle" #: lazarusidestrconsts.lismenueditinstallpkgs msgid "Install/Uninstall Packages ..." msgstr "Paketleri Yükle / Kaldır ..." #: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging #, object-pascal-format msgid "Accelerator(&&) key \"%s\" needs changing" msgstr "Hızlandırıcı(&&) tuşunun \"%s\" değişmesi gerekiyor" #: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem msgid "Add a new item above selected item" msgstr "Seçili öğenin üstüne yeni bir öğe ekle" #: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem msgid "Add a new item after selected item" msgstr "Seçili öğeden sonra yeni bir öğe ekle" #: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem msgid "Add a new item before selected item" msgstr "Seçili öğeden önce yeni bir öğe ekle" #: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem msgid "Add a new item below selected item" msgstr "Seçili öğenin altına yeni bir öğe ekle" #: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem msgid "Add a submenu at the right of selected item" msgstr "Seçili öğenin sağına bir alt menü ekle" #: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem msgid "Add a submenu below selected item" msgstr "Seçili öğenin altına bir alt menü ekle" #: lazarusidestrconsts.lismenueditoraddfromtemplate msgid "&Add from template ..." msgstr "&Şablondan ekle...." #: lazarusidestrconsts.lismenueditoraddiconfroms #, object-pascal-format msgid "Add icon from %s" msgstr "%s 'den simge ekle" #: lazarusidestrconsts.lismenueditoraddimagelisticon msgid "Add imagelist &icon" msgstr "İmge ve sim&ge ekle" #: lazarusidestrconsts.lismenueditoraddmenuitem msgid "Add menu item" msgstr "Menü öğesi ekle" #: lazarusidestrconsts.lismenueditoraddnewitemabove msgid "&Add new item above" msgstr "&Yukarıya yeni öğe ekle" #: lazarusidestrconsts.lismenueditoraddnewitemafter msgid "Add ne&w item after" msgstr "Sonuna yen&i öğe ekle" #: lazarusidestrconsts.lismenueditoraddnewitembefore msgid "&Add new item before" msgstr "Ön&üne yeni öğe ekle" #: lazarusidestrconsts.lismenueditoraddnewitembelow msgid "Add ne&w item below" msgstr "Aşağıya ¥i öğe ekle" #: lazarusidestrconsts.lismenueditoraddonclickhandler msgid "Add &OnClick handler" msgstr "&Tıklama (OnClick) işleyicisi ekle" #: lazarusidestrconsts.lismenueditoraddseparatorafter msgid "Add separator &after" msgstr "&Sonuna Ayırıcı ekle" #: lazarusidestrconsts.lismenueditoraddseparatorbefore msgid "Add separator &before" msgstr "&Önüne Ayırıcı ekle" #: lazarusidestrconsts.lismenueditoraddsubmenu msgid "Add submenu" msgstr "Alt menü ekle" #: lazarusidestrconsts.lismenueditoraddsubmenubelow msgid "Add &submenu below" msgstr "Aşağıya &alt menü ekle" #: lazarusidestrconsts.lismenueditoraddsubmenuright msgid "Add &submenu right" msgstr "Sağa alt menü e&kle" #: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved #, object-pascal-format msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items" msgstr "\"%s\" olarak tanımlanan yeni bir menü şablonu temelinde %s,%d alt öğeyle kaydedildi" #: lazarusidestrconsts.lismenueditorbasiceditmenutemplate msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,," msgstr "&Düzenle,Temel düzenle menüsü&Gerial,CTRL+Z,&İleri al,,-,,&Tümünü Seç,Ctrl+A,&Kes,Ctrl+X,K&opyala,Ctrl+C,&Yapıştır,Ctrl+V,&Özel yapıştır,,-,,A&ra,,D&eğiştir,,&Git ...,," #: lazarusidestrconsts.lismenueditorbasicfilemenutemplate msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,," msgstr "&Dosya,Temel dosya menüsü,&Yeni,,&Aç ...,,&Kaydet,&Farklı Kaydet,,-,,&Yazdır,,Ya&zıcı ayarları...,,-,,&Çıkış,," #: lazarusidestrconsts.lismenueditorbasichelpmenutemplate msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,," msgstr "&Yardım,&Temel yardım menüsü,Yardım ve &İçindekiler, F1, Ya&rdım ve Dizin,, &Çevrimiçi Yardım,,-,&Lisans Bilgisi,&Güncellemeleri Kontrol Et,,-,&Hakkında,," #: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,," msgstr "&Pencere,&Temel pencere menüsü, &Yeni Pencere, &Döşe,,&Kademeli, &Tümünü düzenle,,-,,&Gizle,,&Göster ,," #: lazarusidestrconsts.lismenueditorcaption msgid "Caption" msgstr "Başlık" #: lazarusidestrconsts.lismenueditorcaptioneditemss #, object-pascal-format msgid "Captioned items: %s" msgstr "Altyazılı öğeler: %s" #: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank msgid "Caption should not be blank" msgstr "Başlık boş olmamalıdır" #: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators #, object-pascal-format msgid "Change conflicting accelerator \"%s\"" msgstr "Çakışan hızlandırıcıyı \"%s\" değiştir" #: lazarusidestrconsts.lismenueditorchangeimagelisticon msgid "Change imagelist &icon" msgstr "İmgeleyici ve &simgeyi değiştir" #: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent #, object-pascal-format msgid "Change %s for %s" msgstr "%s için %s değiştir" #: lazarusidestrconsts.lismenueditorchangeshortcutconflicts #, object-pascal-format msgid "Change shortcut conflict \"%s\"" msgstr "\"%s\" kısayol çakışmasını değiştir" #: lazarusidestrconsts.lismenueditorchangetheshortcutfors #, object-pascal-format msgid "Change the shortCut for %s" msgstr "Kısayol öğesini %s için değiştirin" #: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors #, object-pascal-format msgid "Change the shortCutKey2 for %s" msgstr "Kısayol2 öğesini %s için değiştirin" #: lazarusidestrconsts.lismenueditorchoosetemplatetodelete msgid "Choose template to delete" msgstr "Silinecek şablonu seçin" #: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert msgid "Choose template to insert" msgstr "Eklenecek şablonu seçin" #: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column" msgstr "Kısayolunu düzenlemek için grileşmemiş bir öğeyi tıklayın veya o sütuna göre sıralamak için başlığı tıklayın" #: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind msgid "Component is unexpected kind" msgstr "Bileşen beklenmedik bir tür" #: lazarusidestrconsts.lismenueditorcomponentisunnamed msgid "Component is unnamed" msgstr "Bileşen adlandırılmamış" #: lazarusidestrconsts.lismenueditorconflictresolutioncomplete msgid "" msgstr "<çakışma çözümü tamamlandı>" #: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd #, object-pascal-format msgid "Conflicts found initially: %d" msgstr "Başlangıçta bulunan çakışmalar: %d" #: lazarusidestrconsts.lismenueditordeepestnestedmenulevels #, object-pascal-format msgid "Deepest nested menu level: %s" msgstr "En derin iç içe menü seviyesi: %s" #: lazarusidestrconsts.lismenueditordeleteitem msgid "&Delete item" msgstr "&Öğeyi sil" #: lazarusidestrconsts.lismenueditordeletemenutemplate msgid "&Delete menu template ..." msgstr "Menü şablonunu &sil ..." #: lazarusidestrconsts.lismenueditordeletesavedmenutemplate msgid "Delete saved menu template" msgstr "Kayıtlı menü şablonunu sil" #: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate msgid "Delete selected menu template" msgstr "Seçili menü şablonunu sil" #: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems msgid "Delete this item and its subitems?" msgstr "Bu öğe ve alt öğeler silinsin mi?" #: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu msgid "Display preview as &Popup menu" msgstr "Açılır &menü önizlemesini görüntüle" #: lazarusidestrconsts.lismenueditoreditcaption msgid "Edit &Caption" msgstr "&Başlığı düzenle" #: lazarusidestrconsts.lismenueditoreditingcaptionofs #, object-pascal-format msgid "Editing Caption of %s" msgstr "%s Başlığını Düzenleme" #: lazarusidestrconsts.lismenueditoreditingsdots #, object-pascal-format msgid "To resolve conflict edit %s.%s" msgstr "Çakışmayı çözmek için %s.%s'yi düzenleyin" #: lazarusidestrconsts.lismenueditoreditingsfors #, object-pascal-format msgid "Editing %s for %s" msgstr "%s için %s düzenleme" #: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected #, object-pascal-format msgid "Editing %s.%s - no menuitem selected" msgstr "%s.%s düzenleniyor - menü öğesi seçilmedi" #: lazarusidestrconsts.lismenueditorenteramenudescription msgid "Enter a menu &Description:" msgstr "Bir menü &açıklaması girin:" #: lazarusidestrconsts.lismenueditorenteranewshortcutfors #, object-pascal-format msgid "Enter a new ShortCut for %s" msgstr "%s için yeni bir kısayol girin" #: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors #, object-pascal-format msgid "Enter a new ShortCutKey2 for %s" msgstr "%s için yeni bir Kısyoltuşu2 girin" #: lazarusidestrconsts.lismenueditorexistingsavedtemplates msgid "Existing saved templates" msgstr "Mevcut kaydedilmiş şablonlar" #: lazarusidestrconsts.lismenueditorfurthershortcutconflict msgid "Further shortcut conflict" msgstr "Daha fazla kısayol çakışması" #: lazarusidestrconsts.lismenueditorgethelptousethiseditor msgid "Get help to use this editor" msgstr "Bu editörü kullanmak için yardım alın" #: lazarusidestrconsts.lismenueditorgrabkey msgid "&Grab key" msgstr "&Tutma tuşu" #: lazarusidestrconsts.lismenueditorgroupindexd #, object-pascal-format msgid "GroupIndex: %d" msgstr "GroupIndex: %d" #: lazarusidestrconsts.lismenueditorgroupindexvaluess #, object-pascal-format msgid "Values in use: %s" msgstr "Kullanılan değerler: %s" #: lazarusidestrconsts.lismenueditorinadequatedescription msgid "Inadequate Description" msgstr "Yetersiz Açıklama" #: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs #, object-pascal-format msgid "Insert menu template into root of %s" msgstr "Menü şablonunu %s köküne ekle" #: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate msgid "Insert selected menu template" msgstr "Seçili menü şablonunu ekle" #: lazarusidestrconsts.lismenueditorisnotassigned msgid "is not assigned" msgstr "atanmamış" #: lazarusidestrconsts.lismenueditoritemswithicons #, object-pascal-format msgid "Items with icon: %s" msgstr "Simgeli öğeler: %s" #: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators #, object-pascal-format msgid "List shortcuts and &accelerators for %s ..." msgstr "%s için kısayolları ve &hızlandırıcıları listele ..." #: lazarusidestrconsts.lismenueditorlistshortcutsfors #, object-pascal-format msgid "List shortcuts for %s ..." msgstr "%s kısayollarını listele ..." #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" msgstr "Menü Düzenleyici" #: lazarusidestrconsts.lismenueditormenuitemactions msgid "Menu Item actions" msgstr "Menü Öğesi eylemleri" #: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins #, object-pascal-format msgid "Menuitem shortcut conflicts in %s" msgstr "%s içindeki menü öğesi kısayolu çakışıyor" #: lazarusidestrconsts.lismenueditormoveitemdown msgid "Mo&ve item down" msgstr "Aşağı taşı" #: lazarusidestrconsts.lismenueditormoveitemleft msgid "&Move item left" msgstr "Sola taşı" #: lazarusidestrconsts.lismenueditormoveitemright msgid "Mo&ve item right" msgstr "Sağa taşı" #: lazarusidestrconsts.lismenueditormoveitemup msgid "&Move item up" msgstr "Yukarı taşı" #: lazarusidestrconsts.lismenueditormoveselecteditemdown msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown" msgid "Move selected item down" msgstr "Seçili öğeyi aşağı taşı" #: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft msgid "Move selected item to the left" msgstr "Seçili öğeyi sola taşı" #: lazarusidestrconsts.lismenueditormoveselecteditemtotheright msgid "Move selected item to the right" msgstr "Seçili öğeyi sağa taşı" #: lazarusidestrconsts.lismenueditormoveselecteditemup msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup" msgid "Move selected item up" msgstr "Seçili öğeyi yukarı taşı" #: lazarusidestrconsts.lismenueditorna msgid "n/a" msgstr "n/a" #: lazarusidestrconsts.lismenueditornomenuselected msgid "(no menu selected)" msgstr "(menü seçilmedi)" #: lazarusidestrconsts.lismenueditornone msgid "" msgstr "" #: lazarusidestrconsts.lismenueditornonenone msgid "," msgstr "," #: lazarusidestrconsts.lismenueditornoshortcutconflicts msgid "" msgstr "" #: lazarusidestrconsts.lismenueditornousersavedtemplates msgid "No user-saved templates" msgstr "Kullanıcının kaydettiği şablon yok" #: lazarusidestrconsts.lismenueditorpickaniconfroms #, object-pascal-format msgid "Pick an icon from %s" msgstr "%s öğesinden bir simge seçin" #: lazarusidestrconsts.lismenueditorpopupassignmentss #, object-pascal-format msgid "Popup assignments: %s" msgstr "Popup atamaları:%s" #: lazarusidestrconsts.lismenueditorradioitem msgid "RadioItem" msgstr "Radioögesi" #: lazarusidestrconsts.lismenueditorremainingconflictss #, object-pascal-format msgid "Remaining conflicts: %s" msgstr "Kalan çakışmalar: %s" #: lazarusidestrconsts.lismenueditorremoveallseparators msgid "&Remove all separators" msgstr "&Tüm ayırıcıları kaldır" #: lazarusidestrconsts.lismenueditorresolvedconflictss #, object-pascal-format msgid "Resolved conflicts: %s" msgstr "Çözülen çakışmalar:%s" #: lazarusidestrconsts.lismenueditorresolveselectedconflict msgid "Resolve selected conflict" msgstr "Seçili çakışmaları çöz" #: lazarusidestrconsts.lismenueditorresolveshortcutconflicts msgid "&Resolve shortcut conflicts ..." msgstr "Kısayol çakışma&larını çöz ..." #: lazarusidestrconsts.lismenueditorsavedtemplates msgid "Saved templates" msgstr "Şablonlar kaydedildi" #: lazarusidestrconsts.lismenueditorsavemenuasatemplate msgid "&Save menu as a template ..." msgstr "&Menüyü şablon olarak kaydet..." #: lazarusidestrconsts.lismenueditorsavemenuastemplate msgid "Save menu as template" msgstr "Menüyü şablon olarak kaydet" #: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse msgid "Save menu as template for future use" msgstr "Menüyü ileride kullanmak üzere şablon olarak kaydet" #: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate msgid "Save menu shown as a new template" msgstr "Yeni şablon olarak gösterilen menüyü kaydet" #: lazarusidestrconsts.lismenueditorsconflictswiths #, object-pascal-format msgid "%s conflicts with %s" msgstr "%s ile %s çakışıyor" #: lazarusidestrconsts.lismenueditorseparators msgid "Se¶tors" msgstr "&Ayırıcılar" #: lazarusidestrconsts.lismenueditorshortcutitemss #, object-pascal-format msgid "Shortcut items: %s" msgstr "Kısayol ögeleri: %s" #: lazarusidestrconsts.lismenueditorshortcutnotyetchanged msgid "Shortcut not yet changed" msgstr "Kısayol henüz değiştirilmedi" #: lazarusidestrconsts.lismenueditorshortcuts msgid "Shortcuts" msgstr "Kısayollar" #: lazarusidestrconsts.lismenueditorshortcuts2 msgid "Shortc&uts" msgstr "&Kısayollar" #: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys msgid "Shortcuts and Accelerator keys" msgstr "Kısayollar ve Hızlandırıcı tuşlar" #: lazarusidestrconsts.lismenueditorshortcutsd #, object-pascal-format msgid "Shortcuts (%d)" msgstr "Kısayollar (%d)" #: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd #, object-pascal-format msgid "Shortcuts (%d) and Accelerator keys (%d)" msgstr "Kısayollar (%d) ve Hızlandırıcı tuşlar (%d)" #: lazarusidestrconsts.lismenueditorshortcutsourceproperty msgid "Shortcut,Source Property" msgstr "Kısayol, Kaynak Özelliği" #: lazarusidestrconsts.lismenueditorshortcutsusedins #, object-pascal-format msgid "Shortcuts used in %s" msgstr "%s içinde kullanılan kısayollar" #: lazarusidestrconsts.lismenueditorshortcutsusedinsd #, object-pascal-format msgid "Shortcuts used in %s (%d)" msgstr "%s içinde kullanılan kısayollar (%d)" #: lazarusidestrconsts.lismenueditorsins #, object-pascal-format msgid "\"%s\" in %s" msgstr "\"%s\" de %s" #: lazarusidestrconsts.lismenueditorsisalreadyinuse #, object-pascal-format msgid "" "\"%s\" is already in use in %s as a shortcut.\n" "Try a different shortcut." msgstr "" "\"%s\" zaten %s içinde kısayol olarak kullanılıyor.\n" "Farklı bir kısayol deneyin." #: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand #, object-pascal-format msgid "Please expand: \"%s\" is not a sufficient Description" msgstr "Lütfen genişletin: \"%s\" açıklama yeterli değil" #: lazarusidestrconsts.lismenueditorsshortcuts #, object-pascal-format msgid "%s: Shortcuts" msgstr "%s: Kısayollar" #: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys #, object-pascal-format msgid "%s: Shortcuts and accelerator keys" msgstr "%s: Kısayollar ve hızlandırıcı tuşlar" #: lazarusidestrconsts.lismenueditorsssonclicks #, object-pascal-format msgid "%s.%s.%s - OnClick: %s" msgstr "%s.%s.%s - Tıklama(OnClick): %s" #: lazarusidestrconsts.lismenueditorstandardtemplates msgid "Standard templates" msgstr "Standart Şablon" #: lazarusidestrconsts.lismenueditortemplatedescription msgid "Template description:" msgstr "Şablon açıklaması:" #: lazarusidestrconsts.lismenueditortemplates msgid "&Templates" msgstr "&Şablon" #: lazarusidestrconsts.lismenueditortemplatesaved msgid "Template saved" msgstr "Şablon kaydedildi" #: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates msgid "" "There are no user-saved menu templates.\n" "\n" "Only standard default templates are available." msgstr "" "Kullanıcının kaydettiği menü şablonu yok.\n" "\n" "Yalnızca standart varsayılan şablonlar kullanılabilir." #: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis #, object-pascal-format msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" msgstr "TSCList.GetScanListCompName: FScanList için geçersiz %d dizini" #: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict #, object-pascal-format msgid "" "You have to change the shortcut from %s\n" "to avoid a conflict" msgstr "" "Çakışmayı önlemek için kısayolu %s konumundan\n" "değiştirmeniz gerekiyor" #: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption msgid "You must enter text for the Caption" msgstr "Başlık için metin girmelisiniz" #: lazarusidestrconsts.lismenuencloseinifdef msgid "Enclose in $IFDEF ..." msgstr "$IFDEF dahil et .." #: lazarusidestrconsts.lismenuencloseselection msgid "Enclose Selection ..." msgstr "Seçimi Dahil Et..." #: lazarusidestrconsts.lismenuevaluate msgid "E&valuate/Modify ..." msgstr "&Değerlendir/Değiştir ..." #: lazarusidestrconsts.lismenuextractproc msgid "Extract Procedure ..." msgstr "İşlemi Ayıkla ..." #: lazarusidestrconsts.lismenufile msgid "&File" msgstr "&Dosya" #: lazarusidestrconsts.lismenufind msgid "Find" msgstr "Bul" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." msgstr "&Bul ..." #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find Other End of Code Block" msgstr "Kod Bloğunun Diğer Sonu Bul" #: lazarusidestrconsts.lismenufindcodeblockstart msgid "Find Start of Code Block" msgstr "Kod Bloğunun Başlangıcını Bul" #: lazarusidestrconsts.lismenufinddeclarationatcursor msgid "Find Declaration at Cursor" msgstr "İmleçte Bildirimi Bul" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Tanımlayıcı Referanslarını Bul ..." #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in Files ..." msgstr "&Dosyada Bul..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" msgstr "&Sonrakini bul" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" msgstr "Ö&ncekini bul" #: lazarusidestrconsts.lismenufindreferencesofusedunit msgid "Find References Of Used Unit" msgstr "Kullanılmış Birimin Referanslarını Bul" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." msgstr "Seçenekler ..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto Include Directive" msgstr "Yönetmeliğe Git" #: lazarusidestrconsts.lismenugotoline msgid "Goto Line ..." msgstr "Satıra Git ..." #: lazarusidestrconsts.lismenuguessmisplacedifdef msgid "Guess Misplaced IFDEF/ENDIF" msgstr "Sanırım yanlış yerleştirilmiş IFDEF / ENDIF" #: lazarusidestrconsts.lismenuguessunclosedblock msgid "Guess Unclosed Block" msgstr "Sanırım engellenmiş blok" #: lazarusidestrconsts.lismenuhelp msgid "&Help" msgstr "&Yardım" #: lazarusidestrconsts.lismenuideinternals msgid "IDE Internals" msgstr "IDE Dahilileri" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" msgstr "Artımlı Bul" #: lazarusidestrconsts.lismenuindentselection msgid "Indent Selection" msgstr "Girinti Seçimi" #: lazarusidestrconsts.lismenuinsertchangelogentry msgid "ChangeLog Entry" msgstr "Değişiklik Girişi" #: lazarusidestrconsts.lismenuinsertcharacter msgid "Insert from Character Map ..." msgstr "Karakter Haritası Ekle ..." #: lazarusidestrconsts.lismenuinsertcvskeyword msgid "Insert CVS Keyword" msgstr "CVS Anahtar Kelimesini Ekle" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current Date and Time" msgstr "Geçerli Tarih ve Saat" #: lazarusidestrconsts.lismenuinsertfilename msgid "Insert Full Filename ..." msgstr "Tam Dosya Adını Ekle ..." #: lazarusidestrconsts.lismenuinsertgeneral msgid "Insert General" msgstr "Genel Ekle" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL Notice" msgstr "GPL Bildirimi" #: lazarusidestrconsts.lismenuinsertgplnoticetranslated msgid "GPL Notice (translated)" msgstr "GPL Bildirimi (tercüme edildi)" #: lazarusidestrconsts.lismenuinsertlgplnotice msgid "LGPL Notice" msgstr "LGPL Bildirimi" #: lazarusidestrconsts.lismenuinsertlgplnoticetranslated msgid "LGPL Notice (translated)" msgstr "LGPL Bildirimi (tercüme edildi)" #: lazarusidestrconsts.lismenuinsertmitnotice msgid "MIT Notice" msgstr "MIT Bildirimi" #: lazarusidestrconsts.lismenuinsertmitnoticetranslated msgid "MIT Notice (translated)" msgstr "MIT Bildirimi (tercüme edildi)" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL Notice" msgstr "Değiştirilmiş LGPL Bildirimi" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated msgid "Modified LGPL Notice (translated)" msgstr "Değiştirilmiş LGPL Bildirimi (tercüme edildi)" #: lazarusidestrconsts.lismenuinsertusername msgid "Current Username" msgstr "Geçerli Kullanıcı Adı" #: lazarusidestrconsts.lismenuinspect msgctxt "lazarusidestrconsts.lismenuinspect" msgid "&Inspect ..." msgstr "&Denetle ..." #: lazarusidestrconsts.lismenujumpback msgctxt "lazarusidestrconsts.lismenujumpback" msgid "Jump Back" msgstr "Geri Atla" #: lazarusidestrconsts.lismenujumpforward msgctxt "lazarusidestrconsts.lismenujumpforward" msgid "Jump Forward" msgstr "İleriye Atla" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" msgstr "Atla" #: lazarusidestrconsts.lismenujumptoimplementation msgid "Jump to Implementation" msgstr "Implementation bölümüne atla" #: lazarusidestrconsts.lismenujumptoimplementationuses msgid "Jump to Implementation uses" msgstr "Implementation uses bölümüne atla" #: lazarusidestrconsts.lismenujumptoinitialization msgid "Jump to Initialization" msgstr "Initalization bölümüne atla" #: lazarusidestrconsts.lismenujumptointerface msgid "Jump to Interface" msgstr "Interface bölümüne atla" #: lazarusidestrconsts.lismenujumptointerfaceuses msgid "Jump to Interface uses" msgstr "Uses bölümüne atla" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to Next Bookmark" msgstr "Sonraki Favorilere Git" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to Next Error" msgstr "Sonraki Hataya Git" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to Previous Bookmark" msgstr "Önceki Yer İşaretine Git" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to Previous Error" msgstr "Önceki Hataya Git" #: lazarusidestrconsts.lismenujumptoprocedurebegin msgid "Jump to Procedure begin" msgstr "Prosedür başlangıcına atla" #: lazarusidestrconsts.lismenujumptoprocedureheader msgid "Jump to Procedure header" msgstr "Prosedür başlığına atla" #: lazarusidestrconsts.lismenulowercaseselection msgid "Lowercase Selection" msgstr "Küçük harf seçimi" #: lazarusidestrconsts.lismenumacrolistview msgctxt "lazarusidestrconsts.lismenumacrolistview" msgid "Editor Macros" msgstr "Editör Makroları" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." msgstr "Kaynak Stringi Oluştur ..." #: lazarusidestrconsts.lismenumultipaste msgid "MultiPaste ..." msgstr "Çoklu Yapıştır..." #: lazarusidestrconsts.lismenunewcomponent msgid "New Component" msgstr "Yeni Bileşen" #: lazarusidestrconsts.lismenunewcustom #, object-pascal-format msgid "New %s" msgstr "Yeni %s" #: lazarusidestrconsts.lismenunewform msgid "New Form" msgstr "Yeni Form" #: lazarusidestrconsts.lismenunewother msgid "New ..." msgstr "Yeni ..." #: lazarusidestrconsts.lismenunewpackage msgid "New Package ..." msgstr "Yeni Paket ..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." msgstr "Yeni proje ..." #: lazarusidestrconsts.lismenunewprojectfromfile msgid "New Project from File ..." msgstr "Dosyadan Yeni Proje ..." #: lazarusidestrconsts.lismenunewunit msgctxt "lazarusidestrconsts.lismenunewunit" msgid "New Unit" msgstr "Yeni Birim" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "Çevrimiçi yardım" #: lazarusidestrconsts.lismenuopen msgid "&Open ..." msgstr "&Aç ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open Filename at Cursor" msgstr "İmleçte Dosya Adını Aç" #: lazarusidestrconsts.lismenuopenfolder msgid "Open Folder ..." msgstr "Klasörü Aç..." #: lazarusidestrconsts.lismenuopenpackage msgid "Open Loaded Package ..." msgstr "Yüklü Paketden Aç ..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open Package File (.lpk) ..." msgstr "Paket Dosyasını Aç (.lpk) ..." #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open Package of Current Unit" msgstr "Mevcut Ünitenin Paketini Aç" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." msgstr "Projeyi Aç ..." #: lazarusidestrconsts.lismenuopenrecent msgid "Open &Recent" msgstr "&En son kullanılanı Aç" #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open Recent Package" msgstr "En son açılan Paketi Aç" #: lazarusidestrconsts.lismenuopenrecentproject msgid "Open Recent Project" msgstr "En son açılan Projeyi Aç" #: lazarusidestrconsts.lismenuopenunit msgid "Open Unit ..." msgstr "Birim aç.." #: lazarusidestrconsts.lismenupackage msgid "Pa&ckage" msgstr "Pa&ket" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph" msgstr "Paket Grafiği" #: lazarusidestrconsts.lismenupackagelinks msgid "Package Links ..." msgstr "Paket Bağlantıları ..." #: lazarusidestrconsts.lismenupastefromclipboard msgid "Paste from clipboard" msgstr "Panodan yapıştır" #: lazarusidestrconsts.lismenupkgnewpackagecomponent msgid "New package component" msgstr "Yeni bileşen paketi" #: lazarusidestrconsts.lismenuprocedurelist msgid "Procedure List ..." msgstr "Prosedür Listesi ..." #: lazarusidestrconsts.lismenuproject msgid "&Project" msgstr "&Proje" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" msgstr "Proje denetçisi" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." msgstr "Proje Seçenekleri ..." #: lazarusidestrconsts.lismenuprojectrun msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "&Run" msgstr "&Çalıştır" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." msgstr "Projeyi Yayınla ..." #: lazarusidestrconsts.lismenuquickcompile msgid "Quick Compile" msgstr "Hızlı Derle" #: lazarusidestrconsts.lismenuquicksyntaxcheck msgid "Quick Syntax Check" msgstr "Hızlı Sözdizim Kontrolü" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "Hızlı sözdizimi denetimi tamam" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." msgstr "Projeden Kaldır ..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Tanımlayıcıyı Yeniden Adlandır ..." #: lazarusidestrconsts.lismenurenamelowercase msgid "Rename Unit Files to LowerCase ..." msgstr "" #: lazarusidestrconsts.lismenureportingbug msgid "Reporting a Bug" msgstr "Hata Bildirme" #: lazarusidestrconsts.lismenuresaveformswithi18n msgid "Resave forms with enabled i18n" msgstr "Etkinleştirilmiş i18n ile formları yeniden kaydet" #: lazarusidestrconsts.lismenurescanfpcsourcedirectory msgid "Rescan FPC Source Directory" msgstr "FPC Kaynak Dizini'ni yeniden tara" #: lazarusidestrconsts.lismenuresetdebugger msgid "Reset Debugger" msgstr "Hata Ayıklayıcıyı Sıfırla" #: lazarusidestrconsts.lismenurevert msgid "Revert" msgstr "Geri Dön" #: lazarusidestrconsts.lismenurun msgctxt "lazarusidestrconsts.lismenurun" msgid "&Run" msgstr "&Çalıştır" #: lazarusidestrconsts.lismenurunfile msgid "Run File" msgstr "Dosyayı Çalıştır" #: lazarusidestrconsts.lismenurunparameters msgid "Run &Parameters ..." msgstr "&Parametreleri Çalıştır..." #: lazarusidestrconsts.lismenuruntocursor msgctxt "lazarusidestrconsts.lismenuruntocursor" msgid "Run to Cursor" msgstr "İmleçi Çalıştır" #: lazarusidestrconsts.lismenurunwithdebugging msgid "Run with Debugging" msgstr "Hata Ayıklama ile Çalıştır" #: lazarusidestrconsts.lismenurunwithoutdebugging msgid "Run without Debugging" msgstr "Hata Ayıklamasız Çalıştır" #: lazarusidestrconsts.lismenusave msgid "&Save" msgstr "&Kaydet" #: lazarusidestrconsts.lismenusaveas msgid "Save &As ..." msgstr "&Farklı kaydet ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" msgstr "Projeyi Kaydet" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." msgstr "Projeyi Farklı Kaydet.." #: lazarusidestrconsts.lismenusearch msgid "&Search" msgstr "&Arama" #: lazarusidestrconsts.lismenuselect msgid "Select" msgstr "Seç" #: lazarusidestrconsts.lismenuselectall msgctxt "lazarusidestrconsts.lismenuselectall" msgid "Select All" msgstr "Hepsini seç" #: lazarusidestrconsts.lismenuselectcodeblock msgid "Select Code Block" msgstr "Kod Bloğu Seç" #: lazarusidestrconsts.lismenuselectline msgid "Select Line" msgstr "Satır Seç" #: lazarusidestrconsts.lismenuselectparagraph msgid "Select Paragraph" msgstr "Paragrafı Seç" #: lazarusidestrconsts.lismenuselecttobrace msgid "Select to Brace" msgstr "Ayracı Seç" #: lazarusidestrconsts.lismenuselectword msgid "Select Word" msgstr "Kelimeyi Seç" #: lazarusidestrconsts.lismenusetfreebookmark msgctxt "lazarusidestrconsts.lismenusetfreebookmark" msgid "Set a Free Bookmark" msgstr "Serbest bir Yer İşareti ayarla" #: lazarusidestrconsts.lismenushowexecutionpoint msgid "S&how Execution Point" msgstr "&Yürütme Noktasını göster" #: lazarusidestrconsts.lismenushowsmarthint msgid "Context sensitive smart hint" msgstr "İçerik duyarlı akıllı ipucu" #: lazarusidestrconsts.lismenusortselection msgid "Sort Selection ..." msgstr "Seçimi Sırala ..." #: lazarusidestrconsts.lismenusource msgid "S&ource" msgstr "Ka&ynak" #: lazarusidestrconsts.lismenuswapcaseselection msgid "Swap Case in Selection" msgstr "Seçimde Takas Yap" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to Spaces in Selection" msgstr "Seçimdeki Boşluklara Sekmeler" #: lazarusidestrconsts.lismenutemplateabout msgctxt "lazarusidestrconsts.lismenutemplateabout" msgid "About" msgstr "Hakkında" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle Comment in Selection" msgstr "Seçilen Yorumu Aç / Kapat" #: lazarusidestrconsts.lismenutools msgid "&Tools" msgstr "&Araçlar" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment Selection" msgstr "Seçimi Kaldır" #: lazarusidestrconsts.lismenuunindentselection msgid "Unindent Selection" msgstr "Girintisiz Seçim" #: lazarusidestrconsts.lismenuuppercaseselection msgid "Uppercase Selection" msgstr "Büyük Harf Seçimi" #: lazarusidestrconsts.lismenuuseunit msgid "Add Unit to Uses Section ..." msgstr "Birimi Uses e Ekle..." #: lazarusidestrconsts.lismenuview msgid "&View" msgstr "&Görünüm" #: lazarusidestrconsts.lismenuviewanchoreditor msgid "Anchor Editor" msgstr "Çapa Editör" #: lazarusidestrconsts.lismenuviewcodebrowser msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" msgid "Code Browser" msgstr "Kod Tarayıcı" #: lazarusidestrconsts.lismenuviewcodeexplorer msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" msgid "Code Explorer" msgstr "Kod Explorer" #: lazarusidestrconsts.lismenuviewcomponentpalette msgid "Component Palette" msgstr "Bileşen Paleti" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" msgstr "&Bileşenler" #: lazarusidestrconsts.lismenuviewdebugevents msgctxt "lazarusidestrconsts.lismenuviewdebugevents" msgid "Event Log" msgstr "Olay günlüğü" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug Output" msgstr "Çıktıyı Hata Ayıkla" #: lazarusidestrconsts.lismenuviewforms msgid "Forms ..." msgstr "Formlar..." #: lazarusidestrconsts.lismenuviewhistory msgctxt "lazarusidestrconsts.lismenuviewhistory" msgid "History" msgstr "Geçmiş" #: lazarusidestrconsts.lismenuviewjumphistory msgctxt "lazarusidestrconsts.lismenuviewjumphistory" msgid "Jump History" msgstr "Geçmişe atla" #: lazarusidestrconsts.lismenuviewlocalvariables msgctxt "lazarusidestrconsts.lismenuviewlocalvariables" msgid "Local Variables" msgstr "Yerel değişkenler" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" msgstr "Mesajlar" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" msgid "Object Inspector" msgstr "Nesne(Bileşen) Özellikleri" #: lazarusidestrconsts.lismenuviewprojectsource msgid "&View Project Source" msgstr "&Projenin Kaynaklarını Görüntüle" #: lazarusidestrconsts.lismenuviewpseudoterminal msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal" msgid "Console In/Output" msgstr "Terminal giriş/çıkışı" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" msgid "Registers" msgstr "Kayıtlar" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "Kısıtlama Tarayıcısı" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" msgstr "Arama sonuçları" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" msgid "Source Editor" msgstr "Kaynak Düzenleyici" #: lazarusidestrconsts.lismenuviewtaborder msgid "Tab Order" msgstr "Sekme Sırası" #: lazarusidestrconsts.lismenuviewthreads msgctxt "lazarusidestrconsts.lismenuviewthreads" msgid "Threads" msgstr "Konular" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle Form/Unit View" msgstr "Form/Birim Görüntüle" #: lazarusidestrconsts.lismenuviewunitdependencies msgctxt "lazarusidestrconsts.lismenuviewunitdependencies" msgid "Unit Dependencies" msgstr "Birim Bağımlılıkları" #: lazarusidestrconsts.lismenuviewunitinfo msgid "Unit Information ..." msgstr "Birim Bilgisi ..." #: lazarusidestrconsts.lismenuviewunits msgid "Units ..." msgstr "Birimler ..." #: lazarusidestrconsts.lismenuviewwatches msgctxt "lazarusidestrconsts.lismenuviewwatches" msgid "Watches" msgstr "İzlemeler" #: lazarusidestrconsts.lismenuwhatneedsbuilding msgid "What Needs Building" msgstr "Derlenmesi Gerekenler" #: lazarusidestrconsts.lismenuwindow msgid "&Window" msgstr "&Pencere" #: lazarusidestrconsts.lismeother msgid "Other tabs" msgstr "Diğer sekmeler" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" msgstr "Mesajlar Editörü" #: lazarusidestrconsts.lismessageswindow msgid "Messages Window" msgstr "Mesajlar Penceresi" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" msgstr "Yöntem sınıfı bulunamadı" #: lazarusidestrconsts.lismissingdirectory #, object-pascal-format msgid "missing directory \"%s\"" msgstr "eksik dizin \"%s\"" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" msgstr "Eksik Etkinlikler" #: lazarusidestrconsts.lismissingexecutable #, object-pascal-format msgid "missing executable \"%s\"" msgstr "eksik çalıştırılabilir \"%s\"" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" msgstr "Eksik tanımlayıcılar" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" msgstr "Eksik Paketler" #: lazarusidestrconsts.lismissingunitschoices msgid "Your choices are:" msgstr "Seçimleriniz şunlar:" #: lazarusidestrconsts.lismissingunitscomment msgid "Comment Out" msgstr "Yorum Yap" #: lazarusidestrconsts.lismissingunitsfordelphi msgid "For Delphi only" msgstr "Sadece Delphi için" #: lazarusidestrconsts.lismissingunitsinfo1 msgid "1) Comment out the selected units." msgstr "1) Seçilen birimleri yorumlayın." #: lazarusidestrconsts.lismissingunitsinfo1b msgid "1) Use the units only for Delphi." msgstr "1) Birimleri yalnızca Delphi için kullanın." #: lazarusidestrconsts.lismissingunitsinfo2 msgid "2) Search for units. Found paths are added to project settings." msgstr "2) Birimleri arayın. Bulunan yollar proje ayarlarına eklenir." #: lazarusidestrconsts.lismissingunitsinfo3 msgid "3) Leave these units in uses sections as they are." msgstr "3) Uses bölümlerindeki bu birimleri olduğu gibi bırakın." #: lazarusidestrconsts.lismissingunitssearch msgid "Search Unit Path" msgstr "Birim Yolunu Ara" #: lazarusidestrconsts.lismissingunitsskip msgctxt "lazarusidestrconsts.lismissingunitsskip" msgid "Skip" msgstr "Atla" #: lazarusidestrconsts.lismitnotice msgid "" "\n" "\n" "Copyright (c) \n" "\n" "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" "\n" "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" "\n" "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." msgstr "" "\n" "\n" "Copyright (c) \n" "\n" "Bu yazılımın ve ilgili dokümantasyon dosyalarının (\"Yazılım\") bir kopyasını alan herhangi bir kişiye, Yazılım'da herhangi bir kısıtlama olmaksızın, kullanım, kopyalama, değiştirme, birleştirme haklarını sınırlandırma olmaksızın da dahil olmak üzere, ücretsiz olarak izin verilir. Yazılımın bir kopyasını yayınlamak, dağıtmak, alt lisans vermek ve / veya satmak ve Yazılımın bu belgeyi sağladığı kişilerin, aşağıdaki koşullara tabi olarak kullanımına izin vermek:\n" "\n" "Yukarıdaki telif hakkı bildirimi ve bu izin bildirimi, Yazılımın tüm kopyalarına veya önemli bölümlerine dahil edilecektir.\n" "\n" "YAZILIM, TİCARİ AMAÇ VE ZIMNİ GİDERME GARANTİSİNE SINIRLANMAMIŞTIR, HİÇBİR GARANTİ, AÇIK veya UYGULANMADI, HERHANGİ BİR TÜR GARANTİ VERMEMEKTEDİR. ETKİLİ OLMAYAN YETKİLİ VEYA TELİF SAHİPLİ TUTUCULAR, SÖZLEŞME, TOR VEYA DİĞER SORUMLULUK, YANLIŞTAN VEYA KULLANIMDAN DOĞRU, TOR VEYA DİĞER BİRLİKTE HİÇBİR ZARAR VEYA DİĞER SORUMLULUK YAZILIM." #: lazarusidestrconsts.lismmadditionsandoverrides msgid "Additions and Overrides" msgstr "İlaveler ve Geçersiz Kılmalar" #: lazarusidestrconsts.lismmaddscustomoptions msgid "Adds custom options:" msgstr "Özel seçenekler ekler:" #: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" msgstr "Keyfi fpc seçeneklerini ekleyin, örneğin -O1 -ghtl -dFlag" #: lazarusidestrconsts.lismmapplytoallpackages msgid "Apply to all packages." msgstr "Tüm paketlere uygula." #: lazarusidestrconsts.lismmapplytoallpackagesandprojects msgid "Apply to all packages and projects." msgstr "Tüm paketlere ve projelere uygula." #: lazarusidestrconsts.lismmapplytoallpackagesmatching #, object-pascal-format msgid "Apply to all packages matching name \"%s\"" msgstr "\"%s\" adıyla eşleşen tüm paketlere uygula" #: lazarusidestrconsts.lismmapplytoproject msgid "Apply to project." msgstr "Projeye uygula." #: lazarusidestrconsts.lismmcreateanewgroupofoptions msgid "Create a new group of options" msgstr "Yeni bir grup grubu oluşturun" #: lazarusidestrconsts.lismmcustomoption msgid "Custom Option" msgstr "Özel Seçenek" #: lazarusidestrconsts.lismmdeletetheselectedtargetoroption msgid "Delete the selected target or option" msgstr "Seçilen hedefi veya seçeneği sil" #: lazarusidestrconsts.lismmdoesnotaddcustomoptions msgid "Does not add custom options:" msgstr "Özel seçenek eklemez:" #: lazarusidestrconsts.lismmdoesnothaveidemacro #, object-pascal-format msgid "Does not have IDE Macro %s:=%s" msgstr "IDE Macro %s yok: = %s" #: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu msgid "Does not override OutDir (-FU)" msgstr "OutDir (-FU) öğesini geçersiz kılmaz" #: lazarusidestrconsts.lismmexcludeallpackagesmatching #, object-pascal-format msgid "Exclude all packages matching name \"%s\"" msgstr "\"%s\" adıyla eşleşen tüm paketleri hariç tut" #: lazarusidestrconsts.lismmexpectedaftermacronamebutfound #, object-pascal-format msgid "expected \":=\" after macro name but found \"%s\"" msgstr "makro adından sonra beklenen \": =\" ancak \"%s\" bulundu" #: lazarusidestrconsts.lismmexpectedmacronamebutfound #, object-pascal-format msgid "expected macro name but found \"%s\"" msgstr "beklenen makro adı, ancak \"%s\" bulundu" #: lazarusidestrconsts.lismmfromto #, object-pascal-format msgid "From %s to %s" msgstr "%s den %s ye" #: lazarusidestrconsts.lismmidemacro msgid "IDE Macro" msgstr "IDE Makro" #: lazarusidestrconsts.lismmidemacro2 #, object-pascal-format msgid "IDE Macro %s:=%s" msgstr "IDE Makro %s: = %s" #: lazarusidestrconsts.lismminvalidcharacterat #, object-pascal-format msgid "invalid character \"%s\" at %s" msgstr "geçersiz karakter \"%s\" %s" #: lazarusidestrconsts.lismminvalidcharacterinmacrovalue #, object-pascal-format msgid "invalid character in macro value \"%s\"" msgstr "makro değerindeki geçersiz karakter \"%s\"" #: lazarusidestrconsts.lismmmissingmacroname msgid "missing macro name" msgstr "makro adı eksik" #: lazarusidestrconsts.lismmmoveselecteditemdown msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown" msgid "Move selected item down" msgstr "Seçili öğeyi aşağı taşı" #: lazarusidestrconsts.lismmmoveselecteditemup msgctxt "lazarusidestrconsts.lismmmoveselecteditemup" msgid "Move selected item up" msgstr "Seçili öğeyi yukarı taşı" #: lazarusidestrconsts.lismmnewtarget msgid "New Target" msgstr "Yeni Hedef" #: lazarusidestrconsts.lismmoverrideoutdirfu #, object-pascal-format msgid "Override OutDir (-FU): %s" msgstr "OutDir'i geçersiz kıl (-FU): %s" #: lazarusidestrconsts.lismmoverrideoutputdirectory msgid "Override output directory (-FU)" msgstr "Çıkış dizinini geçersiz kıl (-FU)" #: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget msgid "Override output directory -FU of target" msgstr "Çıkış dizinini geçersiz kıl -HB hedefi" #: lazarusidestrconsts.lismmredolastundotothisgrid msgid "Redo last undo to this grid" msgstr "Bu ızgaraya en son geri al" #: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32 msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32" msgstr "Bir IDE makrosu ayarlayın, ör. LCLWidgetType: = win32" #: lazarusidestrconsts.lismmsets #, object-pascal-format msgid "Set \"%s\"" msgstr "\"%s\" Ayarla" #: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml msgid "Stored in IDE (environmentoptions.xml)" msgstr "Depolanmış IDE (environmentoptions.xml)" #: lazarusidestrconsts.lismmstoredinprojectlpi msgid "Stored in project (.lpi)" msgstr "Projede sakla (.lpi)" #: lazarusidestrconsts.lismmstoredinsessionofprojectlps msgid "Stored in session of project (.lps)" msgstr "Proje oturumunda saklanır (.lps) " #: lazarusidestrconsts.lismmtargets msgid "Targets: " msgstr "Hedefler: " #: lazarusidestrconsts.lismmundolastchangetothisgrid msgid "Undo last change to this grid" msgstr "Bu ızgaradaki son değişikliği geri al" #: lazarusidestrconsts.lismmvalues #, object-pascal-format msgid "Value \"%s\"" msgstr "Değer \"%s\"" #: lazarusidestrconsts.lismmwas #, object-pascal-format msgid "(was \"%s\")" msgstr "(\"%s\" idi)" #: lazarusidestrconsts.lismmwidgetsetavailableforlclproject msgid "WidgetSet change is available only for LCL projects" msgstr "WidgetSet değişikliği yalnızca LCL projeleri için kullanılabilir" #: lazarusidestrconsts.lismode #, object-pascal-format msgid ", Mode: %s" msgstr ", Mod: %s" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "" "\n" "\n" "Copyright (C) \n" "\n" "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" "\n" "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" "\n" "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" "\n" "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." msgstr "" " \n" "\n" "Telif Hakkı (C) \n" "\n" "Bu kütüphane ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Kütüphane Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; ya Lisansın 2. sürümü ya da (isteğe bağlı olarak) aşağıdaki değişiklikle: \n" " \n" "Özel bir istisna olarak, bu kütüphanenin telif hakkı sahipleri, bu bağımsız modüllerin lisans koşullarından bağımsız olarak bir çalıştırılabilir dosya üretmek için bu kitaplığı bağımsız modüllerle bağlamanıza ve elde ettiğiniz yürütülebilir dosyayı seçtiğiniz şartlar altında kopyalayıp dağıtmanıza izin verir. Her bir bağımsız modül için, o modülün lisansının şart ve koşullarını da yerine getirmeniz şartıyla, bağımsız bir modül, bu kütüphaneden türetilmeyen veya bu kütüphaneden türetilmeyen bir modüldür. Bu istisna, kütüphane sürümünüz için geçerlidir, fakat bunu yapmak zorunda değilsiniz. Bunu yapmak istemiyorsanız, bu istisna bildirimini sürümünüzden silin. \n" " \n" "Bu program faydalı olacağı umuduyla dağıtılmıştır, ancak HİÇBİR GARANTİ YOKTUR; HİÇBİR AMAÇLI GARANTİ veya FITNESS zımni garantisi olmadan. Daha fazla bilgi için GNU Kütüphanesi Genel Kamu Lisansına bakın. \n" "\n" "GNU Kütüphanesi Genel Kamu Lisansının bir kopyasını bu kütüphane ile birlikte almış olmalısınız; olmasa da, Özgür Yazılım Vakfı, Inc.'e, 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazmalısınız." #: lazarusidestrconsts.lismore msgctxt "lazarusidestrconsts.lismore" msgid "More" msgstr "Daha fazla" #: lazarusidestrconsts.lismoresub msgctxt "lazarusidestrconsts.lismoresub" msgid "More" msgstr "Daha fazla" #: lazarusidestrconsts.lismove msgid "Move" msgstr "Taşı" #: lazarusidestrconsts.lismovedown msgid "Move Down" msgstr "Aşağı taşı" #: lazarusidestrconsts.lismovefiles msgid "Move Files" msgstr "Dosyaları Taşı" #: lazarusidestrconsts.lismovefiles2 msgid "Move files?" msgstr "Dosyaları taşı?" #: lazarusidestrconsts.lismovefilesfromtothedirectoryof #, object-pascal-format msgid "Move %s file(s) from %s to the directory%s%s%sof %s?" msgstr "%s dosyaları, %s klasöründen %s%s%s %s klasörüne taşısın mı?" #: lazarusidestrconsts.lismoveonepositiondown #, object-pascal-format msgid "Move \"%s\" one position down" msgstr "\"%s\" bir konum aşağı taşı" #: lazarusidestrconsts.lismoveonepositionup #, object-pascal-format msgid "Move \"%s\" one position up" msgstr "\"%s\" bir konum yukarı taşı" #: lazarusidestrconsts.lismoveorcopyfiles msgid "Move or Copy files?" msgstr "Dosyaları Taşı veya Kopyala?" #: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage #, object-pascal-format msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?" msgstr "%s %s dosyalarını %s dizininden %s%s%s dizine taşı ya da kopyala.?" #: lazarusidestrconsts.lismovepage msgid "Move Page" msgstr "Sayfayı Taşı" #: lazarusidestrconsts.lismoveselecteddown msgid "Move selected item down (Ctrl+Down)" msgstr "Seçili öğeyi aşağıya taşı (Ctrl + Aşağı)" #: lazarusidestrconsts.lismoveselectedup msgid "Move selected item up (Ctrl+Up)" msgstr "Seçili öğeyi yukarı taşı (Ctrl + Yukarı)" #: lazarusidestrconsts.lismoveto msgid "Move to: " msgstr "Taşı : " #: lazarusidestrconsts.lismoveup msgid "Move Up" msgstr "Yukarı Taşı" #: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa msgid "Moving these units will break their uses sections. See Messages window for details." msgstr "Bu birimlerin taşınması kullanım bölümlerini bozacaktır. Ayrıntılar için Mesajlar penceresine bakın." #: lazarusidestrconsts.lismpcstyle msgid "C style: \" => \\\"" msgstr "C sitili: \" => \\\"" #: lazarusidestrconsts.lismpescapequotes msgid "Escape "es" msgstr "Çıkış tırnakları" #: lazarusidestrconsts.lismpmultipaste msgctxt "lazarusidestrconsts.lismpmultipaste" msgid "MultiPaste" msgstr "Çoklu Yapıştır" #: lazarusidestrconsts.lismppascalstyle msgid "Pascal style: ' => ''" msgstr "Pascal Tarzı: ' => ''" #: lazarusidestrconsts.lismppasteoptions msgid "Paste &options" msgstr "Yapıştırma &seçenekleri" #: lazarusidestrconsts.lismppreview msgid "&Preview" msgstr "&Önizleme" #: lazarusidestrconsts.lismptextaftereachline msgid "Text &after each line" msgstr "&Metin her satırdan sonra" #: lazarusidestrconsts.lismptextbeforeeachline msgid "Text &before each line" msgstr "Metin &her satırdan önce" #: lazarusidestrconsts.lismptrimclipboardcontents msgid "&Trim clipboard contents" msgstr "&Pano içeriğini kırp" #: lazarusidestrconsts.lismsgcolors msgid "Message colors" msgstr "Mesaj renkleri" #: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons msgid "Multiple directories are separated with semicolons" msgstr "Birden çok dizin noktalı virgül ile ayrılır" #: lazarusidestrconsts.lismultiplepack msgid ", multiple packages: " msgstr ", Birden çok paket: " #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Mesajları dosyaya kaydet (*.txt)" #: lazarusidestrconsts.lisname msgctxt "lazarusidestrconsts.lisname" msgid "Name" msgstr "Ad" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" msgstr "İsim çakışması" #: lazarusidestrconsts.lisnameofactivebuildmode msgid "Name of active build mode" msgstr "Etkin yapı modunun adı" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" msgstr "Yeni prosedürün adı" #: lazarusidestrconsts.lisnew msgctxt "lazarusidestrconsts.lisnew" msgid "New" msgstr "Yeni" #: lazarusidestrconsts.lisnewclass msgid "New Class" msgstr "Yeni Sınıf" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" msgstr "Yeni konsol uygulaması" #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype #, object-pascal-format msgid "Create a new editor file.%sChoose a type." msgstr "Yeni bir editör dosyası oluşturun.%sBir tür seçin." #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Yeni bir boş metin dosyası oluştur." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype #, object-pascal-format msgid "Create a new project.%sChoose a type." msgstr "Yeni bir proje oluşturun.%sBir tür seçin." #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun #, object-pascal-format msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "Yeni bir standart paket oluşturun.%s Paket, birimler ve bileşenler koleksiyonudur." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "Veri modülüyle yeni bir birim oluşturun." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame." msgstr "Çerçeveli yeni bir birim oluşturun." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "LCL formuyla yeni bir birim oluşturun." #: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent msgid "Inherit from a project form or component" msgstr "Bir proje formundan veya bileşenden devralın" #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" msgstr "Hiçbir öğe seçilmedi" #: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "Lütfen önce bir öğe seçin." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" msgstr "Yeni kodlama:" #: lazarusidestrconsts.lisnewmacroname #, object-pascal-format msgid "Macro %d" msgstr "Makro %d" #: lazarusidestrconsts.lisnewmacroname2 msgid "New Macroname" msgstr "Yeni Macroname" #: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order." msgstr "Bu sınıfın mevcut yöntemleri arasına yeni yöntem uygulamaları eklenir. Alfabetik olarak ya da en son ya da beyan sırasına göre." #: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last." msgstr "Sınıftaki yeni yöntem ve üye bildirimleri ... son bölümler alfabetik olarak eklenir veya en son eklenir." #: lazarusidestrconsts.lisnewpage msgid "New page" msgstr "Yeni sayfa" #: lazarusidestrconsts.lisnewproject msgid "(new project)" msgstr "(yeni proje)" #: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved msgid "New recorded macros. Not to be saved" msgstr "Yeni kaydedilen makrolar, kaydedilmeyecek" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections" msgstr "Uses bölümüne yeni birimler eklenirken" #: lazarusidestrconsts.lisnoautosaveactivedesktop msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually." msgstr "'Etkin masaüstünü otomatik kaydet' seçeneği kapalı, mevcut masaüstünü manuel olarak kaydetmeniz gerekecek." #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" msgstr "Yedekleme yapma" #: lazarusidestrconsts.lisnobuildprofilesselected msgid "No profiles are selected to be built." msgstr "Oluşturulacak profil seçilmedi." #: lazarusidestrconsts.lisnochange msgid "No change" msgstr "Değişiklik yok" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" msgstr "Kod seçilmedi" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "Herhangi bir derleyici seçeneği devralınmadı." #: lazarusidestrconsts.lisnofppkgprefix msgid "empty Free Pascal compiler prefix." msgstr "boş Free Pascal derleyici öneki." #: lazarusidestrconsts.lisnohints msgid "no hints" msgstr "ipucu yok" #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" msgstr "IDE penceresi seçilmedi" #: lazarusidestrconsts.lisnolfmfile msgid "No LFM file" msgstr "LFM dosyası değil" #: lazarusidestrconsts.lisnomacroselected msgid "No macro selected" msgstr "Makro seçilmedi" #: lazarusidestrconsts.lisnomessageselected msgid "(no message selected)" msgstr "(Mesaj seçilmedi)" #: lazarusidestrconsts.lisnoname msgid "noname" msgstr "isimsiz" #: lazarusidestrconsts.lisnoneclicktochooseone msgid "none, click to choose one" msgstr "hiçbiri, birini seçmek için tıkla" #: lazarusidestrconsts.lisnoneselected msgid "(None selected)" msgstr "(Hiçbiri seçilmedi)" #: lazarusidestrconsts.lisnonewfilefound msgid "No new file found" msgstr "Yeni dosya bulunamadı" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" msgstr "hiçbir düğüm seçilmedi" #: lazarusidestrconsts.lisnopascalfile msgid "No Pascal file" msgstr "Pascal dosyası yok" #: lazarusidestrconsts.lisnoprogramfilesfound #, object-pascal-format msgid "No program file \"%s\" found." msgstr "\"%s\" program dosyası bulunamadı." #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "ResourceString Bölümü bulunamadı" #: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "Normalde filtre normal bir ifadedir. Basit sözdiziminde a. normal bir karakter, a * bir şeyin kısaltmasıdır, a? herhangi bir karakteri temsil eder ve virgül ve noktalı virgül alternatifleri ayırır. Örneğin: Basit sözdizimi * .pas; *. Pp ^(.*\\.pas|.*\\.pp)$" #: lazarusidestrconsts.lisnostringconstantfound msgid "No string constant found" msgstr "Srtring sabiti bulunamadı" #: lazarusidestrconsts.lisnotadesigntimepackage msgid "Not a designtime package" msgstr "Tasarım zamanı paketi değil" #: lazarusidestrconsts.lisnotaninstallpackage msgid "Not an install package" msgstr "Yükleme paketi değil" #: lazarusidestrconsts.lisnotavalidfppkgprefix msgid "Free Pascal compiler not found at the given prefix." msgstr "Free Pascal derleyicisi verilen önekte bulunamadı." #: lazarusidestrconsts.lisnote msgctxt "lazarusidestrconsts.lisnote" msgid "Note" msgstr "Not" #: lazarusidestrconsts.lisnotebooktabposbottom msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" msgid "Bottom" msgstr "Alt" #: lazarusidestrconsts.lisnotebooktabposleft msgctxt "lazarusidestrconsts.lisnotebooktabposleft" msgid "Left" msgstr "Sol" #: lazarusidestrconsts.lisnotebooktabposright msgctxt "lazarusidestrconsts.lisnotebooktabposright" msgid "Right" msgstr "Sağ" #: lazarusidestrconsts.lisnotebooktabpostop msgctxt "lazarusidestrconsts.lisnotebooktabpostop" msgid "Top" msgstr "Üst" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "NOT: Free Pascal Kaynakları için Şablon Tanımlama Oluşturulamadı" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "NOT: Lazarus Kaynakları için Şablon Tanımlama Oluşturulamadı" #: lazarusidestrconsts.lisnotemplateselected msgid "no template selected" msgstr "şablon seçilmedi" #: lazarusidestrconsts.lisnothingtodo msgid "Nothing to do" msgstr "Yapacak bir şey yok" #: lazarusidestrconsts.lisnotinstalled msgid "not installed" msgstr "yüklü değil" #: lazarusidestrconsts.lisnotinstalledpackages msgid "Not installed packages" msgstr "Paketler Yüklenmemiş" #: lazarusidestrconsts.lisnotnow msgid "Not now" msgstr "Şimdi değil" #: lazarusidestrconsts.lisnowloadedscheme msgid "Now loaded: " msgstr "Şimdi yüklendi: " #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" msgstr "Yeni bir proje oluştur" #: lazarusidestrconsts.lisnumberoffilestoconvert #, object-pascal-format msgid "Number of files to convert: %s" msgstr "Dönüştürülecek dosya sayısı: %s" #: lazarusidestrconsts.lisobjectinspectorbecomesvisible msgid "Object Inspector becomes visible when components are selected in designer." msgstr "Nesne Denetçisi, tasarımcılarda bileşenler seçildiğinde görünür hale gelir." #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" msgstr "Object Pascal - varsayılan" #: lazarusidestrconsts.lisobjectpath msgid "object path" msgstr "nesne yolu" #: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab msgid "Switch to Object Inspector Favorites tab" msgstr "Nesne Denetleyicisi Sık Kullanılanları sekmesine geç" #: lazarusidestrconsts.lisofpackage #, object-pascal-format msgid " of package %s" msgstr " %s paketinin" #: lazarusidestrconsts.lisoftheprojectinspector msgid " of the Project Inspector" msgstr " Proje denetleyicisinin" #: lazarusidestrconsts.lisoifaddtofavoriteproperties msgid "Add to favorite properties" msgstr "Favori özelliklere ekle" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty #, object-pascal-format msgid "Choose a base class for the favorite property \"%s\"." msgstr "Favori özellik \"%s\" için bir temel sınıf seçin." #: lazarusidestrconsts.lisoifclassnotfound #, object-pascal-format msgid "Class \"%s\" not found." msgstr "Sınıf \"%s\" bulunamadı." #: lazarusidestrconsts.lisoifremovefromfavoriteproperties msgid "Remove from favorite properties" msgstr "Favori özelliklerden kaldır" #: lazarusidestrconsts.lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "otomatik yükle dinamik" #: lazarusidestrconsts.lisoipautoinstallstatic msgid "auto install static" msgstr "otomatik yükle statik" #: lazarusidestrconsts.lisoipdescription msgid "Description: " msgstr "Açıklama: " #: lazarusidestrconsts.lisoipdescriptiondescription #, object-pascal-format msgid "%sDescription: %s" msgstr "%sAçıklama: %s" #: lazarusidestrconsts.lisoipfilename #, object-pascal-format msgid "Filename: %s" msgstr "Dosya adı: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" msgstr "kurulu dinamik" #: lazarusidestrconsts.lisoipinstalledstatic msgid "installed static" msgstr "kurulu statik" #: lazarusidestrconsts.lisoiplicenselicense #, object-pascal-format msgid "%sLicense: %s" msgstr "%sLisans: %s" #: lazarusidestrconsts.lisoipmissing msgid "missing" msgstr "eksik" #: lazarusidestrconsts.lisoipmodified msgid "modified" msgstr "değiştirilmiş" #: lazarusidestrconsts.lisoipopenloadedpackage msgid "Open Loaded Package" msgstr "Yüklü Paketi Aç" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" msgstr "Paket ismi" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" msgstr "Lütfen bir paket seçin" #: lazarusidestrconsts.lisoipreadonly msgid "readonly" msgstr "sadece okunur" #: lazarusidestrconsts.lisoipstate msgctxt "lazarusidestrconsts.lisoipstate" msgid "State" msgstr "Durum" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound #, object-pascal-format msgid "%sThis package is installed but the lpk file was not found" msgstr "%s Bu paket kuruldu, ancak lpk dosyası bulunamadı" #: lazarusidestrconsts.lisoldclass msgid "Old Class" msgstr "Eski sınıf" #: lazarusidestrconsts.lisonbreaklineiereturnorenterkey msgid "On break line (i.e. return or enter key)" msgstr "Kesme çizgisinde (örn. Dönüş veya enter tuşu)" #: lazarusidestrconsts.lisonlinepackage msgid "available in the main repository" msgstr "ana depoda mevcut" #: lazarusidestrconsts.lisonly32bit msgid "only 32bit" msgstr "sadece 32bit" #: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden msgid "Only available on Windows. Run the tool hidden." msgstr "Sadece Windows'ta kullanılabilir.Gizli aracı çalıştır." #: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole msgid "Only available on Windows. Run tool in a new console." msgstr "Sadece Windows'ta kullanılabilir. Aracı yeni bir konsolda çalıştır." #: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression msgid "Only messages fitting this regular expression:" msgstr "Yalnızca bu düzenli ifadeye uyan iletiler:" #: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated msgid "Only messages with these FPC IDs (comma separated):" msgstr "Sadece bu FPC ID'lerine sahip mesajlar (virgülle ayrılmış):" #: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild msgid "Only register the Lazarus package files (.lpk). Do not build." msgstr "Yalnızca Lazarus paket dosyalarını (.lpk) kaydedin. Derleme yapmayın." #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" msgstr "Yalnızca tüm kelimeleri ara" #: lazarusidestrconsts.lisonpastefromclipboard msgid "On paste from clipboard" msgstr "Panodan yapıştır" #: lazarusidestrconsts.lisopen msgid "Open" msgstr "Aç" #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" msgstr "XML dosyası olarak aç" #: lazarusidestrconsts.lisopendesigneronopenunit msgid "Open designer on open unit" msgstr "Açık ünitede tasarımcıyı aç" #: lazarusidestrconsts.lisopendesigneronopenunithint msgid "Form is loaded in designer always when source unit is opened." msgstr "Form her zaman kaynak birimi açıldığında tasarımcıya yüklenir." #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" msgstr "Varolan dosyayı aç" #: lazarusidestrconsts.lisopenfile msgid "Open File" msgstr "Dosyayı Aç" #: lazarusidestrconsts.lisopenfile2 msgid "Open file" msgstr "Dosyayı Aç" #: lazarusidestrconsts.lisopenfileatcursor msgid "Open file at cursor" msgstr "İmleçteki dosyayı aç" #: lazarusidestrconsts.lisopeninfileman msgid "Open in file manager" msgstr "Dosya yöneticisini aç" #: lazarusidestrconsts.lisopeninfilemanhint msgid "Open destination directory in file manager" msgstr "Hedef dizini dosya yöneticisinde aç" #: lazarusidestrconsts.lisopenlfm #, object-pascal-format msgid "Open %s" msgstr "%s aç" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" msgstr "Paket Açılsın mı?" #: lazarusidestrconsts.lisopenpackage2 #, object-pascal-format msgid "Open package %s" msgstr "Paketi Aç %s" #: lazarusidestrconsts.lisopenpackage3 msgid "Open Package" msgstr "Paketi Aç" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" msgstr "Paket Dosyasını Aç" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" msgstr "Proje Açılsın mı?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" msgstr "Projeyi Aç" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" msgstr "Projeyi tekrar Aç" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" msgstr "Proje Dosyasını Aç" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "Dosyayı normal kaynak olarak aç" #: lazarusidestrconsts.lisopenthepackage #, object-pascal-format msgid "Open the package %s?" msgstr "%s paketi açılsın mı?" #: lazarusidestrconsts.lisopentheproject #, object-pascal-format msgid "Open the project %s?" msgstr "%s projesi açılsın mı?" #: lazarusidestrconsts.lisopentooloptions msgid "Open Tool Options" msgstr "Araç Seçeneklerini Aç" #: lazarusidestrconsts.lisopenunit msgid "Open Unit" msgstr "Birim Aç" #: lazarusidestrconsts.lisopenurl msgid "Open URL" msgstr "URL Aç" #: lazarusidestrconsts.lisopenxml msgid "Open XML" msgstr "XML Aç" #: lazarusidestrconsts.lisoptions msgctxt "lazarusidestrconsts.lisoptions" msgid "Options" msgstr "Seçenekler" #: lazarusidestrconsts.lisoptionvalueignored msgid "ignored" msgstr "yoksay" #: lazarusidestrconsts.lisos #, object-pascal-format msgid ", OS: %s" msgstr ", OS: %s" #: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa #, object-pascal-format msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path." msgstr "\"%s\" paketinin diğer kaynaklar yolu, zaten birim arama yolunda bulunan \"%s\" dizinini içeriyor." #: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource #, object-pascal-format msgid "output directory of %s contains Pascal unit source \"%s\"" msgstr "%s çıktı dizini \"%s\" Pascal birim kaynağını içeriyor" #: lazarusidestrconsts.lisoutputfilenameofproject msgid "Output filename of project" msgstr "Projenin çıktı dosya adı" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"." msgstr "Dili geçersiz kıl. Olası değerler için \"languages\" dizinindeki dosyalara bakın. Örnek: \"--language=tr\"." #: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype msgid "Override function result string types with the first parameter expression type" msgstr "İlk parametre ifadesi türüyle işlev sonuç dizesi türlerini geçersiz kıl" #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml." msgstr "Varsayılan derleyiciyi geçersiz kılın. Örneğin: ppc386 ppcx64 ppcppc. Varsayılan değer environmentoptions.xml dosyasında saklanır." #: lazarusidestrconsts.lisoverridetheprojectbuildmode msgid "Override the project or IDE build mode." msgstr "Proje veya IDE derleme modunu geçersiz kılın." #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 #, object-pascal-format msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s." msgstr "Proje CPU'sunu geçersiz kılın. Örneğin: i386 x86_64 powerpc powerpc_64. Varsayılan: %s." #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau #, object-pascal-format msgid "Override the project operating system. For example: win32 linux. Default: %s." msgstr "Proje işletim sistemini geçersiz kılın. Örneğin: win32 linux. Varsayılan: %s." #: lazarusidestrconsts.lisoverridetheprojectsubtarg msgid "Override the project subtarget." msgstr "Proje alt hedefini geçersiz kılın." #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond #, object-pascal-format msgid "Override the project widgetset. For example: gtk gtk2 qt win32 carbon. Default: %s." msgstr "Proje widgetset'ini geçersiz kılın. Örneğin: gtk gtk2 qt win32 carbon. Varsayılan: %s." #: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot msgid "'Owner' is already used by TReader/TWriter. Please choose another name." msgstr "'Sahibi' zaten TReader / TWriter tarafından kullanılıyor, lütfen başka bir ad seçin." #: lazarusidestrconsts.lispackage msgid "Package" msgstr "Paket" #: lazarusidestrconsts.lispackage2 #, object-pascal-format msgid "package %s" msgstr "paket %s" #: lazarusidestrconsts.lispackage3 #, object-pascal-format msgid ", package %s" msgstr ", paket %s" #: lazarusidestrconsts.lispackageinfo msgid "Package info" msgstr "Paket bilgisi" #: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint #, object-pascal-format msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages." msgstr "\"%s\" paketi sadece tasarım zamanıdır, bu yüzden proje ayarları ile değil sadece IDE'de derlenmelidir.%s Lütfen IDE paketlerini oluşturmak için \"Yükle\" veya \"Araçlar/Lazarus Derle\" yi kullanın." #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." msgstr "Paket adı ile başlar ..." #: lazarusidestrconsts.lispackagenamecontains msgid "Package name contains ..." msgstr "Paket adı içeriyor ..." #: lazarusidestrconsts.lispackageneedsanoutputdirectory msgid "Package needs an output directory." msgstr "Paket bir çıkış dizinine ihtiyaç duyar." #: lazarusidestrconsts.lispackageneedsinstallation msgid "Package needs installation" msgstr "Paketin kurulum ihtiyacı var" #: lazarusidestrconsts.lispackageoption #, object-pascal-format msgid "Package \"%s\" Option" msgstr "Paket \"%s\" Seçenekleri" #: lazarusidestrconsts.lispackageoutputdirectories msgid "Package output directories" msgstr "Paket çıktı dizinleri" #: lazarusidestrconsts.lispackagesourcedirectories msgid "Package source directories" msgstr "Paket kaynak dizinleri" #: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes #, object-pascal-format msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s" msgstr "paketler=%s/%s birimler=%s/%s tanımlayıcılar=%s/%s satırlar=%s baytlar=%s" #: lazarusidestrconsts.lispackageunit msgid "package unit" msgstr "paket birimi" #: lazarusidestrconsts.lispage msgctxt "lazarusidestrconsts.lispage" msgid "Page" msgstr "Sayfa" #: lazarusidestrconsts.lispagename msgid "Page name" msgstr "Sayfa adı" #: lazarusidestrconsts.lispagenamealreadyexists #, object-pascal-format msgid "Page name \"%s\" already exists. Not added." msgstr "Sayfa adı \"%s\" zaten var, eklenmedi." #: lazarusidestrconsts.lispanic msgctxt "lazarusidestrconsts.lispanic" msgid "Panic" msgstr "Panik" #: lazarusidestrconsts.lisparsed msgid ", parsed " msgstr ", ayrıştırılmış " #: lazarusidestrconsts.lisparser #, object-pascal-format msgid "parser \"%s\": %s" msgstr "ayrıştırıcı \"%s\": %s" #: lazarusidestrconsts.lisparsers msgid "Parsers:" msgstr "Ayrıştırma:" #: lazarusidestrconsts.lispassingquiettwotimeswillp msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler." msgstr "İki kez --quiet geçmek derleyiciye -vw-n-h-i-l-d-u-t-p-c-x- geçecektir." #: lazarusidestrconsts.lispasteclipboard msgid "paste clipboard" msgstr "panoya yapıştır" #: lazarusidestrconsts.lispastefromclipboard msgid "Paste from clipboard." msgstr "Panodan yapıştır." #: lazarusidestrconsts.lispastelcolors msgid "Pastel Colors" msgstr "Pastel renkler" #: lazarusidestrconsts.lispath msgid "Path" msgstr "Yol" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" msgid "Browse" msgstr "Gözat" #: lazarusidestrconsts.lispatheditdeleteinvalidpaths msgid "Delete Invalid Paths" msgstr "Geçersiz Yolları Sil" #: lazarusidestrconsts.lispatheditmovepathdown msgid "Move path down (Ctrl+Down)" msgstr "Yolu aşağı taşı (Ctrl + Aşağı)" #: lazarusidestrconsts.lispatheditmovepathup msgid "Move path up (Ctrl+Up)" msgstr "Yolu yukarı taşı (Ctrl + Yukarı)" #: lazarusidestrconsts.lispatheditoraddhint msgid "Add new path to the list" msgstr "Listeye yeni yol ekle" #: lazarusidestrconsts.lispatheditordeletehint msgid "Delete the selected path" msgstr "Seçili yolu sil" #: lazarusidestrconsts.lispatheditordeleteinvalidhint msgid "Remove non-existent (gray) paths from the list" msgstr "Varolmayan (gri) yolları listeden kaldır" #: lazarusidestrconsts.lispatheditorreplacehint msgid "Replace the selected path with a new path" msgstr "Seçili yolu yeni bir yolla değiştir" #: lazarusidestrconsts.lispatheditortempladdhint msgid "Add template to the list" msgstr "Listeye şablon ekle" #: lazarusidestrconsts.lispatheditpathtemplates msgid "Path templates" msgstr "Yol şablonları" #: lazarusidestrconsts.lispatheditsearchpaths msgid "Search paths:" msgstr "Arama yolları:" #: lazarusidestrconsts.lispathisnodirectory msgid "is not a directory" msgstr "bir dizin değil" #: lazarusidestrconsts.lispathoftheinstantfpccache msgid "path of the instantfpc cache" msgstr "anlık önbellek yolunun yolu" #: lazarusidestrconsts.lispathofthemakeutility msgid "Path of the make utility" msgstr "Make programının yolu" #: lazarusidestrconsts.lispathtoinstance msgid "Path to failed Instance:" msgstr "Başarısız Örnek için Yol:" #: lazarusidestrconsts.lispause msgid "Pause" msgstr "Duraklat" #: lazarusidestrconsts.lispckcleartousethepackagename msgid "Clear to use the package name" msgstr "Paket adını kullanmak için temizle" #: lazarusidestrconsts.lispckdisablei18noflfm msgid "Disable I18N of lfm" msgstr "Lfm'in I18N'sini devre dışı bırak" #: lazarusidestrconsts.lispckeditaddfilesfromfilesystem msgid "Add Files from File System" msgstr "Dosyaları Dosya Sisteminden Ekle" #: lazarusidestrconsts.lispckeditaddtoproject msgid "Add to Project" msgstr "Projeye Ekle" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" msgstr "Değişiklikleri uygula" #: lazarusidestrconsts.lispckeditavailableonline msgid "(available online)" msgstr "(mevcut çevrimiçi)" #: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit #, object-pascal-format msgid "Call %sRegister%s procedure of selected unit" msgstr "Seçilen ünitenin %sRegister%s prosedürünü çağır" #: lazarusidestrconsts.lispckeditcheckavailabilityonline msgid "Check availability online" msgstr "Kullanılabilirliği çevrimiçi kontrol edin" #: lazarusidestrconsts.lispckeditcleanupdependencies msgid "Clean up dependencies ..." msgstr "Bağımlılıkları temizle ..." #: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency msgid "Clear default/preferred filename of dependency" msgstr "Varsayılan / tercih edilen dosya adı bağımlılığını temizle" #: lazarusidestrconsts.lispckeditcommonoptions msgid "Common" msgstr "Ortak" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" msgstr "Komple derle?" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" msgstr "Paketi Derle" #: lazarusidestrconsts.lispckeditcreatefpmakefile msgid "Create fpmake.pp" msgstr "Fpmake.pp Oluştur" #: lazarusidestrconsts.lispckeditcreatemakefile msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" msgid "Create Makefile" msgstr "Makefile Oluştur" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" msgstr "Bağımlılık Özellikleri" #: lazarusidestrconsts.lispckediteditgeneraloptions msgid "Edit general options" msgstr "Genel seçenekleri düzenle" #: lazarusidestrconsts.lispckeditfileproperties msgid "File Properties" msgstr "Dosya Özellikleri" #: lazarusidestrconsts.lispckeditinstall msgid "Install" msgstr "Yükle" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "Geçersiz maksimum sürümü" #: lazarusidestrconsts.lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "Geçersiz minimum sürüm" #: lazarusidestrconsts.lispckeditmaximumversion msgid "Maximum Version:" msgstr "Maksimum Sürüm:" #: lazarusidestrconsts.lispckeditminimumversion msgid "Minimum Version:" msgstr "Minimum Sürüm:" #: lazarusidestrconsts.lispckeditmodified #, object-pascal-format msgid "Modified: %s" msgstr "Değiştirildi: %s" #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" msgstr "Bağımlılığı aşağıya kaydır" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" msgstr "Bağımlılığı yukarı taşı" #: lazarusidestrconsts.lispckeditoptionsforpackage #, object-pascal-format msgid "Options for Package %s" msgstr "Paket %s için Seçenekler" #: lazarusidestrconsts.lispckeditpackage #, object-pascal-format msgid "Package %s" msgstr "Paket %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage #, object-pascal-format msgid "Package \"%s\" has changed.%sSave package?" msgstr "Paket \"%s\" değişti %sPaketi kaydet?" #: lazarusidestrconsts.lispckeditpackagenotsaved #, object-pascal-format msgid "package %s not saved" msgstr "paket %s kaydedilmedi" #: lazarusidestrconsts.lispckeditpage #, object-pascal-format msgid "%s, Page: %s" msgstr "%s, Sayfa: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" msgstr "Yeniden bağımlılık ekle" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" msgstr "Dosyayı yeniden ekle" #: lazarusidestrconsts.lispckeditreadonly #, object-pascal-format msgid "Read Only: %s" msgstr "Salt Okunur: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired msgid "Recompile All Required" msgstr "Gerekli Tüm Yeniden Derle" #: lazarusidestrconsts.lispckeditrecompileclean msgid "Recompile Clean" msgstr "Temizle Yeniden Derle" #: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "Bu ve gereken tüm paketleri yeniden derleyin?" #: lazarusidestrconsts.lispckeditregisteredplugins msgid "Registered plugins" msgstr "Kayıtlı eklentiler" #: lazarusidestrconsts.lispckeditregisterunit msgid "Register unit" msgstr "Kayıt birimi" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" msgstr "Bağımlılığı kaldır" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage #, object-pascal-format msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" msgstr "\"%s\" paketindeki \"%s\"%s bağımlılıkları kaldırılsın mı?" #: lazarusidestrconsts.lispckeditremovedfiles msgid "Removed Files" msgstr "Çıkarılan Dosyalar" #: lazarusidestrconsts.lispckeditremovedrequiredpackages msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages" msgid "Removed required packages" msgstr "Gerekli paketler kaldırıldı" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" msgstr "Dosyayı kaldır" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" msgstr "Dosya kaldırılsın mı?" #: lazarusidestrconsts.lispckeditremovefilefrompackage #, object-pascal-format msgid "Remove file \"%s\"%sfrom package \"%s\"?" msgstr "\"%s\"%s paketinden \"%s\" dosyası kaldırılsın mı?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" msgstr "Seçili öğeyi kaldır" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" msgstr "Gerekli Paketler" #: lazarusidestrconsts.lispckeditsavepackage msgid "Save Package" msgstr "Paket Kaydet" #: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency msgid "Store file name as default for this dependency" msgstr "Bu bağımlılık için dosya adı varsayılan olarak sakla" #: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency msgid "Store file name as preferred for this dependency" msgstr "Bu bağımlılık için dosya adını tercih ettiğiniz gibi sakla" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion #, object-pascal-format msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" msgstr "Maksimum sürüm \"%s\" geçerli bir paket sürümü değildir.%s (iyi örnek 1.2.3.4)" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion #, object-pascal-format msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" msgstr "Minimum sürüm \"%s\" geçerli bir paket sürümü değil.%s (iyi örnek 1.2.3.4)" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" msgstr "Kaldır" #: lazarusidestrconsts.lispckeditviewpackagesource msgid "View Package Source" msgstr "Paket Kaynağını Görüntüle" #: lazarusidestrconsts.lispckexplbase msgid "Base, cannot be uninstalled" msgstr "Temel, kaldırılamaz" #: lazarusidestrconsts.lispckexplinstalled msgctxt "lazarusidestrconsts.lispckexplinstalled" msgid "Installed" msgstr "Yüklü" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" msgstr "Bir sonraki başlatmada yükle" #: lazarusidestrconsts.lispckexplstate #, object-pascal-format msgid "%sState: " msgstr "%sDurum: " #: lazarusidestrconsts.lispckexpluninstallonnextstart msgid "Uninstall on next start (unless needed by an installed package)" msgstr "Bir sonraki başlangıçta kaldır (yüklü bir paket tarafından gerekmedikçe)" #: lazarusidestrconsts.lispckexpluninstallpackage #, object-pascal-format msgid "Uninstall package %s" msgstr "%s paketini kaldır" #: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Bağımlı paketlere ve projelere seçenek ekleme" #: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Bağımlı paketlere / projelere yol ekle" #: lazarusidestrconsts.lispckoptsauthor msgid "Author" msgstr "Yazar" #: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Gerektiği gibi otomatik olarak yeniden oluşturun" #: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Hepsini yeniden derlenirken otomatik derle" #: lazarusidestrconsts.lispckoptscustom msgid "Custom" msgstr "Özel" #: lazarusidestrconsts.lispckoptsdescriptionabstract msgid "Description / Abstract" msgstr "Açıklama / Özet" #: lazarusidestrconsts.lispckoptsdesigntime msgid "Designtime" msgstr "Tasarımzamanı" #: lazarusidestrconsts.lispckoptsdesigntimeandruntime msgid "Designtime and runtime" msgstr "Tasarımzamanı ve çalışma zamanı" #: lazarusidestrconsts.lispckoptsideintegration msgid "IDE Integration" msgstr "IDE Entegrasyonu" #: lazarusidestrconsts.lispckoptsinclude msgid "Include" msgstr "Dahil" #: lazarusidestrconsts.lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "Geçersiz paket türü" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" msgstr "Kütüphane" #: lazarusidestrconsts.lispckoptslicense msgid "License" msgstr "Lisans" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" msgstr "Bağlayıcı" #: lazarusidestrconsts.lispckoptsmajor msgid "Major" msgstr "Ana" #: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "Manuel derleme (otomatik olarak asla)" #: lazarusidestrconsts.lispckoptsminor msgid "Minor" msgstr "En küçük" #: lazarusidestrconsts.lispckoptsobject msgid "Object" msgstr "Nesne" #: lazarusidestrconsts.lispckoptspackagetype msgid "Package type" msgstr "Paket Tipi" #: lazarusidestrconsts.lispckoptsprovides msgid "Provides" msgstr "Sağlar" #: lazarusidestrconsts.lispckoptsrelease msgid "Release" msgstr "Serbest bırak" #: lazarusidestrconsts.lispckoptsruntime msgid "Runtime" msgstr "Çalışmazamanı" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans #, object-pascal-format msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." msgstr "\"%s\" paketi otomatik yükleme bayrağına sahiptir.%sBu, IDE'de yükleneceği anlamına gelir.%sKurulum paketleri tasarım zamanı Paketleri olmalıdır." #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "Bu paket aşağıdaki paketlerin aynısını sağlar:" #: lazarusidestrconsts.lispckoptsupdaterebuild msgid "Update / Rebuild" msgstr "Güncelle/Yeniden Oluştur" #: lazarusidestrconsts.lispckoptsusage msgid "Usage" msgstr "Kullanım" #: lazarusidestrconsts.lispckpackage msgid "Package:" msgstr "Paket:" #: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon." msgstr "Fpdoc xml dosyaları için arama yolları: Birden fazla yol, noktalı virgülle ayrılmış olmalıdır." #: lazarusidestrconsts.lispckshowunneededdependencies msgid "Show unneeded dependencies" msgstr "Gereksiz bağımlılıkları göster" #: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked." msgstr "Form kaydedildiğinde, IDE tüm TTranslateString özelliklerini paket po dosyasına depolayabilir. Bunun için bu paket için I18N'i etkinleştirmeli, bir po çıktı dizini sağlamalı ve bu seçeneği işaretli bırakmalısınız." #: lazarusidestrconsts.lispdabort msgctxt "lazarusidestrconsts.lispdabort" msgid "Abort" msgstr "İptal" #: lazarusidestrconsts.lispdprogress msgid "Progress" msgstr "İlerleme" #: lazarusidestrconsts.lispecollapsedirectory msgid "Collapse directory" msgstr "Dizini daralt" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" msgstr "Çakışma bulundu" #: lazarusidestrconsts.lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "Sanal Birimi Düzenle" #: lazarusidestrconsts.lispeexpanddirectory msgid "Expand directory" msgstr "Dizini genişlet" #: lazarusidestrconsts.lispefilename msgid "Filename:" msgstr "Dosya adı:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" msgstr "Dosyaları Düzelt" #: lazarusidestrconsts.lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Geçersiz birim dosya adı" #: lazarusidestrconsts.lispeinvalidunitname msgid "Invalid unitname" msgstr "Geçersiz birim adı" #: lazarusidestrconsts.lispemissingfilesofpackage #, object-pascal-format msgid "Missing files of package %s" msgstr "%s paketinin eksik dosyaları" #: lazarusidestrconsts.lispenewfilenotinincludepath msgid "New file not in include path" msgstr "Yeni dosya yolunda değil" #: lazarusidestrconsts.lispenofilesmissingallfilesexist msgid "No files missing. All files exist." msgstr "Eksik dosya yok. Tüm dosyalar var." #: lazarusidestrconsts.lisperemovefiles msgid "Remove files" msgstr "Dosyaları kaldır" #: lazarusidestrconsts.lisperevertpackage msgid "Revert Package" msgstr "Paketi geri al" #: lazarusidestrconsts.lispesavepackageas msgid "Save Package As ..." msgstr "Paketi Farklı Kaydet ..." #: lazarusidestrconsts.lispeshowdirectoryhierarchy msgid "Show directory hierarchy" msgstr "Dizin hiyerarşisini göster" #: lazarusidestrconsts.lispeshowmissingfiles msgid "Show Missing Files" msgstr "Eksik Dosyaları Göster" #: lazarusidestrconsts.lispesortfiles msgid "Sort Files Permanently" msgstr "Dosyaları Kalıcı Olarak Sırala" #: lazarusidestrconsts.lispesortfilesalphabetically msgid "Sort files alphabetically" msgstr "Dosyaları alfabetik olarak sırala" #: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea #, object-pascal-format msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" msgstr "\"%s\" dosyası şu anda paketin içerme yolunda değil.%s\"%s\" dosyasını içerme yoluna eklensin mi?" #: lazarusidestrconsts.lispeunitname msgid "Unitname:" msgstr "Birimadı:" #: lazarusidestrconsts.lispeuseallunitsindirectory msgid "Use all units in directory" msgstr "Dizindeki tüm birimleri kullan" #: lazarusidestrconsts.lispeusenounitsindirectory msgid "Use no units in directory" msgstr "Dizinde hiçbir birim kullanma" #: lazarusidestrconsts.lispkgcleanuppackagedependencies msgid "Clean up package dependencies" msgstr "Paket bağımlılıklarını temizle" #: lazarusidestrconsts.lispkgclearselection msgid "Clear Selection" msgstr "Seçimi Temizle" #: lazarusidestrconsts.lispkgdeletedependencies msgid "Delete dependencies" msgstr "Bağımlılıkları sil" #: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand #, object-pascal-format msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "%s paketindeki tüm değişiklikleri yok saymak ve dosyayı yeniden yüklemek istiyor musunuz?" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Yeni birim ünite yolunda değil" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" msgstr "Paketi Yayınla" #: lazarusidestrconsts.lispkgeditrevertpackage msgid "Revert package?" msgstr "Paketi geri al?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage #, object-pascal-format msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?" msgstr "\"%s\" %s dosyası şu anda paketin birim yolunda değil.%s \"%s\" birim yolu eklensin mi?" #: lazarusidestrconsts.lispkgedmorefunctionsforthepackage msgid "More functions for the package" msgstr "Paket için daha fazla fonksiyon" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage #, object-pascal-format msgid "%sAdding new Dependency for package %s: package %s" msgstr "%sPaket %s için yeni bağımlılık ekleme: paket %s" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage #, object-pascal-format msgid "%sAdding new Dependency for project %s: package %s" msgstr "%sProje %s için yeni Bağımlılık ekleme: paket %s" #: lazarusidestrconsts.lispkgmangaddunittousesclause msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." msgstr "Uses bölümüne paket ana dosyasının birim ekleyin. Bunu yalnızca her durumda derlenmemesi gereken birimler için devre dışı bırakın." #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Belirsiz birimler bulundu" #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Otomatik olarak yüklenen paketler" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu #, object-pascal-format msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sHer iki paket de bağlı. Bunun anlamı, bir paket diğerini kullanır veya her ikisi de üçüncü bir paket tarafından kullanılır." #: lazarusidestrconsts.lispkgmangbrokendependency msgid "Broken dependency" msgstr "Bozuk bağımlılık" #: lazarusidestrconsts.lispkgmangcirculardependencies msgid "Circular dependencies found" msgstr "Dairesel bağımlılıklar bulundu" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Eski Paket Dosyasını Silsin mi?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 #, object-pascal-format msgid "Delete old package file \"%s\"?" msgstr "Eski paket dosyasını \"%s\" silinsin mi?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner #, object-pascal-format msgid "Dependency without Owner: %s" msgstr "Sahibi Olmayan Bağımlılık: %s" #: lazarusidestrconsts.lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "Paket Okuma Hatası" #: lazarusidestrconsts.lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "Paket Yazma Hatası" #: lazarusidestrconsts.lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "Dosya zaten pakette" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" msgstr "Dosya Projede" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "Dosya adı Packagename'den farklı" #: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "Dosya adı başka bir paket tarafından kullanılıyor" #: lazarusidestrconsts.lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "Dosya adı proje tarafından kullanılıyor" #: lazarusidestrconsts.lispkgmangfilenotfound #, object-pascal-format msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" msgid "File \"%s\" not found." msgstr "Dosya \"%s\" bulunamadı." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" msgstr "Dosya kaydedilmedi" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac #, object-pascal-format msgid "Installing the package %s will automatically install the package:" msgstr "%s paketinin kurulması otomatik olarak şu paketi yükleyecek:" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 #, object-pascal-format msgid "Installing the package %s will automatically install the packages:" msgstr "%s paketinin kurulması otomatik olarak şu paketleri yükleyecek:" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "Geçersiz dosya uzantısı" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "Geçersiz paket dosya uzantısı" #: lazarusidestrconsts.lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "Geçersiz paket dosya adı" #: lazarusidestrconsts.lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Geçersiz paket adı" #: lazarusidestrconsts.lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "Geçersiz Paket Adı" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage #, object-pascal-format msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" msgstr "%s paketinin yüklenmesi %s dosyasındaki %s%s paketinin yerini alacaktır.%sEski paket değiştirildi.%sEski paket kaydedilsin mi? %s" #: lazarusidestrconsts.lispkgmangpackage #, object-pascal-format msgid "Package: %s" msgstr "Paket: %s" #: lazarusidestrconsts.lispkgmangpackageconflicts msgid "Package conflicts" msgstr "Paket çakışmaları" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage msgid "Package is not a designtime package" msgstr "Paket bir tasarım zamanı paketi değil" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" msgstr "Paket gerekiyor" #: lazarusidestrconsts.lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "Paket adı zaten var" #: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "Paketlerin uzantısı .lpk olmalıdır" #: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst msgid "Please compile the package first." msgstr "Lütfen önce paketi derleyin." #: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "Dosyayı bir pakete eklemeden önce kaydedin." #: lazarusidestrconsts.lispkgmangproject #, object-pascal-format msgid "Project: %s" msgstr "Proje: %s" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Lazarus'u yeniden derle?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "Dosya küçük harfini yeniden adlandırın?" #: lazarusidestrconsts.lispkgmangreplaceexistingfile #, object-pascal-format msgid "Replace existing file \"%s\"?" msgstr "Varolan dosyayı değiştir \"%s\"?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" msgstr "Dosyayı Değiştir" #: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound msgid "One or more required packages were not found. See package graph for details." msgstr "Gerekli bir veya daha fazla paket bulunamadı. Ayrıntılar için paket grafiğine bakın." #: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage #, object-pascal-format msgid "" "The package %s is already open in the IDE.\n" "You cannot save a package with the same name." msgstr "" "%s paketi IDE'de zaten açık.\n" "Aynı ada sahip bir paketi kaydedemezsiniz.." #: lazarusidestrconsts.lispkgmangsavepackage msgid "Save package?" msgstr "Paket Kaydedilsin mi?" #: lazarusidestrconsts.lispkgmangsavepackagelpk #, object-pascal-format msgid "Save Package %s (*.lpk)" msgstr "Paket Kaydet %s (* .lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto #, object-pascal-format msgid "Should the file be renamed lowercase to%s\"%s\"?" msgstr "Dosya küçük harfe yeniden adlandırılsın mı?%s\"%s\"?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" msgstr "Bu paketi atla" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage #, object-pascal-format msgid "The file \"%s\"%sis already in the package %s." msgstr "\"%s\"%s dosyası zaten %s paketinde bulunuyor." #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage #, object-pascal-format msgid "The file \"%s\" is not a Lazarus package." msgstr "\"%s\" dosyası bir Lazarus paketi değildir." #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage #, object-pascal-format msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" msgstr "\"%s\" dosya adı, dosyadaki \"%s\" paket adına karşılık gelmiyor.%sPaket adını \"%s\" olarak değiştir?" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject #, object-pascal-format msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." msgstr "\"%s\" dosya adı geçerli projenin bir parçasıdır.%sProjeler ve Paketler dosyaları paylaşmamalıdır." #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile #, object-pascal-format msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." msgstr "\"%s\" dosya adı, \"%s\" dosyasındaki \"%s\" %s %spaketi tarafından kullanılmaktadır." #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "Aşağıdaki paket yüklenemedi:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "Aşağıdaki paketler yüklenemedi:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof #, object-pascal-format msgid "%sThe following units will be added to the uses section of%s%s:%s%s" msgstr "%sBunların %s%s uses bölümüne eklenecek: %s%s" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename #, object-pascal-format msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." msgstr "%s \"%s\" içindeki \"%s\" paket dosyasının adı geçerli bir Lazarus paket adı değil." #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages #, object-pascal-format msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." msgstr "%s paketi yalnızca bir çalışma zamanı paketi.%s Çalışma zamanı paketleri IDE'ye yüklenemez." #: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec #, object-pascal-format msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies." msgstr "\"%s\" paketi otomatik olarak derlenir ve çıktı dizini derleyicinin varsayılan birim arama yolunda bulunan \"%s \"dir. Paket, derleyicinin varsayılan birim arama yolunu kullanan diğer paketleri de kullanıyor. Bu sonsuz bir döngü yaratır.%sBu sorunu derleyici yapılandırmanızdan yolu kaldırarak (örn. fpc.cfg)%sveya bu paketin otomatik güncellemesini devre dışı bırakarak veya bağımlılıkları kaldırarak çözebilirsiniz." #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound #, object-pascal-format msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?" msgstr "\"%s\" paketi kurulum için işaretlenmiş ancak bulunamıyor.%sBağımlılığı paketlerin kurulum listesinden kaldırılsın mı?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation #, object-pascal-format msgid "The package %s is required by %s which is marked for installation.%sSee package graph." msgstr "%s paketi, kurulum için işaretlenmiş olan %s tarafından gereklidir.%s Paket grafiğine bakın." #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean #, object-pascal-format msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "\"%s\" paket adı geçerli bir paket adı değil%sLütfen başka bir ad seçin (örneğin, paket1.lpk)" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid #, object-pascal-format msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." msgstr "\"%s\" dosyasının%s \"%s\" paket adı geçersiz." #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus #, object-pascal-format msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" msgstr "\"%s\" paketi işaretlendi.%sŞu anda Lazarus yalnızca statik bağlantılı paketleri destekliyor. Gerçek kurulum kaldırma işlemi Lazarus'un yeniden oluşturulmasını ve yeniden başlatılmasını gerektirir.%sŞimdi Lazarus'u yeniden oluşturmak istiyor musunuz?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus #, object-pascal-format msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" msgstr "\"%s\" paketi kurulum için işaretlendi.%sŞu anda Lazarus yalnızca statik bağlantılı paketleri destekliyor. Gerçek kurulum Lazarus'un yeniden oluşturulmasını ve yeniden başlatılmasını gerektirir.%sLazarus'u şimdi yeniden oluşturmak istiyor musunuz?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound #, object-pascal-format msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." msgstr "Proje \"%s\" paketini gerektiriyor.%sAncak bulunamadı. Proje -> Proje Denetçisi bölümüne bakın." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from #, object-pascal-format msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" msgstr "Aynı ada sahip iki birim var: %s1. \"%s\" %s den %s2. \"%s\" %s" #: lazarusidestrconsts.lispkgmangthereisacirculardependency msgid "There is a circular dependency in the packages. See package graph." msgstr "Paketlerde dairesel bir bağımlılık var. Paket grafiğine bakın." #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage #, object-pascal-format msgid "There is a FPC unit with the same name as a package:%s\"%s\"" msgstr "Paket olarak aynı ada sahip bir FPC birimi var: %s \"%s\"" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom #, object-pascal-format msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" msgstr "Aynı adla aynı adda bir FPC birimi var:%s'dan%s \"%s\"" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename #, object-pascal-format msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" msgstr "Zaten \"%s\" adında başka bir paket var.%sÇakışma paketi: \"%s\"%sDosya: \"%s\"" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile #, object-pascal-format msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." msgstr "Zaten \"%s\" dosyasından yüklenmiş bir \"%s\".%s paketi var. %sPaket -> Paket Grafiğine bakın.%sDeğiştirme imkansız." #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "Gerekli paketlerde kaydedilmemiş bir paket var. Paket grafiğine bakın." #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 #, object-pascal-format msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" msgstr "Bir paketle aynı ada sahip bir birim var:%s1. \"%s\" %s%s2'den. \"%s\"" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "Bu sanal bir pakettir. Henüz kaynağı yoktur. Lütfen önce paketi kaydedin." #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus #, object-pascal-format msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." msgstr "Lazarus için hedef dizin oluşturulamıyor:%s\"%s\".%sBu dizin, özel paketlerinizle yeni değiştirilen Lazarus IDE için gereklidir." #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror #, object-pascal-format msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" msgstr "\"%s\"%s paketi \"%s\" dosyasına yazılamıyor.%s Hata:%s" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Paketi kaldır?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 #, object-pascal-format msgid "Uninstall package %s?" msgstr "Paket %s kaldırılsın mı?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" msgstr "Kaydedilmemiş paket" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" msgstr "Birimi kullan" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject #, object-pascal-format msgid "Warning: The file \"%s\"%sbelongs to the current project." msgstr "Uyarı: \"%s\"%sdosyası geçerli projeye aittir." #: lazarusidestrconsts.lispkgmgrkeep msgid "keep" msgstr "duracak" #: lazarusidestrconsts.lispkgmgrnew msgid "new" msgstr "yeni" #: lazarusidestrconsts.lispkgmgrremove msgid "remove" msgstr "kaldırılacak" #: lazarusidestrconsts.lispkgselectapackage msgid "Select a package" msgstr "Bir paket seçin" #: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies." msgstr "Paket bağımlılıkları arasındaki otomatik geçişlilik nedeniyle aşağıdaki bağımlılıklara gerek yoktur." #: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin #, object-pascal-format msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s" msgstr "Proje, aşağıdaki paketlerin çıktı dizinini geçersiz kılar.%sBkz Proje / Proje Seçenekleri (derleyici seçenekleri bölümü) / Eklemeler ve Geçersiz Kılmalar%s%s" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "Bu dosya yüklenen hiçbir pakette bulunmamaktadır." #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror #, object-pascal-format msgid "Unable to read package file \"%s\".%sError: %s" msgstr "\"%s\" paket dosyası okunamıyor.%sHata: %s" #: lazarusidestrconsts.lisplay msgid "Play" msgstr "Oynat" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" msgid "Global" msgstr "Küresel" #: lazarusidestrconsts.lispldonline msgid "Online" msgstr "Çevrimiçi" #: lazarusidestrconsts.lispldonlinepackagescannotbedeleted msgid "Online packages cannot be deleted" msgstr "Çevrimiçi paketler silinemez" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" msgstr "Paket Bağlantıları" #: lazarusidestrconsts.lispldshowgloballinksin msgid "Show global links in " msgstr "Küresel bağlantıları göster " #: lazarusidestrconsts.lispldshowonlinelinks msgid "Show online links" msgstr "Çevrimiçi linkleri göster" #: lazarusidestrconsts.lispldshowuserlinksin msgid "Show user links in " msgstr "Kullanıcı bağlantılarını göster " #: lazarusidestrconsts.lispldsomepackagescannotbedeleted msgid "Some packages cannot be deleted" msgstr "Bazı paketler silinemez" #: lazarusidestrconsts.lisplduser msgid "User" msgstr "Kullanıcı" #: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow msgid "Please fix the error shown in the message window which is normally below the source editor." msgstr "Lütfen normalde kaynak düzenleyicinin altında olan mesaj penceresinde gösterilen hatayı düzeltin." #: lazarusidestrconsts.lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "Lütfen çalıştırmadan önce bir ünite açın." #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "Lütfen yeni bir prosedür / yöntem çıkarmak için bazı kodları seçin." #: lazarusidestrconsts.lisplistall msgctxt "lazarusidestrconsts.lisplistall" msgid "" msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" msgstr "Yazı Tipini Değiştir" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "Yöntem adını panoya kopyala" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" msgstr "Metodun herhangi bir parçasını eşleyerek filtreleme" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" msgstr "Yöntemin başlangıcıyla eşleşen filtreleme" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" msgstr "Seçime Git" #: lazarusidestrconsts.lisplistnone msgid "" msgstr "" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" msgstr "&Nesneler" #: lazarusidestrconsts.lisplistprocedurelist msgid "Procedure List" msgstr "Prosedür Listesi" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" msgid "Type" msgstr "Tür" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" msgstr ".po dosya dizini seçin" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "Herhangi bir oturum bilgisi kaydetme" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in .lps file in IDE config directory" msgstr ".lps dosyasını IDE yapılandırma dizinine kaydedin" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" msgstr ".lpi dosyasına kaydet" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr ".lps dosyasını proje dizinine kaydedin" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" msgstr "Oturum bilgisini içine kaydet" #: lazarusidestrconsts.lisposavesessioninformationinhint msgid ".lpi is the project main info file, .lps is a separate file for session data only." msgstr ".lpi proje ana bilgi dosyasıdır, .lps sadece oturum verileri için ayrı bir dosyadır." #: lazarusidestrconsts.lisposition msgid "Position" msgstr "Konum" #: lazarusidestrconsts.lispositionoutsideofsource #, object-pascal-format msgid "%s (position outside of source)" msgstr "%s (kaynak dışındaki konum)" #: lazarusidestrconsts.lisppuinwrongdirectory #, object-pascal-format msgid "ppu in wrong directory=%s." msgstr "ppu yanlış dizinde = %s." #: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg #, object-pascal-format msgid "%s.ppu not found. Check your fpc.cfg." msgstr "%s .ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin." #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" msgstr "Önceden geçen kelime" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig #, object-pascal-format msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"." msgstr "Lazarus'un yapılandırma dosyalarını depoladığı birincil yapılandırma dizini. Varsayılan değer \"%s\" dir." #: lazarusidestrconsts.lisprimaryconfigpath msgid "Primary config path" msgstr "Birincil yapılandırma yolu" #: lazarusidestrconsts.lisprior #, object-pascal-format msgid "prior %s" msgstr "önceki %s" #: lazarusidestrconsts.lispriority msgctxt "lazarusidestrconsts.lispriority" msgid "Priority" msgstr "Öncelikli" #: lazarusidestrconsts.lisprivate msgid "Private" msgstr "Özel" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" msgstr "Özel Yöntem" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti #, object-pascal-format msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first." msgstr "Devam etmeden önce muhtemelen bazı paketleri yüklemeniz gerekiyor.%sUyarı:%sProje, tasarımcıda formu açmak için gerekli olabilecek aşağıdaki tasarım zamanı paketlerini kullanır. Devam ederseniz, eksik bileşenlerle ilgili hatalar alabilirsiniz ve form yüklemesi muhtemelen çok hoş olmayan sonuçlar yaratacaktır.%sÖnce bu paketleri iptal etmeniz ve yüklemeniz önerilir." #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" msgid "Procedure" msgstr "Prosedür" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" msgstr "Arabirimli Prosedür" #: lazarusidestrconsts.lisprogram msgctxt "lazarusidestrconsts.lisprogram" msgid "Program" msgstr "Program" #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" msgstr "Program tespit edildi" #: lazarusidestrconsts.lisprogramprogramdescriptor msgid "A Free Pascal command line program with some useful settings added." msgstr "Bazı yararlı ayarlarla birlikte bir Free Pascal komut satırı programı eklendi." #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a Pascal extension like .pas, .pp or .lpr" msgstr "Program kaynağı, .pas, .pp veya .lpr gibi bir Pascal uzantısına sahip olmalıdır" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Bağımlılık zaten var" #: lazarusidestrconsts.lisprojaddeditorfile msgid "Add Editor Files" msgstr "Editör Dosyalarını Ekle" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "Geçersiz Min-Max sürümü" #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" msgstr "Geçersiz sürüm" #: lazarusidestrconsts.lisprojaddlocalpkg #, object-pascal-format msgid "Local (%s)" msgstr "Yerel (%s)" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "Maksimum Sürüm (isteğe bağlı):" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Minimum Sürüm (isteğe bağlı):" #: lazarusidestrconsts.lisprojaddnewfpmakerequirement msgid "New FPMake Requirement" msgstr "Yeni FPMake Gereksinimi" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" msgstr "Yeni Gereksinim" #: lazarusidestrconsts.lisprojaddonlinepkg #, object-pascal-format msgid "Online (%s)" msgstr "Çevrimçi (%s)" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" msgstr "Paket ismi:" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" msgstr "Paket bulunamadı" #: lazarusidestrconsts.lisprojaddpackagetype msgid "Package Type:" msgstr "Paket tipi:" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound #, object-pascal-format msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." msgstr "\"%s\" bağımlılığı bulunamadı.%sLütfen mevcut bir paket seçin." #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid #, object-pascal-format msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" msgstr "Maksimum Sürüm \"%s\" geçersizdir.%sLütfen major.minor.release.build%s biçimini kullanınÖrneğin: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür." #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid #, object-pascal-format msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" msgstr "Minimum Sürüm \"%s\" geçersizdir.%sLütfen major.minor.release.build%s biçimini kullanınÖrneğin: 1.0.20.10" #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency #, object-pascal-format msgid "The project has already a dependency for the package \"%s\"." msgstr "Projenin \"%s\" paketi için zaten bir bağımlılığı var." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject #, object-pascal-format msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." msgstr "\"%s\" birim adı %s projesinde dosya ile zaten mevcut: \"%s\"." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection #, object-pascal-format msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." msgstr "Birim adı \"%s\" zaten dosya ile %s seçiminde mevcut: \"%s\"." #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Birim adı zaten var" #: lazarusidestrconsts.lisproject #, object-pascal-format msgid "Project %s" msgstr "Proje %s" #: lazarusidestrconsts.lisproject2 msgid "Project: " msgstr "Proje: " #: lazarusidestrconsts.lisproject3 msgid "project" msgstr "proje" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" msgstr "Proje değiştirildi" #: lazarusidestrconsts.lisprojectchangedondisk msgid "Project changed on disk" msgstr "Proje disk üzerinde değişti" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" msgid "Project directory" msgstr "Proje dizini" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" msgstr "Proje dosya adı" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" msgstr "Projeyi yola dahil et" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" msgstr "Proje bilgi dosyası algılandı" #: lazarusidestrconsts.lisprojectinspectorshowprops msgid "Show properties pane in Project Inspector" msgstr "Proje denetçisinde özellikler bölmesini göster" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" msgstr "Proje çalıştırılabilir" #: lazarusidestrconsts.lisprojectisrunnablehint msgid "Generates a binary executable which can be run." msgstr "Çalıştırılabilen bir ikili(binary) yürütülebilir dosya oluşturur." #: lazarusidestrconsts.lisprojectmacro msgctxt "lazarusidestrconsts.lisprojectmacro" msgid "Project" msgstr "Proje" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" msgstr "Proje makro özellikleri" #: lazarusidestrconsts.lisprojectnamespaces msgid "Project Namespaces" msgstr "Proje alanadı" #: lazarusidestrconsts.lisprojectoption msgid "Project Option" msgstr "Proje Seçenekleri" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" msgstr "Proje Çıktı dizini (ör. Ppu dizini)" #: lazarusidestrconsts.lisprojectoutputdirectory msgid "Project output directory" msgstr "Proje çıktı dizini" #: lazarusidestrconsts.lisprojectpathhint msgid "Directory where project's main file must be" msgstr "Projenin ana dosyasının olması gereken dizin" #: lazarusidestrconsts.lisprojectsession msgid "Project Session" msgstr "Proje Oturumu" #: lazarusidestrconsts.lisprojectsessionchanged msgid "Project session changed" msgstr "Proje oturumu değişti" #: lazarusidestrconsts.lisprojectsourcedirectories msgid "Project source directories" msgstr "Proje kaynak dizinleri" #: lazarusidestrconsts.lisprojectsraisedexceptionataddress #, object-pascal-format msgid "%0:s%0:s At address %1:x" msgstr "%0:s%0:s Adresinde %1:x" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss #, object-pascal-format msgid "Project %s raised exception class '%s'." msgstr "%s projesinde istisna sınıfı oluştu '%s'." #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess #, object-pascal-format msgid "Project %s raised exception class '%s' with message:%s%s" msgstr "%s projesi istisna sınıfı '%s' mesajını verdi:%s%s" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at address %2:x" msgstr "%0:s%0:s dosyasında '%1:s' adresinde %2:x" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileline #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at line %2:d" msgstr "%0:s%0:s dosyasında '%1:s' satırında %2:d" #: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc #, object-pascal-format msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" msgstr "%0:s%0:s satırındaki %1:s dosyasında: %2:d:%0:s%3:s" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Proje Src Yolu" #: lazarusidestrconsts.lisprojectunit msgid "project unit" msgstr "proje birimi" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" msgstr "Proje Birimi Yolu" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" msgstr "Proje Sihirbazı" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "Bağımlılığı silmeyi onaylayın" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "Dosyayı kaldırmayı onayla" #: lazarusidestrconsts.lisprojinspdeletedependencyfor #, object-pascal-format msgid "Delete dependency for %s?" msgstr "%s için bağımlılık silinsin mi?" #: lazarusidestrconsts.lisprojinspprojectinspector #, object-pascal-format msgid "Project Inspector - %s" msgstr "Proje denetçisi - %s" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages" msgid "Removed required packages" msgstr "Gerekli paketler kaldırıldı" #: lazarusidestrconsts.lisprojinspremovefilefromproject #, object-pascal-format msgid "Remove file %s from project?" msgstr "%s dosyası projeden kaldırılsın mı?" #: lazarusidestrconsts.lisprojinspremoveitemsf #, object-pascal-format msgid "Remove %s items from project?" msgstr "%s öğeler projeden kaldırsın mı?" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Her zaman derle (hiçbir şey değişmese bile)" #: lazarusidestrconsts.lisprojoptsalwaysbuildhint msgid "May be needed if there is a bug in dependency check, normally not needed." msgstr "Bağımlılık kontrolünde bir hata varsa gerekli olabilir, normalde gerekli değildir." #: lazarusidestrconsts.lisprojoptserror msgctxt "lazarusidestrconsts.lisprojoptserror" msgid "Error" msgstr "Hata" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist #, object-pascal-format msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "Program kaynağında otomatik form oluşturma listesi değiştirilemiyor.%sLütfen önce hataları düzeltin." #: lazarusidestrconsts.lispromptforvalue msgid "Prompt for value" msgstr "Değer isteyin" #: lazarusidestrconsts.lisproperties msgid "Properties (replace or remove)" msgstr "Özellikler (değiştir veya kaldır)" #: lazarusidestrconsts.lisproperty #, object-pascal-format msgid "%s property" msgstr "%s özellikler" #: lazarusidestrconsts.lisprotected msgid "Protected" msgstr "Korumalı" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" msgstr "Korumalı Yöntem" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" msgstr "Genel Yöntem" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" msgstr "Yayımlanmış Yöntem" #: lazarusidestrconsts.lispublishedto #, object-pascal-format msgid "Published to %s" msgstr "%s yayınlandı" #: lazarusidestrconsts.lispublishmodulenote msgid "Files belonging to project / package will be included automatically." msgstr "Proje/pakete ait dosyalar otomatik olarak eklenecektir." #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" msgstr "Proje dizini yayınla" #: lazarusidestrconsts.lispublishproject msgid "Publish Project" msgstr "Projeyi Yayınla" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" msgstr ".lrs dosyalarını çıkış dizinine kaydedin" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint msgid "The resource will be available for FPC." msgstr "Kaynak FPC için kullanılabilir olacaktır." #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" msgid "A Pascal unit must have the extension .pp or .pas" msgstr "Bir Pascal biriminin uzantısı .pp veya .pas olmalıdır" #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" msgstr "Sanal birimi düzenle" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile #, object-pascal-format msgid "There is already an unit with this name.%sFile: %s" msgstr "Bu isimde bir birim zaten var.%sDosya: %s" #: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid Pascal identifier." msgstr "Birim adı geçerli bir Pascal tanımlayıcısı değil." #: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni #, object-pascal-format msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Birim adı ve dosya adı uyuşmuyor.%s Örneği: unit1.pas ve unit1" #: lazarusidestrconsts.lispwconvertproject msgid "Convert &Delphi Project" msgstr "&Delphi Projesini çevir" #: lazarusidestrconsts.lispwnewproject msgid "&New Project" msgstr "&Yeni proje" #: lazarusidestrconsts.lispwopenproject msgid "&Open Project" msgstr "&Projeyi Aç" #: lazarusidestrconsts.lispwopenrecentproject msgid "Open &Recent Project" msgstr "&En son Projeyi aç" #: lazarusidestrconsts.lispwviewexampleprojects msgid "View &Example Projects" msgstr "&Örnek Projeleri gör" #: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart msgid "Quick check Fppkg configuration at start" msgstr "Başlangıçta Fppkg yapılandırmasını hızlı kontrol edin" #: lazarusidestrconsts.lisquickfixerror msgid "QuickFix error" msgstr "Hızlı düzeltme hatası" #: lazarusidestrconsts.lisquickfixes msgid "Quick fixes" msgstr "Hızlı düzeltmeler" #: lazarusidestrconsts.lisquickfixsearchidentifier msgid "Search identifier" msgstr "Arama tanımlayıcısı" #: lazarusidestrconsts.lisquit msgid "Quit" msgstr "Çıkış" #: lazarusidestrconsts.lisquitlazarus msgid "&Quit Lazarus" msgstr "&Lazarus'tan Çık" #: lazarusidestrconsts.lisreallydelete msgid "Really delete?" msgstr "Gerçekten silinsin mi?" #: lazarusidestrconsts.lisrecenttabs msgid "Recent tabs" msgstr "Son sekmeler" #: lazarusidestrconsts.lisrecord msgctxt "lazarusidestrconsts.lisrecord" msgid "Record" msgstr "Kayıt" #: lazarusidestrconsts.lisrecordedmacros msgid "Recorded" msgstr "Kaydedilmiş" #: lazarusidestrconsts.lisredo msgid "Redo" msgstr "İleri" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" msgstr "Düzenli ifade" #: lazarusidestrconsts.lisrelative msgid "Relative" msgstr "Göreceli" #: lazarusidestrconsts.lisremove msgid "Remove" msgstr "Kaldır" #: lazarusidestrconsts.lisremove2 msgid "Remove?" msgstr "Kaldır?" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Geçersiz tüm özellikleri kaldır" #: lazarusidestrconsts.lisremoveallmessagetypefilters msgid "Remove all message type filters" msgstr "Tüm mesaj türü filtrelerini kaldır" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" msgstr "Tüm birimleri kaldır" #: lazarusidestrconsts.lisremovecompileroptionhidemessage msgid "Remove Compiler Option Hide Message" msgstr "Derleyici Seçeneğini Gizle Mesajını Kaldır" #: lazarusidestrconsts.lisremovedependenciesfrompackage #, object-pascal-format msgid "Remove %s dependencies from package \"%s\"?" msgstr "%s bağımlılıklarını \"%s\" paketinden kaldırsın mı?" #: lazarusidestrconsts.lisremovedpropertys #, object-pascal-format msgid "Removed property \"%s\"." msgstr "\"%s\" özelliği kaldırıldı." #: lazarusidestrconsts.lisremovefilesfrompackage #, object-pascal-format msgid "Remove %s files from package \"%s\"?" msgstr "%s dosyalarını \"%s\" paketinden kaldır?" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from Project" msgstr "Projeden Kaldır" #: lazarusidestrconsts.lisremovefromsearchpath msgid "Remove from search path" msgstr "Arama yolundan kaldır" #: lazarusidestrconsts.lisremoveincludepath msgid "Remove include path?" msgstr "Dahili yol kaldırılsın mı?" #: lazarusidestrconsts.lisremovelocalvariable3 #, object-pascal-format msgid "Remove local variable \"%s\"" msgstr "Yerel değişkeni \"%s\" kaldır" #: lazarusidestrconsts.lisremovemessagetypefilter msgid "Remove Message Type Filter" msgstr "Mesaj Türü Filtresini Kaldır" #: lazarusidestrconsts.lisremovenonexistingfiles msgid "Remove nonexistent files" msgstr "Varolmayan dosyaları kaldırma" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" msgstr "Seçilen birimleri kaldır" #: lazarusidestrconsts.lisremovethem msgid "Remove them" msgstr "Kendiilerini kaldır" #: lazarusidestrconsts.lisremovethepathsfromothersources msgid "Remove the paths from \"Other sources\"" msgstr "Diğer kaynaklardan yolları kaldırın" #: lazarusidestrconsts.lisremoveunitpath msgid "Remove unit path?" msgstr "Birim yolunu kaldır?" #: lazarusidestrconsts.lisremoveuses #, object-pascal-format msgid "Remove uses \"%s\"" msgstr "Uses den kaldır \"%s\"" #: lazarusidestrconsts.lisrename msgctxt "lazarusidestrconsts.lisrename" msgid "Rename" msgstr "Yeniden Adlandır" #: lazarusidestrconsts.lisrename2 msgid "Rename ..." msgstr "Yeniden Adlandır ..." #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" msgstr "Dosyayı yeniden adlandır?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" msgstr "Dosya yeniden adlandırılamadı" #: lazarusidestrconsts.lisrenameshowresult msgid "Show list of renamed Identifiers" msgstr "Yeniden adlandırılmış Tanımlayıcıların listesini göster" #: lazarusidestrconsts.lisrenameto #, object-pascal-format msgid "Rename to %s" msgstr "%s için yeniden adlandır" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" msgstr "Küçük harfe yeniden adlandır" #: lazarusidestrconsts.lisreopenproject msgid "Reopen project" msgstr "Projeyi tekrar aç" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "Başka bir kodlamayla tekrar aç" #: lazarusidestrconsts.lisrepeat msgctxt "lazarusidestrconsts.lisrepeat" msgid "Repeat" msgstr "Tekrar et" #: lazarusidestrconsts.lisreplace msgid "Replace" msgstr "Değiştir" #: lazarusidestrconsts.lisreplacedpropertyswiths #, object-pascal-format msgid "Replaced property \"%s\" with \"%s\"." msgstr "\"%s\" ile \"%s\" değiştirildi." #: lazarusidestrconsts.lisreplacedtypeswiths #, object-pascal-format msgid "Replaced type \"%s\" with \"%s\"." msgstr "\"%s\" ile \"%s\" değiştirildi." #: lazarusidestrconsts.lisreplacement msgid "Replacement" msgstr "Değiştirme" #: lazarusidestrconsts.lisreplacementfuncs msgid "Replacement functions" msgstr "Değiştirme işlevleri" #: lazarusidestrconsts.lisreplacements msgid "Replacements" msgstr "Değiştirmeler" #: lazarusidestrconsts.lisreplaceremoveunknown msgid "Fix unknown properties and types" msgstr "Bilinmeyen özellikleri ve türleri düzelt" #: lazarusidestrconsts.lisreplacewholeidentifier msgid "Replace whole identifier" msgstr "Tüm tanımlayıcıyı değiştir" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "Seçimi değiştirme başarısız oldu." #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" #: lazarusidestrconsts.lisrescan msgid "Rescan" msgstr "Yeniden tara" #: lazarusidestrconsts.lisreset msgctxt "lazarusidestrconsts.lisreset" msgid "Reset" msgstr "Sıfırla" #: lazarusidestrconsts.lisresetallfilefilterstodefaults msgid "Reset all file filters to defaults?" msgstr "Tüm dosya filtrelerini varsayılanlara sıfırla mu?" #: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?" msgstr "Seçili bileşenlerin sol, üst, en ve genişliği varsaylıan değerlerine sıfırlansın mı?" #: lazarusidestrconsts.lisresourcenamemustbeunique msgid "Resource name must be unique." msgstr "Kaynak adı benzersiz olmalıdır." #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" msgstr "Kaynak kaydetme hatası" #: lazarusidestrconsts.lisresourcetypeofnewfiles msgid "Resource type of project" msgstr "Projenin kaynak türü" #: lazarusidestrconsts.lisrestart msgid "Restart" msgstr "Tekrar başlat" #: lazarusidestrconsts.lisresult2 msgid "Result:" msgstr "Sonuç:" #: lazarusidestrconsts.lisreturnparameterindexedword msgid "" "Return parameter-indexed word from the current line preceding cursor position.\n" "\n" "Words in a line are numbered 1,2,3,... from left to right, but the last word\n" "which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" "is always the current macro.\n" "\n" "Example line:\n" "i 0 count-1 forb|\n" "Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" "\n" "In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+" msgstr "" "Parametre dizine alınmış sözcüğü imleç konumundan önceki geçerli satırdan döndür. \n" "\n" "Satırdaki sözcükler 1,2,3, ... soldan sağa, ancak son sözcük olanher zaman genişletilecek bir makro komutu olan 0 numaraya sahiptir, bu yüzden $ PrevWord (0) \n" "her zaman geçerli makrodur. \n" "\n" "Örnek satır: \n" "i 0 count-1 forb | \n" "Burada $ PrevWord (0) = forb, $ PrevWord (1) = i, $ PrevWord (2) = 0, $ PrevWord (3) = count-1 \n" "\n" "Şablonunuzun sonunda, boş bir dizeye genişleyen, ancak bulunan $ PrevWords'ün tümünü silmek için önemli bir işlem gerçekleştiren $ PrevWord (-1) kullanın. Ayrıca, buradaki kelimeleri tespit etmek için kullanılan bir regexp. makro: [\\ w \\ - + * \\ (\\) \\ [\\]. ^ @] +" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "" "Return the list of all values of case variable in front of variable.\n" "\n" "Optional Parameters (comma separated):\n" "WithoutExtraIndent // the case list will be generated without extra indentation" msgstr "" "Case değişkeninin tüm değerlerinin listesini değişkenin önünde döndür.\n" "\n" "İsteğe bağlı Parametreler (virgülle ayrılmış):\n" "WithoutExtraIndent // case listesi fazladan girinti olmadan oluşturulur" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" msgstr "Geri döndürme başarısız" #: lazarusidestrconsts.lisrevision msgid "Revision: " msgstr "Revizyon: " #: lazarusidestrconsts.lisright msgctxt "lazarusidestrconsts.lisright" msgid "Right" msgstr "Sağ" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" msgstr "Sağ çapa" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "Sağ kenarlık Bu değer taban sınırına eklenir ve kontrol hakkı için kullanılır." #: lazarusidestrconsts.lisrightgutter #, fuzzy #| msgid "Right Gutter" msgctxt "lazarusidestrconsts.lisrightgutter" msgid "Right" msgstr "Sağ Oluk" #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "Bu, sağ tarafın tutturulduğu kardeş kontroldür. Delphi stilinde ebeveyne sabitlemek için boş bırakın (BorderSpacing ve ReferenceSide önemli değildir)." #: lazarusidestrconsts.lisrightsides msgid "Right sides" msgstr "Sağ taraflar" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" msgstr "Sağ alan eşit" #: lazarusidestrconsts.lisrun msgctxt "lazarusidestrconsts.lisrun" msgid "Run" msgstr "Çalıştır" #: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations msgid "\"Run and Design time\" packages have no limitations." msgstr "\"Çalıştırma ve Tasarım zamanı\" paketlerinde herhangi bir sınırlama yoktur." #: lazarusidestrconsts.lisrunning #, object-pascal-format msgid "%s (running ...)" msgstr "%s (çalışıyor ...)" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" msgstr "Dosya yürütülebilir değil" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable #, object-pascal-format msgid "The host application \"%s\" is not executable." msgstr "Sunucu uygulaması \"%s\" çalıştırılabilir değil." #: lazarusidestrconsts.lisrunstage msgctxt "lazarusidestrconsts.lisrunstage" msgid "Run" msgstr "Çalıştır" #: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide msgid "Runtime only, cannot be installed in IDE" msgstr "Yalnızca çalışma zamanı, IDE'ye yüklenemez" #: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly." msgstr "\" Yalnızca çalışma zamanı\" paketleri yalnızca projeler içindir. IDE'ye yüklenemez." #: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them." msgstr "\" Çalıştırma zamanı\" paketleri projeler tarafından kullanılabilir. Bazı tasarım zaman paketleri gerektirmedikçe IDE'ye yüklenemezler." #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" msgstr "Çalıştırma başarısız oldu" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract Methods - not yet overridden" msgstr "Özet Yöntemler - henüz geçersiz kılınmadı" #: lazarusidestrconsts.lissamabstractmethodsof #, object-pascal-format msgid "Abstract methods of %s" msgstr "Özet metotların %s" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "İmleç sınıf bildirgesinde değil" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" msgstr "IDE meşgul" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods #, object-pascal-format msgid "%s is an abstract class, it has %s abstract methods." msgstr "%s soyut bir sınıf, %s soyut yöntemleri var." #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "Soyut yöntem bulunamadı" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" msgstr "Seçilenlerin tümünü geçersiz kıl" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" msgstr "İlk seçilenleri geçersiz kıl" #: lazarusidestrconsts.lissamselectnone msgid "Select none" msgstr "Hiçbir şey seçilmedi" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf #, object-pascal-format msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "%s geçersiz kılacak soyut metotlar var%s, Taslakların oluşturulması gereken yöntemleri seçin:" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "Geçersiz kılınacak soyut yöntem yoktur." #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "Bu yöntem geçerli sınıfta tanımlandığı için geçersiz kılınamaz" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "Geçerli sınıfın soyut yöntemlerini gösteremiyor, çünkü" #: lazarusidestrconsts.lissave msgid "Save" msgstr "Kaydet" #: lazarusidestrconsts.lissaveall msgctxt "lazarusidestrconsts.lissaveall" msgid "Save All" msgstr "Hepsini kaydet" #: lazarusidestrconsts.lissaveallchecked msgid "Save All Checked" msgstr "Hepsini Kaydet" #: lazarusidestrconsts.lissaveallmodified msgid "Save all modified files" msgstr "Değiştirilen tüm dosyaları kaydet" #: lazarusidestrconsts.lissavealloriginalmessagestofile msgid "Save All/Original Messages to File ..." msgstr "Tümünü Kaydet/Orijinal İletileri Dosyaya Kaydet ..." #: lazarusidestrconsts.lissaveandexitdialog msgid "Only Save" msgstr "Sadece Kaydet" #: lazarusidestrconsts.lissaveandrebuildide msgid "Rebuild IDE" msgstr "IDE'yi yeniden oluştur" #: lazarusidestrconsts.lissavechangedfiles msgid "Save changed files?" msgstr "Değiştirilen dosyaları kaydet?" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" msgstr "Değişiklikleri Kaydet?" #: lazarusidestrconsts.lissavechangestoproject #, object-pascal-format msgid "Save changes to project %s?" msgstr "Değişiklikler %s projesine kaydedilsin mi?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "Save current editor file" msgstr "Geçerli düzenleyici dosyasını kaydet" #: lazarusidestrconsts.lissavedwithidesettings msgid "Saved with IDE settings" msgstr "IDE ayarları ile kaydedildi" #: lazarusidestrconsts.lissavedwithprojectsession msgid "Saved with project session" msgstr "Proje oturumu ile kaydedildi" #: lazarusidestrconsts.lissavefilebeforeclosingform #, object-pascal-format msgid "Save file \"%s\"%sbefore closing form \"%s\"?" msgstr "\"%s\" formunu kapatmadan önce \"%s\"%s dosyasını kaydet?" #: lazarusidestrconsts.lissavemacroas msgid "Save macro as" msgstr "Makroyu farklı kaydet" #: lazarusidestrconsts.lissavemessages msgid "Save messages" msgstr "Mesajları kaydet" #: lazarusidestrconsts.lissaveproject #, object-pascal-format msgid "Save project %s (*%s)" msgstr "Projeyi %s kaydet (*%s)" #: lazarusidestrconsts.lissavesessionchangestoproject #, object-pascal-format msgid "Save session changes to project %s?" msgstr "Oturum değişiklikleri %s projesine kaydedilsin mi?" #: lazarusidestrconsts.lissavesessionfoldstate msgid "Save fold info" msgstr "Katlama bilgisini kaydet" #: lazarusidestrconsts.lissavesessionfoldstatehint msgid "Code editor supports folding (temporarily hiding) blocks of code." msgstr "Kod editörü, blok bloklamayı (geçici olarak gizleme) destekler." #: lazarusidestrconsts.lissavesessionjumphistory msgid "Save jump history" msgstr "Atlama geçmişini kaydet" #: lazarusidestrconsts.lissavesessionjumphistoryhint msgid "Ctrl-Click on an identifier in code editor is stored in jump history." msgstr "Kod düzenleyicisinde bir tanımlayıcıya Ctrl-tıklama atlama geçmişinde saklanır." #: lazarusidestrconsts.lissavesettings msgid "Save Settings" msgstr "Ayarları kaydet" #: lazarusidestrconsts.lissaveshownmessagestofile msgid "Save Shown Messages to File ..." msgstr "Gösterilen Mesajları Dosyaya Kaydet ..." #: lazarusidestrconsts.lissavespace msgid "Save " msgstr "Kaydet " #: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn #, object-pascal-format msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s." msgstr "\"%s\" dosyasının \"%s\" olarak kaydedilmesi, %s, %s satırındaki karakterleri kaybeder." #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" msgstr "Ölçekleme faktörü:" #: lazarusidestrconsts.lisscanfilesinparentdir msgid "Scan files in parent directory" msgstr "Üst dizindeki dosyaları tara" #: lazarusidestrconsts.lisscanfilesinparentdirhint msgid "Search for source files in sibling directories (parent directory and its children)" msgstr "Kardeş dizinlerde (üst dizin ve alt öğeleri) kaynak dosyaları ara" #: lazarusidestrconsts.lisscanning msgid "Scanning" msgstr "Taranıyor" #: lazarusidestrconsts.lisscanning2 #, object-pascal-format msgid "%s. Scanning ..." msgstr "%s. Taranıyor..." #: lazarusidestrconsts.lisscanparentdir msgid "Scanning parent directory" msgstr "Üst dizini tarıyor" #: lazarusidestrconsts.lissearchpaths2 msgid "Search paths" msgstr "Yolları ara" #: lazarusidestrconsts.lissearchunit #, object-pascal-format msgid "Search Unit \"%s\"" msgstr "Birim Ara \"%s\"" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor #, object-pascal-format msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"." msgstr "Lazarus'un yapılandırma şablon dosyalarını aradığı ikincil yapılandırma dizini. Varsayılan değer \"%s\" dir." #: lazarusidestrconsts.lissecondaryconfigpath msgid "Secondary config path" msgstr "İkincil yapılandırma yolu" #: lazarusidestrconsts.lissecondtest msgid "&Second test" msgstr "İkinci test" #: lazarusidestrconsts.lisseemessages msgid "See messages." msgstr "Bakın mesajlar." #: lazarusidestrconsts.lisseeprojectprojectinspector #, object-pascal-format msgid "%sSee Project -> Project Inspector" msgstr "%s Projeyi Göster-> Proje Denetçisi" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" msgstr "Bir yardım öğesi seçin:" #: lazarusidestrconsts.lisselectanode msgid "Select a node" msgstr "Bir düğüm seçin" #: lazarusidestrconsts.lisselectanotherlclwidgetset msgid "Select another LCL widgetset (macro LCLWidgetType)" msgstr "Başka bir LCL widget'ı seçin (makro LCLWidgetType)" #: lazarusidestrconsts.lisselectbuildmode msgid "Select build mode" msgstr "Yapı modunu seçin" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Delphi form dosyalarını seçin (* .dfm)" #: lazarusidestrconsts.lisselected msgid "Selected" msgstr "Seçilmiş" #: lazarusidestrconsts.lisselectedaddition msgid "Selected addition:" msgstr "Seçilen ek:" #: lazarusidestrconsts.lisselectedandchildcontrols msgid "Selected and child controls" msgstr "Seçilmiş ve alt kontroller" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" msgstr "(Alt komşu seçildi)" #: lazarusidestrconsts.lisselectedcommandsmapping msgid "Selected Command's Mapping" msgstr "Seçilmiş Komutun Haritalaması" #: lazarusidestrconsts.lisselectedforinstallation msgid "selected for installation" msgstr "kurulum için seçildi" #: lazarusidestrconsts.lisselectedforuninstallation msgid "selected for uninstallation" msgstr "kaldırma için seçildi" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" msgstr "(Seçili sol komşu)" #: lazarusidestrconsts.lisselectedmessageinmessageswindow msgid "Selected message in messages window:" msgstr "Mesaj penceresinde seçilen mesaj:" #: lazarusidestrconsts.lisselectedmodeswerecompiled #, object-pascal-format msgid "Selected %d modes were successfully compiled." msgstr "Seçilen %d modlar başarıyla derlendi." #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" msgstr "(Seçilmiş doğru komşu)" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" msgstr "(Seçkin üst komşu)" #: lazarusidestrconsts.lisselectfile msgid "Select the file" msgstr "Dosyayı seçin" #: lazarusidestrconsts.lisselectfpcpath msgid "Select the path where FPC is installed" msgstr "FPC'nin yüklendiği yolu seçin" #: lazarusidestrconsts.lisselectfpcsourcedirectory msgid "Select FPC source directory" msgstr "FPC kaynak klasörünü seçin" #: lazarusidestrconsts.lisselectframe msgid "Select Frame" msgstr "Çerçeve Seç" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "Seçim dize sabitini aşıyor" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" msgstr "Seçim aracı" #: lazarusidestrconsts.lisselectlazarussourcedirectory msgid "Select Lazarus source directory" msgstr "Lazarus kaynak klasörü seçin" #: lazarusidestrconsts.lisselectpathto #, object-pascal-format msgid "Select path to %s" msgstr "%s yolunu seç" #: lazarusidestrconsts.lisselecttargetdirectory msgid "Select target directory" msgstr "Hedef klasörü seçin" #: lazarusidestrconsts.lissetallcolors msgid "Set all colors:" msgstr "Tüm renkleri ayarla:" #: lazarusidestrconsts.lissetdefault msgid "Set default" msgstr "Varsayılana ayarla" #: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." msgstr "Derleyici mesajlarını başka bir dile çevirmek için bunu ayarlayın (yani İngilizce değil). Örneğin: Almanca: $ (FPCSrcDir) /compiler/msg/errordu.msg." #: lazarusidestrconsts.lissetupdefaultindentation msgid "(Set up default indentation)" msgstr "(Varsayılan girintiyi ayarla)" #: lazarusidestrconsts.lisshort msgid "Short:" msgstr "Kısa:" #: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty." msgstr "TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param)'ın kısa biçimi. Boşsa alt hedef atlanır." #: lazarusidestrconsts.lisshortnopath msgid "Short, no path" msgstr "Kısa, yol yok" #: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications #, object-pascal-format msgid "Should the component \"%s\" be auto created when the application starts?" msgstr "Uygulama başlatıldığında \"%s\" bileşeni otomatik olarak oluşturulmalı mı?" #: lazarusidestrconsts.lisshow msgid "Show" msgstr "Göster" #: lazarusidestrconsts.lisshowabstractmethodsof #, object-pascal-format msgid "Show abstract methods of \"%s\"" msgstr "Soyut yöntemleri göster \"%s\"" #: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector msgid "Show component tree" msgstr "Bileşen ağacını göster" #: lazarusidestrconsts.lisshowconsole msgid "Show console" msgstr "Konsolu göster" #: lazarusidestrconsts.lisshowdeclarationhints msgid "Show declaration hints" msgstr "Bildiri ipuçlarını göster" #: lazarusidestrconsts.lisshowdifferencesbetweenmodes msgid "Show differences between modes ..." msgstr "Modlar arasındaki farkları göster ..." #: lazarusidestrconsts.lisshowemptyunitspackages msgid "Show empty units/packages" msgstr "Boş birimleri/paketleri göster" #: lazarusidestrconsts.lisshowfpcmessagelinescompiled msgid "Show FPC message \"lines compiled\"" msgstr "FPC mesajı \"satırlar derlendi\" yi göster" #: lazarusidestrconsts.lisshowglyphsfor msgid "Show Glyphs for" msgstr "Glifleri Göster" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" msgstr "Oluğu göster" #: lazarusidestrconsts.lisshowhelp msgid "Show help" msgstr "Yardımı göster" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector" msgid "Show hints" msgstr "İpuçlarını göster" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" msgstr "Tanımlayıcıları göster" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" msgstr "Bilgi kutusunu göster" #: lazarusidestrconsts.lisshowmessagetypeid msgid "Show Message Type ID" msgstr "Mesaj Tip Kimliğini Göster" #: lazarusidestrconsts.lisshowmultiplelines msgid "Show multiple lines" msgstr "Çoklu satırları Göster" #: lazarusidestrconsts.lisshowonlymodified msgid "Show only modified" msgstr "Sadece değişiklikleri göster" #: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window." msgstr "Yalnızca görev çubuğunda pencere başına bir yerine tüm IDE için bir düğme gösterin. Cinnamon gibi bazı Linux Pencere Yöneticileri bunu desteklemez ve her zaman pencere başına bir düğme gösterir." #: lazarusidestrconsts.lisshowoutput msgid "Show output" msgstr "Çıktıyı göster" #: lazarusidestrconsts.lisshowoverviewgutter msgid "Show overview gutter" msgstr "Genel bakış oluklarını göster" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" msgstr "Paketleri göster" #: lazarusidestrconsts.lisshowpositionofsourceeditor msgid "Show position of source editor" msgstr "Kaynak düzenleyicinin konumunu göster" #: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector msgid "Show property filter" msgstr "Özellik filtresini göster" #: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop msgid "Show recently used identifiers at top" msgstr "En son kullanılan tanımlayıcıları en üstte göster" #: lazarusidestrconsts.lisshowrelativepaths msgid "Show relative paths" msgstr "Göreli yolları göster" #: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy msgid "Shows all controls in tree hierarchy." msgstr "Tüm kontrolleri ağaç hiyerarşisinde gösterir." #: lazarusidestrconsts.lisshowsdescriptionforselectedproperty msgid "A box at the bottom shows description for the selected property." msgstr "Alttaki kutu, seçili mülk için açıklama gösterir." #: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings msgid "Show setup dialog for most important settings." msgstr "En önemli ayarlar için kurulum diyalogunu göster." #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" msgstr "Özel karakterleri göster" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show statusbar" msgstr "Durum çubuğunu göster" #: lazarusidestrconsts.lisshowunits msgid "Show units" msgstr "Birimleri göster" #: lazarusidestrconsts.lisshowunitswithinitialization msgid "Show units with initialization/finalization sections" msgstr "İnitialization/finalization bölümlerine sahip birimleri göster" #: lazarusidestrconsts.lisshowunitswithinitializationhint msgid "These units may initialize global data used by the program/application. Remove with care." msgstr "Bu birimler program/uygulama tarafından kullanılan global verileri başlatabilir. Dikkatli bir şekilde kaldırın." #: lazarusidestrconsts.lisshowunusedunits msgid "Show unused units ..." msgstr "Kullanılmayan birimleri göster ..." #: lazarusidestrconsts.lisshowvaluehintswhiledebugging msgid "Show value hints while debugging" msgstr "Hata ayıklama sırasında değer ipuçlarını göster" #: lazarusidestrconsts.lisshowversionandexit msgid "Show version and exit." msgstr "Sürümü göster ve çık." #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" msgstr "En küçüğe küçült" #: lazarusidestrconsts.lissibling msgid "Sibling" msgstr "Kardeş" #: lazarusidestrconsts.lissimpleprogram msgid "Simple Program" msgstr "Basit Program" #: lazarusidestrconsts.lissimpleprogramprogramdescriptor msgid "A most simple Free Pascal command line program." msgstr "En basit Free Pascal komut satırı programı." #: lazarusidestrconsts.lissimplesyntax msgid "Simple syntax" msgstr "Basit sözdizimi" #: lazarusidestrconsts.lisskiperrors msgid "Skip errors" msgstr "Hataları atla" #: lazarusidestrconsts.lisskipfile msgid "Skip file" msgstr "Dosyayı atla" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "Dosyayı atla ve yüklemeye devam et" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project." msgstr "Son projeyi yüklemeyi atla." #: lazarusidestrconsts.lisskipstartupchecks msgid "Skip selected checks at startup. Valid options are:" msgstr "Başlangıçta seçili kontrolleri atla. Geçerli seçenekler şunlardır:" #: lazarusidestrconsts.lisslowerbutmoreaccurate msgid "Slower but more accurate." msgstr "Daha yavaş ama daha doğru." #: lazarusidestrconsts.lissmallerratherthanfaster msgid "Smaller rather than faster" msgstr "Daha hızlı, daha küçük" #: lazarusidestrconsts.lissmatches msgid "Matches" msgstr "Karşılaşmalar" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "Üzgünüz, bu tür henüz uygulanmadı" #: lazarusidestrconsts.lissorthistorylimit msgid "History items limit" msgstr "Geçmiş öğeleri sınırı" #: lazarusidestrconsts.lissorting msgid "Sorting" msgstr "Sıralama" #: lazarusidestrconsts.lissortorderalphabetic msgid "Alphabetic" msgstr "Alfabetik" #: lazarusidestrconsts.lissortorderdefinition msgid "Definition (Scoped)" msgstr "Tanım (Kapsamlı)" #: lazarusidestrconsts.lissortorderscopedalphabetic msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic" msgid "Alphabetic (Scoped)" msgstr "Alfabetik (Kapsamlı)" #: lazarusidestrconsts.lissortordertitle msgid "Order by" msgstr "Sırala" #: lazarusidestrconsts.lissortselascending msgid "Ascending" msgstr "Artan" #: lazarusidestrconsts.lissortselcasesensitive msgid "&Case Sensitive" msgstr "&Harfe duyarlı" #: lazarusidestrconsts.lissortseldescending msgid "Descending" msgstr "Azalan" #: lazarusidestrconsts.lissortseldomain msgid "Domain" msgstr "Alan" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" msgstr "Alanı Yoksay" #: lazarusidestrconsts.lissortsellines msgid "Lines" msgstr "Satırlar" #: lazarusidestrconsts.lissortseloptions msgctxt "lazarusidestrconsts.lissortseloptions" msgid "Options" msgstr "Seçenekler" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" msgstr "Paragraf" #: lazarusidestrconsts.lissortselpreview msgctxt "lazarusidestrconsts.lissortselpreview" msgid "Preview" msgstr "Önizleme" #: lazarusidestrconsts.lissortselsort msgid "Accept" msgstr "Onayla" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" msgstr "Sıralama seçimi" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" msgid "Words" msgstr "Kelimeler" #: lazarusidestrconsts.lissourceanddestinationaresame #, object-pascal-format msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory." msgstr "Kaynak \"%s\"%s ve Hedef \"%s\"%s dizinleri aynıdır. Lütfen başka bir dizin seçin." #: lazarusidestrconsts.lissourcedirectorydoesnotexist #, object-pascal-format msgid "Source directory \"%s\" does not exist." msgstr "Kaynak dizini \"%s\" mevcut değil." #: lazarusidestrconsts.lissourceeditorwindowmanager msgid "Source Editor Window Manager" msgstr "Kaynak Düzenleyici Pencere Yöneticisi" #: lazarusidestrconsts.lissourcemodified msgid "Source modified" msgstr "Kaynak değiştirildi" #: lazarusidestrconsts.lissourceofpagehaschangedsave #, object-pascal-format msgid "Source of page \"%s\" has changed. Save?" msgstr "Sayfa kaynağı \"%s\" değişti Kaydedilsin mi?" #: lazarusidestrconsts.lissourceofpagehaschangedsaveex #, object-pascal-format msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" msgstr "Sayfaların kaynakları değişti. Sayfayı kaydet \"%s\"? (%d daha fazla)" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" msgstr "Kaynak yolları" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" msgstr "Eşit alan" #: lazarusidestrconsts.lissrcos msgid "Src OS" msgstr "Src OS" #: lazarusidestrconsts.lisssearching msgid "Searching" msgstr "Arama" #: lazarusidestrconsts.lisssearchtext msgid "Search text" msgstr "Metin ara" #: lazarusidestrconsts.lisstartconversion msgid "Start Conversion" msgstr "Dönüşümü Başlat" #: lazarusidestrconsts.lisstartide msgid "Start IDE" msgstr "IDE'yi Başlat" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" msgstr "Yeni bir proje ile başla" #: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass msgid "Statusbar shows the property's name and the class where it is published." msgstr "Durum çubuğu özelliğin adını ve yayınlandığı sınıfı gösterir." #: lazarusidestrconsts.lisstop msgid "Stop" msgstr "Durdur" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Mevcut hata ayıklaması durdurulsun ve proje yeniden oluşturulsun mu?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" msgstr "Hata ayıklama durdurulsun mu?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" msgstr "Hata ayıklama dursun mu?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" msgstr "İstisna durumunda durdur" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" msgstr "Hata ayıklama durdurulsun mu?" #: lazarusidestrconsts.lisstorepathdelimitersandas msgid "Store path delimiters \\ and / as" msgstr "Yol sınırlayıcılarını \\ ve / olarak saklayın" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" msgstr "Akış hatası" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" msgstr "Alt Prosedür" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "Aynı seviyedeki Alt Prosedür" #: lazarusidestrconsts.lissubtarget msgid "Subtarget" msgstr "Althedef" #: lazarusidestrconsts.lissuccess msgid "Success" msgstr "Başarılı" #: lazarusidestrconsts.lissuccessfullyexported #, object-pascal-format msgid "Successfully exported to \"%s\"." msgstr "%s\" e başarıyla dışa aktarıldı." #: lazarusidestrconsts.lissuccessfullyexportedbuildmodes #, object-pascal-format msgid "Successfully exported %d BuildModes to \"%s\"." msgstr "%d YapıModu \"%s\" ya başarıyla dışa aktarıldı." #: lazarusidestrconsts.lissuccessfullyexportedcompileroptions #, object-pascal-format msgid "Successfully exported compiler options to \"%s\"." msgstr "Derleyici seçenekleri \"%s\" olarak başarıyla dışa aktarıldı." #: lazarusidestrconsts.lissuccessfullyimported #, object-pascal-format msgid "Successfully imported from \"%s\"." msgstr "\"%s\" den başarıyla içe aktarıldı." #: lazarusidestrconsts.lissuccessfullyimportedbuildmodes #, object-pascal-format msgid "Successfully imported %d BuildModes from \"%s\"." msgstr "%d BuildModes başarıyla \"%s\" dizininden içe aktarıldı." #: lazarusidestrconsts.lissuccessfullyimportedcompileroptions #, object-pascal-format msgid "Successfully imported compiler options from \"%s\"." msgstr "\"%s\" dizininden derleyici seçenekleri başarıyla alındı." #: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase msgid "Suggest default name of new file in lowercase" msgstr "Yeni dosyanın varsayılan adını küçük harflerle öner" #: lazarusidestrconsts.lissuspiciousincludepath msgid "Suspicious include path" msgstr "Şüpheli yol içeriyor" #: lazarusidestrconsts.lissuspiciousunitpath msgid "Suspicious unit path" msgstr "Şüpheli birim yolu" #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "Geçersiz değişken adı" #: lazarusidestrconsts.lissvuoisnotavalididentifier #, object-pascal-format msgid "\"%s\" is not a valid identifier." msgstr "\"%s\" geçerli bir tanımlayıcı değil." #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" msgstr "Sistem değişkenini geçersiz kıl" #: lazarusidestrconsts.lisswitchfiltersettings msgid "Switch Filter Settings" msgstr "Filtre Ayarlarını Değiştir" #: lazarusidestrconsts.lisswitchtofavoritestabafterasking msgid "Switch to Favorites tab after asking for component name." msgstr "Bileşen adını sorduktan sonra Favoriler sekmesine geçin." #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" msgstr "Sözdizimi modu" #: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg msgid "system.ppu not found. Check your fpc.cfg." msgstr "system.ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin." #: lazarusidestrconsts.listab msgid "Tab" msgstr "Sekme" #: lazarusidestrconsts.listaborderconfirmsort #, object-pascal-format msgid "Sort tab orders of all child controls of \"%s\" by their positions?" msgstr "\"%s\" öğesinin tüm alt denetimlerinin sekme sıralarını konumlarına göre sıralayın?" #: lazarusidestrconsts.listaborderdownhint msgid "Move the selected control down in tab order" msgstr "Seçilen denetimi sekme sırasına getir" #: lazarusidestrconsts.listaborderof #, object-pascal-format msgid "Tab Order of %s" msgstr "%s Sekmesi Sırası" #: lazarusidestrconsts.listaborderrecursionhint msgid "Calculate tab order recursively for child controls" msgstr "Alt kontroller için tekrarlı olarak sekme sırasını hesaplayın" #: lazarusidestrconsts.listaborderrecursively msgid "recursively" msgstr "yinelemeli" #: lazarusidestrconsts.listabordersorthint msgid "Calculate tab order for controls by their X- and Y- positions" msgstr "Kontroller için X ve Y pozisyonlarına göre sekme sırasını hesapla" #: lazarusidestrconsts.listaborderuphint msgid "Move the selected control up in tab order" msgstr "Seçili denetimi sekme sırasına taşıyın" #: lazarusidestrconsts.listabsfor #, object-pascal-format msgid "Tabs for %s" msgstr "%s için sekmeler" #: lazarusidestrconsts.listarget msgid "Target:" msgstr "Hedef:" #: lazarusidestrconsts.listarget2 #, object-pascal-format msgid ", Target: %s" msgstr ", Hedef: %s" #: lazarusidestrconsts.listargetcpu msgid "Target CPU" msgstr "Hedef CPU" #: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory msgid "Target file name: (-o, empty = use unit output directory)" msgstr "Hedef dosya adı: (-o, boş = birim çıktı dizinini kullan)" #: lazarusidestrconsts.listargetfilenameo msgid "Target file name (-o):" msgstr "Hedef dosya adı (-o):" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" msgstr "Projenin hedef dosya adı" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" msgstr "Hedef dosya adı + parametreler" #: lazarusidestrconsts.listargetisreadonly msgid "Target is read only" msgstr "Hedef yalnızca okunabilir" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" msgid "Target OS" msgstr "Hedef işletim Sistemi" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" msgstr "Düzenlenebilir Hücre" #: lazarusidestrconsts.listemplateeditparamcellhelp #, object-pascal-format msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")." msgstr "Düzenlenebilir bir Hücre yerleştirin. Hücreler sekme tuşunu kullanarak gezilebilir.%0:s \"param \" makrosu virgülle ayrılmış değişkenlerin bir listesini alır.%0:sİlk değişken varsayılan değerdir.%0:sİkinci değişken (isteğe bağlı) kullanılabilir hücreyi başka bir hücreye bağlamak için (syncro edit).%0:s%0:s iken param ( \"foo \") param (foo) yapar;%0:sIki bağımsız metinle her ikisi de \" foo \".%0:s Tırnaklar isteğe bağlıdır.%0:s%0:s param (\" foo \")> 0 ve param (\" foo \", sync = 1) <99 sonra%0:sEkle 2, her ikisini de düzenleyen bağlantılı hücreleri diğerini de değiştirecektir.%0:s \"1 \" değeri, diğer \"param () \" nin konumunu belirtir, eğer daha fazla param varsa:%0:s, param ( \"bar \") ve param (foo)> 0 ve param (foo, sync = 2) <99 sonra%0:sİkinci ve üçüncü bağlanırsa (3. \"2 \" anlamına gelir). %0:s%0:s \"Eşitleme \", \"s \" olarak kısaltılabilir:%0:s eğer param ( \"foo \")> 0 ve param ( \"foo \", s = 1) <99 sonra%0:s%0:s param ( \"bar \") ve param ( \"foo \")> 0 ise ve param ( \"foo \", sync) <99 sonra%0:sİkinci ve üçüncü bağlantılar.%0:s Not: \"Senkronizasyon \" s konum yok ve \"= \" yok, bu nedenle aynı varsayılanla önceki hücreye eşitlenir (bu durumda \"foo \")." #: lazarusidestrconsts.listemplatefile msgid "Template file" msgstr "Şablon dosyası" #: lazarusidestrconsts.listestdirectory msgid "Test directory" msgstr "Dizini test et" #: lazarusidestrconsts.listesturl msgid "Test URL" msgstr "Test URL'si" #: lazarusidestrconsts.listheapplicationbundlewascreatedfor #, object-pascal-format msgid "The Application Bundle was created for \"%s\"" msgstr "Uygulama Paketi \"%s\" için oluşturuldu" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro #, object-pascal-format msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." msgstr "\"%s\" sınıfı bir TControl'dür ve kontrol olmayan bir yere yapıştırılamaz.%sYapıştırılamıyor." #: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect #, object-pascal-format msgid "The compiler file \"%s\" does not look correct:%s%s" msgstr "Derleyici dosyası \"%s\" doğru görünmüyor:%s%s" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby #, object-pascal-format msgid "The component %s can not be deleted because it is not owned by %s." msgstr "%s bileşeni %s tarafından sahiplenilmediği için silinemez." #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror #, object-pascal-format msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" msgstr "\"%s\" sınıfının bileşen düzenleyicisi şu hatayı oluşturdu:%s\"%s\"" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated #, object-pascal-format msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" msgstr "\"%s\"%sınıfının #%s \"%s\"%s fiili ile çağrılan bileşen düzenleyicisi şu hatayı oluşturdu:%s\"%s\"" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp #, object-pascal-format msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "%s bileşeni %s'den miras alınmıştır.%sDevralınan bir bileşeni silmek için atayı açın ve orada silin." #: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp #, object-pascal-format msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." msgstr "%s bileşeni %s'den miras alınmıştır.%sDevralınan bir bileşeni yeniden adlandırmak için ata bileşeni açın ve orada yeniden adlandırın." #: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier." msgstr "Bileşen adı, form/datamodül üzerindeki tüm bileşenlerde benzersiz olmalıdır. ad, normal bir Pascal tanımlayıcısı gibi büyük/küçük harfe duyarsız olarak karşılaştırılır." #: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted msgid "The configuration will be downgraded/converted." msgstr "Yapılandırma düşürülecek/dönüştürülecektir." #: lazarusidestrconsts.listhecontainsanotexistingdirectory #, object-pascal-format msgid "The %s contains a nonexistent directory:%s%s" msgstr "%s, varolmayan bir dizin içeriyor: %s %s" #: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch #, object-pascal-format msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." msgstr "%s bir yıldız * karakteri içeriyor.%sLazarus bunu normal karakter olarak kullanır ve bunu dosya maskesi olarak genişletmez." #: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." msgstr "Mevcut FPC'nin yapılandırma dosyası yoktur. Muhtemelen bazı birimleri kaçıracaktır. FPC kurulumunuzu kontrol edin." #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro #, object-pascal-format msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" msgstr "Hata ayıklayıcı \"%s\"%s mevcut değil veya çalıştırılabilir değil.%sAraçlar -> Seçenekler -> Hata ayıklayıcı seçenekleri'ne bakın" #: lazarusidestrconsts.listhedefaultmodemustbestoredinproject msgid "The default mode must be stored in project, not in session." msgstr "Varsayılan mod, oturumda değil, projede saklanmalıdır." #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist #, object-pascal-format msgid "The destination directory%s\"%s\" does not exist." msgstr "Hedef dizin%s\"%s\" mevcut değil." #: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere #, object-pascal-format msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" msgstr "\"%s\" dizini artık hiçbir proje dahil dosyası içermiyor. Bu dizini projenin include arama yolundan kaldırılsın mı?" #: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi #, object-pascal-format msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" msgstr "\"%s\" dizini artık hiçbir proje birimi içermiyor. Bu dizini projenin birim arama yolundan kaldırılsın mı?" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit #, object-pascal-format msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" msgstr "\"%s\" dizini artık birim yolunda gerekli değil.%sKaldırılsın mı?" #: lazarusidestrconsts.listhefile #, object-pascal-format msgid "The file \"%s\"" msgstr "Dosyalar \"%s\"" #: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." msgstr "Dosya indeksi find declaration gibi fonksiyonlar için gereklidir. Tarama sırasında kaynakları düzenleyebilir ve derleyebilirsiniz, ancak find declaration gibi işlevler birim bulunamadı hatalarını gösterecektir. Bu bir dakika sürebilir." #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi #, object-pascal-format msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" msgstr "\"%s\" dosyası bir Lazarus projesi değil.%sBu \"%s\" için yeni bir proje oluşturun?" #: lazarusidestrconsts.listhefilemaskisinvalid #, object-pascal-format msgid "The file mask \"%s\" is invalid." msgstr "\"%s\" dosya maskesi geçersiz." #: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression #, object-pascal-format msgid "The file mask \"%s\" is not a valid regular expression." msgstr "\"%s\" dosya maskesi geçerli bir düzenli ifade değildir." #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject #, object-pascal-format msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "\"%s\" dosyası bir program gibi görünüyor.%sMevcut projeyi kapatın ve bu program için yeni bir Lazarus projesi oluşturun.%s \"Hayır\" dosyayı normal kaynak olarak yükleyecektir." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp #, object-pascal-format msgid "The file %s seems to be the program file of an existing Lazarus Project." msgstr "%s dosyası mevcut bir Lazarus Projesinin program dosyası gibi görünüyor." #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself #, object-pascal-format msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" msgstr "\"%s\" dosyası bulunamadı. %s Bunu kendiniz bulmak istiyor musunuz?" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject #, object-pascal-format msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "\"%s\" dosyası bulunamadı.%s Yoksay projeyi yüklemeye devam edecek,%s İptal yüklemeyi durduracaktır." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth #, object-pascal-format msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" msgstr "%s tarafından kullanılan aşağıdaki yöntemler kaynakta değil %s%s%s%s%sÇıkan referansları kaldır?" #: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect #, object-pascal-format msgid "The FPC source directory \"%s\" does not look correct:%s%s" msgstr "FPC kaynak dizini \"%s\"doğru görünmüyor: %s%s" #: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect #, object-pascal-format msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s" msgstr "Fppkg yapılandırma dosyası \"%s\" doğru görünmüyor:%s%s" #: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename #, object-pascal-format msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." msgstr "Free Pascal derleyicisi yürütülebilir dosyası tipik olarak \"%s\" adına sahiptir. \"%s\" gibi hedefe özel derleyiciyi de kullanabilirsiniz. Lütfen tam dosya yolunu verin." #: lazarusidestrconsts.listheideisstillbuilding msgid "The IDE is still building." msgstr "IDE hâlâ inşa ediliyor." #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "Tanımlayıcı bir birimdir. Bir birimi yeniden adlandırmak için lütfen Dosya - Farklı kaydet işlevini kullanın." #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand #, object-pascal-format msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?" msgstr "%s tuşu zaten %s%s'e atanmış.%s%sEski atamayı kaldırın ve tuşu yeni %s işlevine atayın?" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists #, object-pascal-format msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." msgstr "Yürütme için gereken Uygulama Paketi %s%s mevcut değil veya yürütülebilir değil.%sBir tane oluşturmak istiyor musunuz?%s Ayarlar için Proje -> Proje Seçenekleri -> Uygulama bölümüne bakın." #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta #, object-pascal-format msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" msgstr "Başlatan uygulama \"%s\"%s mevcut değil veya çalıştırılabilir değil.%sBkz Çalıştır -> Çalıştır parametreleri -> Yerel" #: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth #, object-pascal-format msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." msgstr "Lazarus dizini IDE'nin kaynaklarını ve LCL ve birçok standart paketin paket dosyalarını içerir. Örneğin \"ide%slazarus.lpi\" dosyasını içerir. Çeviri dosyaları da burada bulunur." #: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect #, object-pascal-format msgid "The Lazarus directory \"%s\" does not look correct:%s%s" msgstr "\"%s\" Lazarus dizini doğru görünmüyor: %s%s" #: lazarusidestrconsts.listhelazarussourcesuse #, object-pascal-format msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild." msgstr "Lazarus kaynakları farklı bir temel paket listesi kullanır.%sIDE'nin lazbuild kullanılarak temiz derlenmesi önerilir." #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually." msgstr "LFM (Lazarus formu) dosyası geçersiz özellikler içeriyor. Bu, örneğin mevcut LCL'de bulunmayan bazı özellikler/sınıflar içerdiği anlamına gelir. Normal düzeltme, bu özellikleri lfm'den kaldırmak ve Pascal kodunu manuel olarak düzeltmektir." #: lazarusidestrconsts.listhemacrodoesnotbeginwith #, object-pascal-format msgid "The macro \"%s\" does not begin with \"%s\"." msgstr "\"%s\" makrosu \"%s\" ile başlamıyor." #: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename #, object-pascal-format msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." msgstr "\"make\" çalıştırılabilir dosyası tipik olarak \"%s\" adına sahiptir. IDE'yi oluşturmak için gereklidir. Lütfen tam dosya yolunu verin." #: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd #, object-pascal-format msgid "The new include file is not yet in the include search path.%sAdd directory %s?" msgstr "Yeni include dosyası henüz include arama yolunda değil %s Dizine eklensin mi %s?" #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory #, object-pascal-format msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "Yeni birim henüz birim arama yolunda değil %sDizine eklensin mi %s?" #: lazarusidestrconsts.listheoldconfigurationwillbeupgraded msgid "The old configuration will be upgraded." msgstr "Eski yapılandırma yükseltilecektir." #: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint #, object-pascal-format msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" msgstr "\"Diğer kaynaklar\", zaten \"Diğer birim dosyaları\" nda bulunan bir dizini içerir. %s%s" #: lazarusidestrconsts.listheoutputdirectoryismissing #, object-pascal-format msgid "The output directory \"%s\" is missing." msgstr "\"%s\" çıktı dizini eksik." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath #, object-pascal-format msgid "The output directory of %s is listed in the include search path of %s." msgstr "%s'nin çıktı dizini %s'nin dahil etme arama yolunda listelenir." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes #, object-pascal-format msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "%s'nin çıktı dizini %s'nin devralınan içerme arama yolunda listelenir." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear #, object-pascal-format msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "%s çıktı dizini, %s ürününün devralınan birim arama yolunda listeleniyor." #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof #, object-pascal-format msgid "The output directory of %s is listed in the unit search path of %s." msgstr "%s'nin çıktı dizini %s'nin birim arama yolunda listelenir." #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr " Çıkış dizini ayrı bir dizinde olmalı ve herhangi bir kaynak dosyası içermemelidir." #: lazarusidestrconsts.listheownerclasshasthisname msgid "The owner class has this name" msgstr "Sahip sınıfı şu ada sahiptir" #: lazarusidestrconsts.listheownerhasthisname msgid "The owner has this name" msgstr "Sahibinin adı var" #: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi #, object-pascal-format msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "%s paketi IDE'nin include yoluna \"%s\" yolunu ekler.%sBu muhtemelen paketin yanlış yapılandırılmasıdır." #: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr #, object-pascal-format msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "%s paketi IDE'nin birim yoluna \"%s\" yolunu ekler.%sBu muhtemelen paketin yanlış yapılandırılmasıdır." #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "Paket zaten bu isimde bir birim içeriyor." #: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi #, object-pascal-format msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package." msgstr "Sadece çalışma zamanı paketi olan \"%s\" paketini gerektirdiği için %s paketi yüklenemiyor." #: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth #, object-pascal-format msgid "The package %s can not be uninstalled because it is needed by the IDE itself." msgstr "IDE'nin kendisi tarafından ihtiyaç duyulduğu için %s paketi kaldırılamıyor." #: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi #, object-pascal-format msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." msgstr "%s paketi, herhangi bir IDE eklentisi sağlamadığı anlamına gelen herhangi bir \"Register \" prosedürüne sahip değildir. Kurulumu büyük olasılıkla yalnızca IDE'nin boyutunu artıracak ve hatta dengesiz hale getirebilir.%sİpucu: Projenizde bir paket kullanmak istiyorsanız, \"Projeye ekle \" menü öğesini kullanın." #: lazarusidestrconsts.listhepackageisalreadyinthelist #, object-pascal-format msgid "The package %s is already in the list" msgstr "%s paketi zaten listede yer alıyor" #: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall #, object-pascal-format msgid "The package %s is not a design time package. It cannot be installed in the IDE." msgstr "%s paketi bir tasarım zamanı paketi değildir. IDE'ye yüklenemez." #: lazarusidestrconsts.listhepackageisusedby #, object-pascal-format msgid "The package \"%s\" is used by" msgstr "\"%s\" paketi tarafından kullanılıyor" #: lazarusidestrconsts.listhepathofmakeisnotcorrect #, object-pascal-format msgid "The path of \"make\" is not correct: \"%s\"" msgstr "\"make\" yolu doğru değil: \"%s\"" #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla #, object-pascal-format msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." msgstr "\"make\" programı bulunamadı.%sBu araç Lazarus'u oluşturmak için gereklidir." #: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" msgstr "Proje derleyici seçenekleri ve ana kaynaktaki direktifler farklıdır. Yeni birim için proje seçeneklerinin modu ve string tipi kullanılır:" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption msgid "Running your application with debugger" msgstr "Uygulamanızı hata ayıklayıcı ile çalıştırma" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging." msgstr "Bu seçim daha sonra Proje -> Proje Seçenekleri -> Derleyici Seçenekleri -> Hata Ayıklama bölümünden değiştirilebilir." #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption msgid "Run with no debugger" msgstr "Hata ayıklayıcı olmadan çalıştır" #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain #, object-pascal-format msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled." msgstr "\"%s\" uygulamanızı yalnızca uygun bir Hata Ayıklama Bilgisi etkinleştirilerek derlendiğinde çalıştırabilir." #: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title msgid "Choose Debug Information format" msgstr "Hata Ayıklama Bilgisi biçimini seçin" #: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems #, object-pascal-format msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces." msgstr "Proje, LCLBase tarafından gerekli olan LCL birim arayüzlerini kullanmıyor.%sArayüzler olmadan LCL kullanırsanız garip bağlayıcı hataları alırsınız." #: lazarusidestrconsts.listheprojecthasnocompilecommandseepr #, object-pascal-format msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands" msgstr "Projede derleme komutu yok.%sBkz: Proje -> Proje Seçenekleri -> Derleyici Seçenekleri -> Derleyici Komutları" #: lazarusidestrconsts.listheprojecthasnomainsourcefile msgid "The project has no main source file." msgstr "Projenin ana kaynak dosyası yok." #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource #, object-pascal-format msgid "The project info file \"%s\"%sis equal to the project main source file!" msgstr "Proje bilgi dosyası \"%s\"%s proje ana kaynak dosyasına eşit!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk #, object-pascal-format msgid "The project information file \"%s\"%shas changed on disk." msgstr "Proje bilgi dosyası \"%s\"%s Disk üzerinde değişti." #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest #, object-pascal-format msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" msgstr "Proje oluşturulmadan önce kaydedilmelidir%sIDE seçeneklerinde Test Dizinini ayarlarsanız,%s yeni projeler oluşturabilir ve bunları bir kerede oluşturabilirsiniz.%sProje kaydedilsin mi?" #: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast msgid "The project uses FPC resources which require at least FPC 2.4" msgstr "Proje, en az FPC 2.4 gerektiren FPC kaynaklarını kullanmaktadır" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar #, object-pascal-format msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgstr "Proje hedef OS=%s ve CPU=%s kullanıyor.%sBu hedef için system.ppu FPC ikili dizinlerinde bulunamadı.%sBu hedef için fpc'nin doğru yüklendiğinden ve fpc.cfg'nin doğru dizinleri içerdiğinden emin olun." #: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe #, object-pascal-format msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable." msgstr "Proje, hata ayıklama sembollerini harici bir dosyaya yazar. \"%s\" yalnızca yürütülebilir dosya içindeki sembolleri destekler." #: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable #, object-pascal-format msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file." msgstr "Proje, hata ayıklama sembollerini harici bir dosya yerine çalıştırılabilir dosyaya yazar. \"%s\" yalnızca harici bir dosyadaki sembolleri destekler." #: lazarusidestrconsts.listhereareadditionalnotesforthismessageon #, object-pascal-format msgid "%sThere are additional notes for this message on%s" msgstr "%s Bu ileti için %s üzerinde ek notlar var" #: lazarusidestrconsts.listherearenoconflictingkeys msgid "There are no conflicting keys." msgstr "Çakışan anahtar yok." #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename #, object-pascal-format msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "Dizinde aynı ada sahip başka dosyalar var, %s yalnızca farklı durumda: %s %s %s Öğe silinsin mi?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension #, object-pascal-format msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" msgstr "%s diskinde aynı adı ve benzer bir uzantısı olan bir dosya var. Dosya:%s%s Belirsiz Dosya:%s%s Belirsiz dosyayı sil?" #: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname msgid "There is already a build mode with this name." msgstr "Bu isimde bir derleme modu zaten var." #: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename #, object-pascal-format msgid "There is already a component class with the name %s." msgstr "Zaten %s adında bir bileşen sınıfı var." #: lazarusidestrconsts.listhereisalreadyacomponentwiththisname msgid "There is already a component with this name" msgstr "Bu isimde bir bileşen zaten var" #: lazarusidestrconsts.listhereisalreadyafilein #, object-pascal-format msgid "There is already a file%s%s%sin %s" msgstr "Zaten %s %s %s %s adlı bir dosya var" #: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue #, object-pascal-format msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" msgstr "%s%s \"%s\" adlı bir dosya zaten var Eski:%s%s Yeni:%s%s%s Devam edilsin mi?" #: lazarusidestrconsts.listhereisalreadyaformwiththename #, object-pascal-format msgid "There is already a form with the name \"%s\"" msgstr "Zaten \"%s\" adında bir form var" #: lazarusidestrconsts.listhereisalreadyamacrowiththename #, object-pascal-format msgid "There is already a macro with the name \"%s\"." msgstr "Zaten \"%s\" adında bir makro var." #: lazarusidestrconsts.listhereisalreadyanidemacrowiththename #, object-pascal-format msgid "There is already an IDE macro with the name \"%s\"" msgstr "\"%s\" adında bir IDE makrosu zaten var" #: lazarusidestrconsts.listhereisalreadyapackageinthelist #, object-pascal-format msgid "There is already a package %s in the list" msgstr "Listede zaten bir %s paketi var" #: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur #, object-pascal-format msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?" msgstr "%s%s içinde zaten bir \"%s\" birimi var Eski: %s%sYeni: %s%sBirim arama yolunun bunlardan yalnızca birini içerdiğinden emin olmalısınız.%s%sDevam edlsin mi?" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus #, object-pascal-format msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." msgstr "Zaten \"%s\" adında bir birim var. Pascal tanımlayıcıları benzersiz olmalıdır." #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose #, object-pascal-format msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" msgstr "Projede \"%s\" adında bir birim var.%sLütfen farklı bir ad seçin" #: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu #, object-pascal-format msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." msgstr "%s dizininde fpc.exe dosyası yok. Genellikle make çalıştırılabilir dosyası FPC derleyicisi ile birlikte yüklenir." #: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured #, object-pascal-format msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s" msgstr "Proje seçeneklerinde yapılandırılmış bir Free Pascal Derleyicisi (örn. fpc%0:s veya ppc%0:s) yok. CodeTools düzgün çalışmayacaktır.%1:s%1:sHata mesajı:%1:s%2:s" #: lazarusidestrconsts.listheremustbeatleastonebuildmode msgid "There must be at least one build mode." msgstr "En az bir derleme modu olmalıdır." #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor #, object-pascal-format msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." msgstr "\"%s\" kaynak sınıfı \"%s \"den türemiştir. Muhtemelen bu TForm için bir yazım hatasıdır." #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent #, object-pascal-format msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "Seçilen bileşen %s:%s:%s%s yazılırken bir hata oluştu" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe #, object-pascal-format msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "Seçilen bileşenin ikili akışı dönüştürülürken bir hata oluştu %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli #, object-pascal-format msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "Bileşen akışı panoya kopyalanırken bir hata oluştu:%s%s" #: lazarusidestrconsts.listherootcomponentcannotbedeleted msgid "The root component cannot be deleted." msgstr "Kök bileşen silinemez." #: lazarusidestrconsts.listhesefileswillbedeleted msgid "These files will be deleted" msgstr "Bu dosyalar silinecek" #: lazarusidestrconsts.listhesesettingsarestoredwiththeproject msgid "These settings are stored with the project." msgstr "Bu ayarlar proje ile birlikte saklanır." #: lazarusidestrconsts.listheseunitswerenotfound msgid "These units were not found:" msgstr "Bu birimler bulunamadı:" #: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro #, object-pascal-format msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." msgstr "Free Pascal paketlerinin kaynakları tarama ve kod tamamlama için gereklidir. Örneğin, \"%s\" dosyasına sahip." #: lazarusidestrconsts.listhetargetdirectoryisafile #, object-pascal-format msgid "The target directory is a file:%s" msgstr "Hedef klasör adı bir dosya %s" #: lazarusidestrconsts.listhetargetfilenameisadirectory msgid "The target file name is a directory." msgstr "Hedef dosya adı bir klasör." #: lazarusidestrconsts.listhetargetisnotwritable #, object-pascal-format msgid "The target %s is not writable." msgstr "Hedef %s yazılabilir değil." #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt #, object-pascal-format msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" msgstr "Test Dizini bulunamadı: %s \"%s\" %s (IDE seçeneklerine bakın)" #: lazarusidestrconsts.listheunitalreadyexists #, object-pascal-format msgid "The unit \"%s\" already exists." msgstr "Birim \"%s\" zaten var." #: lazarusidestrconsts.listheunitbelongstopackage #, object-pascal-format msgid "The unit belongs to package %s." msgstr "Birim %s paketine aittir." #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe #, object-pascal-format msgid "The unit %s exists twice in the unit path of the %s:" msgstr "%s birimi %s birim yolunda iki kez var:" #: lazarusidestrconsts.listheunithasthisname msgid "The unit has this name" msgstr "Birimin adı şu şekildedir" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler #, object-pascal-format msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" msgstr "Birim dosya adı \"%s\" küçük harf değil.%sFree Pascal derleyicisi tüm durumları aramaz. Küçük harfli dosya adı kullanılması önerilir.%sDosya küçük harfli olarak yeniden adlandırılsın mı?" #: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd #, object-pascal-format msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." msgstr "\"%s\" birimi FPC kaynaklarının bir parçası, ancak ilgili fpdoc xml dosyası bulunamadı.%sYa fpcdocs dizinini arama yoluna henüz eklemediniz ya da birim henüz belgelenmemiş.%s FPC kaynakları için fpdoc dosyaları şu adresten indirilebilir:%s%s Lütfen dizini fpdoc düzenleyici seçeneklerine ekleyin.%s Yeni bir dosya oluşturmak için dizinin yazılabilir olması gerekir." #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic #, object-pascal-format msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "%s birimi diğer dosyalar tarafından kullanılıyor:%s Referanslar otomatik olarak güncellensin mi?" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus #, object-pascal-format msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." msgstr "Birimin kendisi zaten \"%s\" ismine sahiptir. Pascal tanımlayıcıları benzersiz olmalıdır." #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac #, object-pascal-format msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" msgstr "\"%s\" biriminde arama yolu %s paketinin \"%s\"kaynak dizinini içeriyor" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki #, object-pascal-format msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "\"%s\"çalışma dizini yok %sLütfen çalışma dizinini kontrol edin. Menü> Çalıştır> Prametreleri Çalıştır." #: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename #, object-pascal-format msgid "This component already contains a class with the name %s." msgstr "Bu bileşen zaten %s isminde bir sınıf içeriyor." #: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor msgid "This function needs an open .lfm file in the source editor." msgstr "Bu fonksiyon kaynak editöründe açık bir .lfm dosyasına ihtiyaç duyar." #: lazarusidestrconsts.listhishelpmessage msgid "This help message." msgstr "Bu yardım mesajı" #: lazarusidestrconsts.listhisistestprojectfordesigntimepackage msgid "This is a test project for a design time package, testing it outside the IDE." msgstr "Bu, bir tasarım zamanı paketi için IDE dışında test edilen bir test projesidir." #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc #, object-pascal-format msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "Bu bir Pascal dosyasına benziyor.%sBazı dosya sistemlerinde ve farklı derleyicilerde çeşitli sorunlardan kaçınmak için küçük harf dosya adlarının kullanılması önerilir.%sKüçük harfle mi değiştirilsin mi?" #: lazarusidestrconsts.listhisprojecthasnomainsourcefile msgid "This project has no main source file" msgstr "Bu projenin ana kaynak dosyası yok" #: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode msgid "This project has only the default build mode." msgstr "Bu proje yalnızca varsayılan derleme moduna sahiptir." #: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis #, object-pascal-format msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." msgstr "Lazarus'u oluşturmak için bu seçenekler kümesi bu kurulum tarafından desteklenmiyor.%s\"%s\" dizini yazılabilir değil.%sLazarus'u kurmanın diğer yolları için Lazarus web sitesine bakın." #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode #, object-pascal-format msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "Bu ifade çıkarılamaz.%sYeni bir prosedür/yöntem çıkarmak için lütfen bazı kodlar seçin." #: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme msgid "This will allow changing all build modes at once. Not implemented yet." msgstr "Bu, tüm derleme modlarının aynı anda değiştirilmesine izin verecektir. Henüz uygulanmadı." #: lazarusidestrconsts.listhiswillcreateacirculardependency msgid "This will create a circular dependency." msgstr "Bu döngüsel bir bağımlılık yaratacaktır." #: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed #, object-pascal-format msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" msgstr "Bu, panoya çok sayıda metin (%s) koyacaktır.%sDevam edilsin mi?" #: lazarusidestrconsts.listitle msgid "&Title" msgstr "&Başlık" #: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus #, fuzzy #| msgid "Title in taskbar shows for example: project1.lpi - Lazarus" msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus." msgstr "Görev çubuğundaki başlık, örneğin: project1.lpi - Lazarus" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "Başlık (varsayılan olarak boş bırakın)" #: lazarusidestrconsts.listofpcpath msgid "Path:" msgstr "Yol:" #: lazarusidestrconsts.listoolbarconfiguration msgid "Toolbar Configuration" msgstr "Araç Çubuğunu Yapılandır" #: lazarusidestrconsts.listoolhasnoexecutable #, object-pascal-format msgid "tool \"%s\" has no executable" msgstr "\"%s\" aracının yürütülebilir dosyası yok" #: lazarusidestrconsts.listoolheaderfailed msgid "Tool Header: Failed" msgstr "Araç Başlığı: Başarısız" #: lazarusidestrconsts.listoolheaderrunning msgid "Tool Header: Running" msgstr "Alet Başlığı: Çalışıyor" #: lazarusidestrconsts.listoolheaderscrolledup msgid "Tool Header: Scrolled up" msgstr "Araç Başlığı: Kaydırıldı" #: lazarusidestrconsts.listoolheadersuccess msgid "Tool Header: Success" msgstr "Araç Başlığı: Başarılı" #: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo #, object-pascal-format msgid "tool stopped with exit code %s. Use context menu to get more information." msgstr "aracı %s çıkış koduyla durduruldu. Daha fazla bilgi almak için içerik menüsünü kullanın." #: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo #, object-pascal-format msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information." msgstr "aracı ExitCode 0 ve ExitStatus %s ile durduruldu. Daha fazla bilgi almak için içerik menüsünü kullanın." #: lazarusidestrconsts.listop msgctxt "lazarusidestrconsts.listop" msgid "Top" msgstr "Üst" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" msgstr "Üst sabitleme" #: lazarusidestrconsts.listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "Üst kenar boşluğu. Bu değer taban kenar boşluğuna eklenir ve denetimin üstündeki boşluk için kullanılır." #: lazarusidestrconsts.listopinfoview msgid "Show Class/Procedure hint" msgstr "Class/Procedure ipuçlarını Göster" #: lazarusidestrconsts.listops msgid "Tops" msgstr "Üstler" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." msgstr "Bu, üst tarafın tutturulduğu kardeş kontroldür. Delphi stilinde ebeveyne tutturmak için boş bırakın (BorderSpacing ve ReferenceSide önemli değildir)." #: lazarusidestrconsts.listopspaceequally msgid "Top space equally" msgstr "Üst alan eşit olarak" #: lazarusidestrconsts.listotalpages #, object-pascal-format msgid "Total Pages: %s" msgstr "Toplam sayfa: %s" #: lazarusidestrconsts.listranslatetheenglishmessages msgid "Translate the English Messages" msgstr "İngilizce Mesajları Çevir" #: lazarusidestrconsts.listreeneedsrefresh msgid "Tree needs refresh" msgstr "Ağacın yenilenmesi gerekiyor" #: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein #, object-pascal-format msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" msgstr "Taşınan iki dosya aynı dosya adına sahip olacaktır:%s%s%s%s%sdan %s" #: lazarusidestrconsts.listypes msgid "Types (not removed if no replacement)" msgstr "Türler (yedek yoksa kaldırılmaz)" #: lazarusidestrconsts.lisudadditionaldirectories msgid "Additional directories:" msgstr "Ek dizinler:" #: lazarusidestrconsts.lisudallpackageunits msgid "All package units" msgstr "Tüm paket üniteleri" #: lazarusidestrconsts.lisudallsourceeditorunits msgid "All source editor units" msgstr "Tüm kaynak editör birimleri" #: lazarusidestrconsts.lisudallunits msgid "All units" msgstr "Tüm birimler" #: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well." msgstr "Varsayılan olarak sadece proje birimleri ve kaynak editör birimleri aranır. Arama yapmak için buraya noktalı virgülle ayrılmış dizinlerin bir listesini ekleyin." #: lazarusidestrconsts.lisudcollapseallnodes msgid "Collapse all nodes" msgstr "Tümünü daralt" #: lazarusidestrconsts.lisudexpandallnodes msgid "Expand all nodes" msgstr "Tümünü genişlet" #: lazarusidestrconsts.lisudfile #, object-pascal-format msgid "File: %s" msgstr "Dosya: %s" #: lazarusidestrconsts.lisudfilter msgid "(Filter)" msgstr "(Filtre)" #: lazarusidestrconsts.lisudimplementationuses #, object-pascal-format msgid "Implementation Uses: %s" msgstr "Implementation Kullanımı: %s" #: lazarusidestrconsts.lisudimplementationuses2 #, object-pascal-format msgid "implementation uses: %s" msgstr "implementation kullanımı: %s" #: lazarusidestrconsts.lisudinterfaceuses #, object-pascal-format msgid "Interface Uses: %s" msgstr "Interface Kullanımı: %s" #: lazarusidestrconsts.lisudinterfaceuses2 #, object-pascal-format msgid "interface uses: %s" msgstr "interface kullanımı: %s" #: lazarusidestrconsts.lisudprojectsandpackages msgid "Projects and packages" msgstr "Projeler ve paketler" #: lazarusidestrconsts.lisudscanning msgid "Scanning ..." msgstr "Taranıyor ..." #: lazarusidestrconsts.lisudscanningunits #, object-pascal-format msgid "Scanning: %s units ..." msgstr "Taranıyor: %s birimi ..." #: lazarusidestrconsts.lisudsearch msgid "(Search)" msgstr "(Ara)" #: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase msgid "Find next occurrence of this phrase" msgstr "Bu cümlenin bir sonraki varlığını bul" #: lazarusidestrconsts.lisudsearchnextunitofthisphrase msgid "Find next unit with this phrase" msgstr "Bu cümle ile sonraki birimi bulun" #: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase msgid "Find previous occurrence of this phrase" msgstr "Bu cümlenin önceki oluşumunu bul" #: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase msgid "Find previous unit with this phrase" msgstr "Bu cümleyle önceki birimi bulun" #: lazarusidestrconsts.lisudselectedunits msgid "Selected units" msgstr "Seçilen birimler" #: lazarusidestrconsts.lisudshownodesfordirectories msgid "Show nodes for directories" msgstr "Dizinler için düğümleri göster" #: lazarusidestrconsts.lisudshownodesforprojectandpackages msgid "Show nodes for project and packages" msgstr "Proje ve paketler için düğümleri göster" #: lazarusidestrconsts.lisudunits msgid "Units" msgstr "Birimler" #: lazarusidestrconsts.lisudunits2 #, object-pascal-format msgid "Units: %s" msgstr "Birimler: %s" #: lazarusidestrconsts.lisudusedbyimplementations #, object-pascal-format msgid "Used by Implementations: %s" msgstr "Implementations Tarafından Kullanılıyor: %s" #: lazarusidestrconsts.lisudusedbyimplementations2 #, object-pascal-format msgid "used by implementations: %s" msgstr "implementations tarafından kullanılır: %s" #: lazarusidestrconsts.lisudusedbyinterfaces #, object-pascal-format msgid "Used by Interfaces: %s" msgstr "Interfaces tarafından kullanılıyor: %s" #: lazarusidestrconsts.lisudusedbyinterfaces2 #, object-pascal-format msgid "used by interfaces: %s" msgstr "interfaces tarafından kullanılır: %s" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." msgstr "Bu mesajı tekrar gösterme." #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Normal ifade hatası" #: lazarusidestrconsts.lisuefontwith msgid "Font without UTF-8" msgstr "UTF-8 siz yazı tipi" #: lazarusidestrconsts.lisuegotoline msgid "Goto line:" msgstr "Satıra Git:" #: lazarusidestrconsts.lisuemodeseparator msgid "/" msgstr "/" #: lazarusidestrconsts.lisuenotfound msgid "Not found" msgstr "Bulunamadı" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith #, object-pascal-format msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" msgstr "Bu \"%s\"%s\" ile \"%s\" ile değiştirilsin mi?" #: lazarusidestrconsts.lisuesearching #, object-pascal-format msgid "Searching: %s" msgstr "Aranıyor: %s" #: lazarusidestrconsts.lisuesearchstringcontinuebeg msgid "Continue search from the beginning?" msgstr "Baştan aramaya devam et?" #: lazarusidestrconsts.lisuesearchstringcontinueend msgid "Continue search from the end?" msgstr "Arama sona kadar devam etsin mi?" #: lazarusidestrconsts.lisuesearchstringnotfound #, object-pascal-format msgid "Search string '%s' not found!" msgstr "Arama dizesi '%s' bulunamadı!" #: lazarusidestrconsts.lisuethecurre #, object-pascal-format msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." msgstr "Mevcut düzenleyici yazı tipi UTF-8'i desteklemiyor ancak sisteminiz bunu kullanıyor gibi görünüyor.%sBu, ASCII olmayan karakterlerin muhtemelen yanlış gösterileceği anlamına gelir.%sDüzenleyici seçeneklerinden başka bir yazı tipi seçebilirsiniz." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" msgstr "Önbelleği temizle" #: lazarusidestrconsts.lisuidbytes #, object-pascal-format msgid "%s bytes" msgstr "%s byte" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" msgstr "Dahil olan:" #: lazarusidestrconsts.lisuidinproject msgid "In project:" msgstr "Projede:" #: lazarusidestrconsts.lisuidlines msgid "Lines:" msgstr "Satırlar:" #: lazarusidestrconsts.lisuidname msgctxt "lazarusidestrconsts.lisuidname" msgid "Name:" msgstr "Ad:" #: lazarusidestrconsts.lisuidno msgid "no" msgstr "hayır" #: lazarusidestrconsts.lisuidsize msgid "Size:" msgstr "Boyut:" #: lazarusidestrconsts.lisuidtype msgid "Type:" msgstr "Tür:" #: lazarusidestrconsts.lisuidyes msgid "yes" msgstr "evet" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "Kod Araçları Değerlerini Göster" #: lazarusidestrconsts.lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "İkili akış metne dönüştürülemiyor" #: lazarusidestrconsts.lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "Bileşenler panoya kopyalayamıyor" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile #, object-pascal-format msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." msgstr "Kaynak dosyası %s\"%s\" kaynak başlığına yorum eklenemedi.%s Muhtemelen bir sözdizimi hatası." #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably #, object-pascal-format msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." msgstr "Kaynak T%s: FORMDATA %s kaynağına eklenemiyor \"%s\".%s Muhtemelen bir sözdizimi hatası." #: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread #, object-pascal-format msgid "Unable to add the dependency %s because the package %s has already a dependency %s" msgstr "%s paketi zaten %s bağımlılığına sahip olduğundan %s bağımlılığı eklenemiyor" #: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea #, object-pascal-format msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s" msgstr "Döngüsel bir bağımlılık oluşturacağı için %s bağımlılığı eklenemiyor. Bağımlılık %s" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith #, object-pascal-format msgid "Unable to add %s to project because there is already a unit with the same name in the Project." msgstr "Projede zaten aynı isimde bir birim olduğu için %s projeye eklenemiyor." #: lazarusidestrconsts.lisunabletobackupfileto #, object-pascal-format msgid "Unable to backup file \"%s\" to \"%s\"!" msgstr "\"%s\" dosyası \"%s\" dosyasına yedeklenemiyor!" #: lazarusidestrconsts.lisunabletochangeclassofto #, object-pascal-format msgid "%s%sUnable to change class of %s to %s" msgstr "%s%s %s sınıfını %s olarak değiştirilemiyor" #: lazarusidestrconsts.lisunabletochangeprojectscaledinsource #, object-pascal-format msgid "Unable to change project scaled in source.%s%s" msgstr "Kaynakta ölçeklendirilen proje değiştirilemiyor. %s%s" #: lazarusidestrconsts.lisunabletochangeprojecttitleinsource #, object-pascal-format msgid "Unable to change project title in source.%s%s" msgstr "Kaynakta proje başlığı değiştirilemiyor .%s%s" #: lazarusidestrconsts.lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "Hedef klasör temizlenemedi" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions #, object-pascal-format msgid "Unable to clean up \"%s\".%sPlease check permissions." msgstr "\"%s\".%s temizlenemiyor. Lütfen izinleri kontrol edin." #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat #, object-pascal-format msgid "Unable to convert component text into binary format:%s%s" msgstr "Bileşen metni ikili biçimde dönüştürülemiyor: %s %s" #: lazarusidestrconsts.lisunabletoconvertfileerror #, object-pascal-format msgid "Unable to convert file \"%s\"%sError: %s" msgstr "Dosya \"%s\" %sHata: %s" #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream #, object-pascal-format msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" msgstr "%s dosyası \"%s\" %s akışı ikili sistem ( %s) dosyasının metin form verilerini dönüştürmek mümkün değil" #: lazarusidestrconsts.lisunabletoconverttoencoding #, object-pascal-format msgid "Unable to convert to encoding \"%s\"" msgstr "\"%s\" kodlamasına dönüştürülemez" #: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto msgid "Unable to create new file because there is already a directory with this name." msgstr "Yeni bir dosya oluşturulamadı, çünkü zaten bu ada sahip bir klasör var." #: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "Geçici lfm tamponu oluşturulamıyor." #: lazarusidestrconsts.lisunabletodeleteambiguousfile #, object-pascal-format msgid "Unable to delete ambiguous file \"%s\"" msgstr "Belirsiz dosya \"%s\" silinemiyor" #: lazarusidestrconsts.lisunabletoexecute #, object-pascal-format msgid "unable to execute: %s" msgstr "yürütemedi: %s" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "Bu veya kullanılan birimlerden herhangi birinde bir ResourceString bölümü bulunamıyor." #: lazarusidestrconsts.lisunabletofindavalidclassnamein #, object-pascal-format msgid "Unable to find a valid classname in \"%s\"" msgstr "\"%s \" 'da geçerli bir sınıf adı bulunamadı" #: lazarusidestrconsts.lisunabletofindfile #, object-pascal-format msgid "Unable to find file \"%s\"." msgstr "\"%s\" dosyası bulunamadı." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption #, object-pascal-format msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" msgstr "\"%s\" dosyası bulunamıyor.%sProjenize aitse, %sProje -> Derleyici Seçenekleri -> Arama Yolları -> Diğer Birim Dosyaları içindeki arama yolunu kontrol edin. Bu dosya bir pakete aitse, uygun paket derleyici seçeneklerini kontrol edin. Bu dosya Lazarus'a aitse, derlemenin temiz olduğundan emin olun. Dosya FPC'ye aitse, fpc.cfg dosyasını kontrol edin. Emin değilseniz, Project -> CompilerOptions -> Test'i kontrol edin" #: lazarusidestrconsts.lisunabletofindinlfmstream #, object-pascal-format msgid "Unable to find %s in LFM Stream." msgstr "LFM Akışında %s bulunamadı." #: lazarusidestrconsts.lisunabletofindmethod msgid "Unable to find method." msgstr "Yöntem bulunamadı." #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile #, object-pascal-format msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" msgstr ".lfm dosyası %s \"%s\" için Pascal birimi (.pas, .pp) bulunamadı" #: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar #, object-pascal-format msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" msgstr "\"%s\" bileşen sınıfı bulunamıyor.%s RegisterClass aracılığıyla kaydedilmedi ve lfm bulunamadı.%s Birim tarafından gerekli:%s%s" #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "Editör değişiklikleri alınamadı." #: lazarusidestrconsts.lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "Tasarımcı için kaynak bulunamadı." #: lazarusidestrconsts.lisunabletoloadfile2 #, object-pascal-format msgid "unable to load file %s: %s" msgstr "%s dosyası yüklenemedi: %s" #: lazarusidestrconsts.lisunabletoloadpackage #, object-pascal-format msgid "Unable to load package \"%s\"" msgstr "\"%s\" Paketi yüklenemedi" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits #, object-pascal-format msgid "Unable to load the component class \"%s\" because it depends on itself." msgstr "Kendisine bağlı olduğu için \"%s\" bileşen sınıfı yüklenemiyor." #: lazarusidestrconsts.lisunabletoopen #, object-pascal-format msgid "Unable to open \"%s\"" msgstr "\"%s\" açılamıyor" #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "Ata bileşen açılamıyor" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades #, object-pascal-format msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "Tasarımcı açılamıyor.%s%s sınıfı TForm veya TDataModule gibi tasarlanabilir bir sınıftan gelmiyor." #: lazarusidestrconsts.lisunabletoread #, object-pascal-format msgid "Unable to read %s" msgstr "%s okunamadı" #: lazarusidestrconsts.lisunabletoreadprocessexitstatus msgid "unable to read process ExitStatus" msgstr "süreç ExitStatus'u okuyamıyor" #: lazarusidestrconsts.lisunabletoremoveoldbackupfile #, object-pascal-format msgid "Unable to remove old backup file \"%s\"!" msgstr "Eski yedekleme dosyası \"%s\" kaldırılamıyor!" #: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource #, object-pascal-format msgid "Unable to remove project scaled from source.%s%s" msgstr "Kaynaktan ölçeklendirilen proje kaldırılamıyor.%s%s" #: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource #, object-pascal-format msgid "Unable to remove project title from source.%s%s" msgstr "Proje başlığı kaynaktan kaldıramadı. %s%s" #: lazarusidestrconsts.lisunabletorenameambiguousfileto #, object-pascal-format msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" msgstr "Belirsiz dosya \"%s\" %s dan \"%s\"\" olarak yeniden adlandıramıyor" #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "Kaynakta form yeniden adlandırılamıyor." #: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "Yöntem yeniden adlandırılamıyor. Lütfen mesaj penceresinde gösterilen hatayı düzeltin." #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "Kaynakta değişken yeniden adlandırılamıyor." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" msgstr "Çalıştırılamadı" #: lazarusidestrconsts.lisunabletorun2 #, object-pascal-format msgid "Unable to run \"%s\"" msgstr "\"%s\" Çalıştırılamadı" #: lazarusidestrconsts.lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "AnchorSide Kontrolü ayarlanamadı" #: lazarusidestrconsts.lisunabletoshowmethod msgid "Unable to show method." msgstr "Yöntem gösterilemiyor." #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "Seçilen bileşenler aktarılamıyor" #: lazarusidestrconsts.lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "Seçilen bileşenler aktarılamıyor." #: lazarusidestrconsts.lisunabletostreamt #, object-pascal-format msgid "Unable to stream %s:T%s." msgstr "%s akış yapılamadı: T%s." #: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext #, object-pascal-format msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "%s:T%s'nin ikili bileşen akışını metin haline dönüştürülemez." #: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "Proje kaynağında CreateForm deyimi güncelleştirilemiyor" #: lazarusidestrconsts.lisuncheckall msgid "Uncheck All" msgstr "Tüm işareti kaldır" #: lazarusidestrconsts.lisundo msgid "Undo" msgstr "Geri" #: lazarusidestrconsts.lisuninstall #, object-pascal-format msgid "Uninstall %s" msgstr "%s kaldırıldı" #: lazarusidestrconsts.lisuninstallfail msgid "Uninstall failed" msgstr "Kaldırma başarısız oldu" #: lazarusidestrconsts.lisuninstallimpossible msgid "Uninstall impossible" msgstr "Kaldırmak imkansız" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" msgstr "Seçimi kaldır" #: lazarusidestrconsts.lisuninstallthemtoo msgid "Uninstall them too" msgstr "Onları da kaldırın" #: lazarusidestrconsts.lisunithaschangedsave #, object-pascal-format msgid "Unit \"%s\" has changed. Save?" msgstr "Birim \"%s\"değiştirildi. Değişiklikler kaydedilsin mi?" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "Birim tanımlayıcı var" #: lazarusidestrconsts.lisunitinpackage #, object-pascal-format msgid "%s unit %s in package %s" msgstr "%s birimi %s, %s paketinde" #: lazarusidestrconsts.lisunitmustsavebeforeinherit #, object-pascal-format msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?" msgstr "\"%s\" biriminin devralınabilmesi için kaydedilmesi gerekir. Şimdi kaydedilsin mi?" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "Birim adı zaten projede" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "Birim adı başlıyor ..." #: lazarusidestrconsts.lisunitnamecontains msgid "Unit name contains ..." msgstr "Birim adı içeriyor ..." #: lazarusidestrconsts.lisunitnotfound #, object-pascal-format msgid "unit %s not found" msgstr "birim %s bulunamadı" #: lazarusidestrconsts.lisunitnotfoundatnewposition #, object-pascal-format msgid "unit %s not found at new position \"%s\"" msgstr "%s birimi \"%s\" yeni konumunda bulunamadı \"" #: lazarusidestrconsts.lisunitnotfoundinfile #, object-pascal-format msgid "A unit not found in file %s" msgstr "%s dosyasında bir birim bulunamadı" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" msgstr "Birim Çıktı Dizini" #: lazarusidestrconsts.lisunitpath msgid "unit path" msgstr "birim yolu" #: lazarusidestrconsts.lisunitpaths msgid "Unit paths" msgstr "Birim yolları" #: lazarusidestrconsts.lisunitrequirespackage #, object-pascal-format msgid "unit %s requires package %s" msgstr "%s birimi %s paketini gerektiriyor" #: lazarusidestrconsts.lisunitsnotfoundinfile #, object-pascal-format msgid "Units not found in file %s" msgstr "Birimler %s dosyasında bulunamadı" #: lazarusidestrconsts.lisunusedunitsof #, object-pascal-format msgid "Unused units of %s" msgstr "%s kullanılmayan birimler" #: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." msgstr "Alışılmadık derleyici dosya adı Genellikle fpc, ppc veya ppcross ile başlar." #: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa msgid "Unusual pas2js compiler file name. Usually it starts with pas2js." msgstr "Olağandışı pas2js derleyici dosya adı. Genellikle pas2js ile başlar." #: lazarusidestrconsts.lisup msgid "Up" msgstr "Yukarı" #: lazarusidestrconsts.lisupdateapplicationcreateform msgid "Update Application.CreateForm statements in main unit" msgstr "Ana ünitede Application.CreateForm deyimlerini güncelleyin" #: lazarusidestrconsts.lisupdateapplicationscaledstatement msgid "Update Application.Scaled statement in main unit" msgstr "Ana ünitede Application.Scaled deyimlerini güncelleyin" #: lazarusidestrconsts.lisupdateapplicationtitlestatement msgid "Update Application.Title statement in main unit" msgstr "Ana ünitede Application.Title deyimlerini güncelleyin" #: lazarusidestrconsts.lisupdateinfo msgid "Update info" msgstr "Güncelleme bilgisi" #: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha msgid "Update other procedure signatures when only letter case has changed" msgstr "Yalnızca harf durumu değiştiğinde diğer prosedür imzalarını güncelleyin" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" msgstr "Kaynaklar güncellensin mi?" #: lazarusidestrconsts.lisupgrade msgid "Upgrade" msgstr "Yükselt" #: lazarusidestrconsts.lisupgradeconfiguration msgid "Upgrade configuration" msgstr "Yapılandırmayı yükselt" #: lazarusidestrconsts.lisuppercasestring msgid "uppercase string" msgstr "büyük harf string" #: lazarusidestrconsts.lisuppercasestringgivenasparameter msgid "Uppercase string given as parameter." msgstr "Parametre olarak verilen büyük harfli string." #: lazarusidestrconsts.lisurlonwikithebaseurlis #, object-pascal-format msgid "URL on wiki (the base url is %s)" msgstr "Wiki'deki URL (temel url %s)" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" msgstr "Kullanım mesajı (-h seçeneği)" #: lazarusidestrconsts.lisuse msgid "Use" msgstr "Kullan" #: lazarusidestrconsts.lisuseansistrings msgctxt "lazarusidestrconsts.lisuseansistrings" msgid "Use Ansistrings" msgstr "Ansistrings kullanın" #: lazarusidestrconsts.lisusecheckboxforbooleanvalues msgid "Use CheckBox for Boolean values" msgstr "Boolean değerleri için CheckBox kullanın" #: lazarusidestrconsts.lisusecommentsincustomoptions msgid "Use comments in custom options" msgstr "Özel seçeneklerdeki yorumları kullanın" #: lazarusidestrconsts.lisusedby #, object-pascal-format msgid " used by %s" msgstr " %s tarafından kullanılıyor" #: lazarusidestrconsts.lisusedesigntimepackages msgid "Use design time packages" msgstr "Tasarım zaman paketlerini kullanın" #: lazarusidestrconsts.lisusedforautocreatedforms msgid "Used for auto-created forms." msgstr "Otomatik oluşturulan formlar için kullanılır." #: lazarusidestrconsts.lisusefilterforextrafiles msgid "Use filter to include extra files" msgstr "Ekstra dosyalar eklemek için filtre kullanın" #: lazarusidestrconsts.lisuseidentifier msgid "Use identifier" msgstr "Tanımlayıcı kullan" #: lazarusidestrconsts.lisuseidentifierinat #, object-pascal-format msgid "Use identifier %s in %s at %s" msgstr "%s içindeki tanımlayıcı %s'yi kullanın %s" #: lazarusidestrconsts.lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "Uygulama başlatılıyor" #: lazarusidestrconsts.lisusepackageinpackage #, object-pascal-format msgid "Use package %s in package %s" msgstr "Paket %s içerisindeki paketi %s kullan" #: lazarusidestrconsts.lisusepackageinpackage2 msgid "Use package in package" msgstr "Paketde paketi kullanın" #: lazarusidestrconsts.lisusepackageinproject #, object-pascal-format msgid "Use package %s in project" msgstr "Projede %s paketini kullan" #: lazarusidestrconsts.lisusepackageinproject2 msgid "Use package in project" msgstr "Projede paketi kullan" #: lazarusidestrconsts.lisuserdefinedmarkupkeyadd #, object-pascal-format msgid "Add to list \"%s\"" msgstr "Listeye ekle \"%s\"" #: lazarusidestrconsts.lisuserdefinedmarkupkeygroup msgid "User defined text markup" msgstr "Kullanıcı tanımlı metin biçimlendirme" #: lazarusidestrconsts.lisuserdefinedmarkupkeyremove #, object-pascal-format msgid "Remove from list \"%s\"" msgstr "Listeden kaldır \"%s\"" #: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle #, object-pascal-format msgid "Toggle on list \"%s\"" msgstr "Listede \"%s\" aç/kapat" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" msgstr "Kullanıcının ana dizini" #: lazarusidestrconsts.lisuseunit msgid "Add Unit to Uses Section" msgstr "Uses bölümüne birim Ekle" #: lazarusidestrconsts.lisuseunitinunit #, object-pascal-format msgid "Use unit %s in unit %s" msgstr "%s biriminde %s birimini kullan" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" msgstr "BOM ile UTF-8" #: lazarusidestrconsts.lisvalue msgctxt "lazarusidestrconsts.lisvalue" msgid "Value" msgstr "Değer" #: lazarusidestrconsts.lisvalue2 #, object-pascal-format msgid "Value%s" msgstr "Değer %s" #: lazarusidestrconsts.lisvalue3 msgid "Value: " msgstr "Değer: " #: lazarusidestrconsts.lisvalues msgid "Values" msgstr "Değerler" #: lazarusidestrconsts.lisvaluesthatarechangedfromdefault msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector." msgstr "Varsayılandan değiştirilen değerler .lfm dosyasında saklanır ve Nesne Denetçisinde farklı şekilde gösterilir." #: lazarusidestrconsts.lisvariable msgid "Variable" msgstr "Değişken" #: lazarusidestrconsts.lisverbose msgctxt "lazarusidestrconsts.lisverbose" msgid "Verbose" msgstr "Ayrıntılı" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" msgstr "Yöntem çağrılarını doğrulayın" #: lazarusidestrconsts.lisversion msgid "Version" msgstr "Sürüm" #: lazarusidestrconsts.lisversionmismatch msgid "Version mismatch" msgstr "Sürüm uyuşmazlığı" #: lazarusidestrconsts.lisvertical msgid "Vertical" msgstr "Dikey" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" msgstr "Sürüm bilgilerini panoya kopyala" #: lazarusidestrconsts.lisveryverbose msgid "Very Verbose" msgstr "Çok Ayrıntılı" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Kaynağı Görüntüle (.lfm)" #: lazarusidestrconsts.liswarning msgid "Warning: " msgstr "Uyarı: " #: lazarusidestrconsts.liswarnings #, object-pascal-format msgid ", Warnings: %s" msgstr ", Uyarılar: %s" #: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas #, object-pascal-format msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." msgstr "%s Uyarı: Bu ana ünitedir, yeni ana ünite %s.pas olacaktır." #: lazarusidestrconsts.liswelcometolazaruside #, object-pascal-format msgid "Welcome to Lazarus IDE %s" msgstr "Lazarus IDE %s ya hoş geldiniz" #: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve #, object-pascal-format msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" msgstr "Lazarus %s%s 'a hoş geldiniz %s%s içinde %s sürümünden bir yapılandırma zaten var" #: lazarusidestrconsts.liswhatneedsbuilding msgid "What needs building" msgstr "Neyin derlenmesi edilmesi gerekiyor" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references" msgstr "Bir birim yeniden adlandırıldığında, referansları güncelleyin" #: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew msgid "When enabled the current options are saved to the template which is used when creating new projects" msgstr "Etkinleştirildiğinde, mevcut seçenekler yeni proje oluştururken kullanılan şablona kaydedilir" #: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed msgid "When there is only one possible completion item use it immediately, without showing the completion box" msgstr "Yalnızca bir olası tamamlama öğesi olduğunda, tamamlama kutusunu göstermeden hemen kullanın" #: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein msgid "When the source editor cursor moves, show the current node in the code explorer" msgstr "Kaynak editörü imleci hareket edince, kod gezgini içindeki geçerli düğümü göster" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedform msgid "Window menu shows designed form's name instead of caption" msgstr "Pencere menüsü başlık yerine tasarlanan formun adını gösterir" #: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint msgid "Useful especially if the caption is left empty." msgstr "Özellikle başlık boş bırakılmışsa kullanışlıdır." #: lazarusidestrconsts.liswindowstaysontop msgid "Window stays on top" msgstr "Herzaman üstte" #: lazarusidestrconsts.liswithincludes2 msgid ", with includes " msgstr ", içerir " #: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw msgid "Without a proper compiler the code browsing and compiling will be disappointing." msgstr "Uygun bir derleyici olmadan kod tarama ve derleme hayal kırıklığı yaratacaktır." #: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing msgid "Without a proper debugger, debugging will be disappointing." msgstr "Uygun bir hata ayıklayıcı olmadan, hata ayıklama hayal kırıklığı yaratacaktır." #: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn msgid "Without a proper Lazarus directory you will get a lot of warnings." msgstr "Uygun bir Lazarus dizini olmadan çok fazla uyarı alırsınız." #: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." msgstr "Uygun bir \"make\" çalıştırılabilir dosyası olmadan IDE'nin derlenmesi mümkün değildir." #: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio msgid "Without the proper FPC sources code browsing and completion will be very limited." msgstr "Uygun FPC kaynakları olmadan kod tarama ve tamamlama çok sınırlı olacaktır." #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" msgstr "Gerekli paketler ile" #: lazarusidestrconsts.liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Geçerli düzenleyicide imleçte bulunan kelime" #: lazarusidestrconsts.lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "Derleme için çalışma dizini" #: lazarusidestrconsts.lisworkingdirectoryforrun msgid "Working directory for run" msgstr "Çalıştırmak için çalışma dizini" #: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters msgid "Write config instead of command line parameters" msgstr "Komut satırı parametreleri yerine config yaz" #: lazarusidestrconsts.liswritepackageinfofailed msgid "Writing the package info file failed." msgstr "Paket bilgi dosyası yazılamadı." #: lazarusidestrconsts.liswriteprojectinfofailed msgid "Writing the project info file failed." msgstr "Proje bilgi dosyası yazılamadı." #: lazarusidestrconsts.liswritewhatpackagefilesares msgid "Write what package files are searched and found." msgstr "Hangi paket dosyalarının arandığını ve bulunduğunu yazın." #: lazarusidestrconsts.liswrongversionin #, object-pascal-format msgid "wrong version in %s: %s" msgstr "%s içindeki yanlış sürüm: %s" #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed msgid "You can disable this for individual forms via the package editor" msgstr "Bunu paket düzenleyicisi aracılığıyla tek tek formlar için devre dışı bırakabilirsiniz" #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu msgid "You can disable this for individual forms via the popup menu in the project inspector" msgstr "Proje denetçisindeki açılır menü aracılığıyla bunu tek tek formlar için devre dışı bırakabilirsiniz" #: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" msgstr "FPC ve FPC kaynaklarını http://sourceforge.net/projects/lazarus/?source=dir adresinden indirebilirsiniz" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You cannot build Lazarus while debugging or compiling." msgstr "Hata ayıklarken veya derlerken Lazarus oluşturamazsınız." #: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling msgid "You cannot change the build mode while compiling." msgstr "Derleme sırasında derleme modunu değiştiremezsiniz." #: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter msgid "You can select items by simply pressing underscored letters" msgstr "Öğeleri sadece altı çizili harflere basarak seçebilirsiniz" #: lazarusidestrconsts.lis_all_ msgctxt "lazarusidestrconsts.lis_all_" msgid "" msgstr "" #: lazarusidestrconsts.locwndsrceditor msgctxt "lazarusidestrconsts.locwndsrceditor" msgid "Source Editor" msgstr "Kaynak Düzenleyici" #: lazarusidestrconsts.lrsplddeleteselected msgid "Delete selected" msgstr "Seçileni sil" #: lazarusidestrconsts.lrspldinvalid msgid "invalid" msgstr "geçersiz" #: lazarusidestrconsts.lrspldlpkfileinvalid #, object-pascal-format msgid "lpk file invalid (%s)" msgstr "lpk dosyası geçersiz ( %s)" #: lazarusidestrconsts.lrspldlpkfilevalid #, object-pascal-format msgid "lpk file valid (%s)" msgstr "lpk dosyası geçerli ( %s)" #: lazarusidestrconsts.lrspldunabletodeletefile #, object-pascal-format msgid "Unable to delete file \"%s\"" msgstr "\"%s\" dosyasını silemiyor" #: lazarusidestrconsts.lrspldvalid msgid "valid" msgstr "geçerli" #: lazarusidestrconsts.lrsrescanlplfiles msgid "Rescan lpl files" msgstr "Lpl dosyalarını yeniden tara" #: lazarusidestrconsts.lvlgraphaddhorizontalspacing msgid "Add horizontal spacing between columns" msgstr "Sütunlar arasına yatay boşluk ekle" #: lazarusidestrconsts.lvlgraphaddverticalspacingar msgid "Add vertical spacing around nodes" msgstr "Düğümlerin etrafına dikey boşluklar ekleyin" #: lazarusidestrconsts.lvlgraphextraspacing msgid "Extra spacing (x/y)" msgstr "Ekstra boşluk (x/y)" #: lazarusidestrconsts.lvlgraphnamesabovenode msgid "Names above node" msgstr "Düğüm üzerindeki adlar" #: lazarusidestrconsts.lvlgraphoptabsolutelimi msgid "Absolute limit for height of levels" msgstr "Seviye yüksekliği için mutlak limit" #: lazarusidestrconsts.lvlgraphoptcrossings msgid "Crossings" msgstr "Geçişler" #: lazarusidestrconsts.lvlgraphoptedgelen msgid "Edge len" msgstr "Kenar uzunluğu" #: lazarusidestrconsts.lvlgraphoptedges msgid "Edges" msgstr "Kenarlar" #: lazarusidestrconsts.lvlgraphoptinfo msgid "Info" msgstr "Bilgi" #: lazarusidestrconsts.lvlgraphoptlevels msgctxt "lazarusidestrconsts.lvlgraphoptlevels" msgid "Levels" msgstr "Seviyeler" #: lazarusidestrconsts.lvlgraphoptlimitheightoflvl msgid "Limit height of Levels" msgstr "Seviyelerin limit yüksekliği" #: lazarusidestrconsts.lvlgraphoptlimitrelativ #, object-pascal-format msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))" msgstr "Düzeylerin yüksekliği için düğüm sayımına göre sınır.%0sLimit = min(3, val*sqrt(NodeCount))" #: lazarusidestrconsts.lvlgraphoptsplitpoints msgid "Splitpoints" msgstr "Ayrılma noktaları" #: lazarusidestrconsts.lvlgraphreducebackedges msgid "Reduce backedges" msgstr "Yedeklemeleri azalt" #: lazarusidestrconsts.lvlgraphshapecalculatelay msgid "Calculate layout from high-edge" msgstr "Düzeni yüksek kenardan hesapla" #: lazarusidestrconsts.lvlgraphshapecurved msgid "Curved" msgstr "Kavisli" #: lazarusidestrconsts.lvlgraphshapeedgesshape msgid "Edges shape" msgstr "Kenar şekli" #: lazarusidestrconsts.lvlgraphshapeedgessplitmo msgid "Edges split mode" msgstr "Kenarları bölme modu" #: lazarusidestrconsts.lvlgraphshapeminimizeedge msgid "Minimize edges len" msgstr "Kenarları küçült" #: lazarusidestrconsts.lvlgraphshapenodes msgid "Nodes" msgstr "Düğümler" #: lazarusidestrconsts.lvlgraphshapestraight msgid "Straight" msgstr "Düzgün" #: lazarusidestrconsts.lvlgraphsplitmergeathighe msgid "Merge at highest" msgstr "En yükseğe birleştirme" #: lazarusidestrconsts.lvlgraphsplitmergeatsourc msgid "Merge at source" msgstr "Kaynakta birleştir" #: lazarusidestrconsts.lvlgraphsplitmergeattarge msgid "Merge at target" msgstr "Hedefte Birleştir" #: lazarusidestrconsts.lvlgraphsplitnone msgctxt "lazarusidestrconsts.lvlgraphsplitnone" msgid "None" msgstr "Yok" #: lazarusidestrconsts.lvlgraphsplitseparate msgid "Separate" msgstr "Ayrı" #: lazarusidestrconsts.lvlgraphstraightengraph msgid "Straighten graph" msgstr "Grafiği Düzleştir" #: lazarusidestrconsts.optdispgutterchanges msgid "Changes" msgstr "Değişiklikler" #: lazarusidestrconsts.optdispgutterfolding msgid "Folding" msgstr "Katlanır" #: lazarusidestrconsts.optdispguttermarks msgid "Marks" msgstr "İşaretler" #: lazarusidestrconsts.optdispgutternocurrentlinecolor msgid "No current line color" msgstr "Geçerli çizgi rengi yok" #: lazarusidestrconsts.optdispgutterseparator msgid "Separator" msgstr "Ayırıcı" #: lazarusidestrconsts.optdispgutterusecurrentlinecolor msgid "Use current line color" msgstr "Geçerli çizgi rengini kullan" #: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor msgid "Use current line number color" msgstr "Geçerli satır numarası rengini kullan" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "Kullanılan bölümlere paket birimi ekle" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" msgstr "Ters Ekle" #: lazarusidestrconsts.rsaddnewterm msgid "Add new term" msgstr "Yeni terim ekle" #: lazarusidestrconsts.rsattributes msgid "Attributes" msgstr "Nitelikler" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "Otomatik olarak üretim numarasını artır" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint msgid "Increased every time the project is compiled." msgstr "Proje her derlendiğinde arttır." #: lazarusidestrconsts.rsbuild msgid "&Build:" msgstr "&Derle:" #: lazarusidestrconsts.rscharacterset msgid "Character set:" msgstr "Karakter takımı:" #: lazarusidestrconsts.rscloseall msgid "Close all pages" msgstr "Tüm sayfaları kapat" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page (Ctrl+F4)∥(Ctrl+W)" msgstr "Geçerli sayfayı kapat (Ctrl+F4)∥(Ctrl+W)" #: lazarusidestrconsts.rscloseleft msgid "Close page(s) on the left" msgstr "Soldaki sayfaları kapat" #: lazarusidestrconsts.rscloseothers msgid "Close other page(s)" msgstr "Diğer sayfaları kapat" #: lazarusidestrconsts.rscloseright msgid "Close page(s) on the right" msgstr "Sağdaki sayfaları kapat" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" msgstr "Koşullu tanımlar" #: lazarusidestrconsts.rscreatenewdefine msgid "Create new define" msgstr "Yeni tanım oluştur" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" msgstr "I18n aktif" #: lazarusidestrconsts.rsfilterthelistwithstring msgid "Filter the lines in list with a string (Ctrl+F)" msgstr "Listedeki satırları bir dizeyle filtreleme (Ctrl+F)" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found but not listed here: " msgstr "Bulundu ancak burada listelenmedi: " #: lazarusidestrconsts.rsi18nexcluded msgid "Excluded" msgstr "Dışlanan" #: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild msgid "Force update PO files on next build" msgstr "Bir sonraki derlemede PO dosyalarını zorla güncelle" #: lazarusidestrconsts.rsi18nidentifiers msgid "Identifiers:" msgstr "Tanımlayıcılar:" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" msgstr "i18n Seçenekleri" #: lazarusidestrconsts.rsi18noriginals msgid "Originals:" msgstr "Orjinaller:" #: lazarusidestrconsts.rsincludeversioninfohint msgid "Version info is stored if the executable format supports it." msgstr "Çalıştırılabilir biçim destekliyorsa sürüm bilgisi saklanır." #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include version info in executable" msgstr "Sürüm bilgilerini çalıştırılabilir dosyaya ekle" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" msgstr "Dil seçenekleri" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" msgstr "Dil seçimi:" #: lazarusidestrconsts.rsmajorversion msgid "&Major version:" msgstr "&Ana sürüm::" #: lazarusidestrconsts.rsminorversion msgid "Mi&nor version:" msgstr "Küçü&k sürüm:" #: lazarusidestrconsts.rsnewsearchwithsamecriteria msgid "New search with same criteria (Ctrl+N)" msgstr "Aynı kriterlerle yeni arama (Ctrl+N)" #: lazarusidestrconsts.rsotherinfo msgid "Other info" msgstr "Diğer bilgi" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" msgstr "PO Çıktı klasörü:" #: lazarusidestrconsts.rsrefreshthesearch msgid "Refresh the search (F5)" msgstr "Aramayı yenile (F5)" #: lazarusidestrconsts.rsresource msgid "Resource" msgstr "Kaynak" #: lazarusidestrconsts.rsresourceclear msgid "Delete all resources?" msgstr "Tüm kaynaklar silinsin mi?" #: lazarusidestrconsts.rsresourcefilename msgctxt "lazarusidestrconsts.rsresourcefilename" msgid "File name" msgstr "Dosya adı" #: lazarusidestrconsts.rsresourcetype msgctxt "lazarusidestrconsts.rsresourcetype" msgid "Type" msgstr "Tür" #: lazarusidestrconsts.rsrevision msgid "&Revision:" msgstr "&Revizyon:" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" msgstr "Devralınan bir girişi seçin" #: lazarusidestrconsts.rsshowabspath msgid "Absolute path" msgstr "Kesin yol" #: lazarusidestrconsts.rsshowfilename msgctxt "lazarusidestrconsts.rsshowfilename" msgid "File name" msgstr "Dosya adı" #: lazarusidestrconsts.rsshowpathmode msgid "Path display mode (Ctrl+P)" msgstr "Yol görüntüleme modu (Ctrl+P)" #: lazarusidestrconsts.rsshowrelpath msgid "Relative path" msgstr "Göreceli yol" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" msgstr "Sürüm numarası" #: lazarusidestrconsts.showoptions msgid "Show options" msgstr "Seçenekleri göster" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" msgstr "Yardım menüsü komutları" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" msgstr "Komut komutları" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" msgstr "Kod Araçları komutları" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" msgstr "Metin sütun seçme komutları" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" msgstr "İmleç hareketi komutları" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" msgstr "Metin düzenleme komutları" #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" msgstr "Dosya menüsü komutları" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" msgstr "Metin katlama komutları" #: lazarusidestrconsts.srkmcatmacrorecording msgctxt "lazarusidestrconsts.srkmcatmacrorecording" msgid "Macros" msgstr "Makro" #: lazarusidestrconsts.srkmcatmarker msgid "Text bookmark commands" msgstr "Metin işaretleyici komutları" #: lazarusidestrconsts.srkmcatmulticaret msgid "Multi caret commands" msgstr "Çok satırlı komutlar" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" msgstr "Paket menüsü komutları" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" msgstr "Proje menüsü komutları" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" msgstr "Çalıştır menüsü komutları" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Metin arama ve değiştirme komutları" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" msgstr "Metin seçme komutları" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "Kaynak Not Defteri komutları" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" msgstr "Senkronize Düzenle" #: lazarusidestrconsts.srkmcatsyncroeditoff msgid "Syncron Editing (not in Cell)" msgstr "Eşzamanlı Düzenle (Hücrede Değil)" #: lazarusidestrconsts.srkmcatsyncroeditsel msgid "Syncron Editing (while selecting)" msgstr "Eşzamanlı Düzenle (seçilirken)" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" msgstr "Şablon Düzenle" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" msgstr "Şablon Düzenle (Hücre Değil)" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" msgstr "Araçlar menü komutları" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" msgstr "Menü komutlarını görüntüle" #: lazarusidestrconsts.srkmcommand msgctxt "lazarusidestrconsts.srkmcommand" msgid "Command:" msgstr "Komut:" #: lazarusidestrconsts.srkmconflic msgid "Conflict " msgstr "Çakışma " #: lazarusidestrconsts.srkmecabortbuild msgid "abort build" msgstr "derlemeyi iptal et" #: lazarusidestrconsts.srkmecabstractmethods msgid "Abstract Methods ..." msgstr "Özet Yöntemler ..." #: lazarusidestrconsts.srkmecaddbpaddress msgid "add address breakpoint" msgstr "adres kesme noktası ekle" #: lazarusidestrconsts.srkmecaddbpsource msgid "add source breakpoint" msgstr "kaynak kesme noktası ekle" #: lazarusidestrconsts.srkmecaddbpwatchpoint msgid "add data/watchpoint" msgstr "veri/gözetleme noktası ekle" #: lazarusidestrconsts.srkmecaddjumppoint msgid "Add Jump Point" msgstr "Atlama Noktası Ekle" #: lazarusidestrconsts.srkmecaddwatch msgid "add watch" msgstr "izleme ekle" #: lazarusidestrconsts.srkmecattach msgid "Attach to program" msgstr "Programa ekle" #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" msgstr "Kod şablonu tamamlama" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" msgstr "Bloğu Kopyala" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" msgstr "Bloğu Sil" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" msgstr "Blok başlangıcına git" #: lazarusidestrconsts.srkmecblockgotoend msgid "Goto Block end" msgstr "Blok sonuna git" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" msgstr "Bloğu Gizle" #: lazarusidestrconsts.srkmecblockindent #, fuzzy #| msgid "Indent block" msgid "Indent line/block" msgstr "Girinti bloğu" #: lazarusidestrconsts.srkmecblockindentmove msgid "Indent line/block (move columns)" msgstr "" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" msgstr "Bloğu Taşı" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" msgstr "Blok başlangıçını ayarla" #: lazarusidestrconsts.srkmecblocksetend msgid "Set block end" msgstr "Blok sonunu ayarla" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" msgstr "Bloğu göster" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" msgstr "Bloğu değiştir" #: lazarusidestrconsts.srkmecblockunindent #, fuzzy #| msgid "Unindent block" msgid "Unindent line/block" msgstr "Girintisiz blok" #: lazarusidestrconsts.srkmecblockunindentmove msgid "Unindent line/block (move columns)" msgstr "" #: lazarusidestrconsts.srkmecbreakpointproperties msgid "show breakpoint properties" msgstr "kesme noktası özelliklerini göster" #: lazarusidestrconsts.srkmecbuild msgid "build program/project" msgstr "program/proje derle" #: lazarusidestrconsts.srkmecbuildfile msgid "build file" msgstr "dosya oluştur" #: lazarusidestrconsts.srkmecbuildlazarus msgid "Build Lazarus" msgstr "Lazarusu Oluştur" #: lazarusidestrconsts.srkmecbuildmanymodes msgid "build many modes" msgstr "birçok mod oluştur" #: lazarusidestrconsts.srkmecchar msgid "Char" msgstr "Karakter" #: lazarusidestrconsts.srkmeccleanupandbuild msgid "clean up and build" msgstr "temizle ve derle" #: lazarusidestrconsts.srkmecclearall msgid "Delete whole text" msgstr "Tüm metni sil" #: lazarusidestrconsts.srkmecclearallbookmark msgid "Clear all Bookmarks" msgstr "Tüm Yer İşaretlerini Temizle" #: lazarusidestrconsts.srkmecclearbookmarkforfile msgid "Clear Bookmarks for current file" msgstr "Geçerli dosya için Yer İşaretlerini Temizle" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" msgstr "Sütun Seç Aşağı" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" msgstr "Sütun Mutlak sonuna seç" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" msgstr "Sütun Kesin başlangıçta seç" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" msgstr "Sütun Seçimi Sola" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" msgstr "Sütun Seçimi Satır Sonu" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" msgstr "Sütun Seçimi Çizgi Başlat" #: lazarusidestrconsts.srkmeccolsellinetextstart msgid "Column Select to text start in line" msgstr "Satır başında metne sütun seç" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" msgstr "Sütun Seç Sayfa Alt" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" msgstr "Sütun Sayfa Aşağı Seç" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" msgstr "Sütun Seç Sayfa Üstü" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" msgstr "Sütun Sayfa Yukarı Seç" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" msgstr "Sütun Sağ Seç" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" msgstr "Sütun Yukarı Seç" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" msgstr "Sütun Sol Kelimeyi Seçin" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" msgstr "Sütun Sağ Kelimeyi Seçin" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" msgstr "Sütun seçimi modu" #: lazarusidestrconsts.srkmeccompile msgid "compile program/project" msgstr "program/proje derle" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" msgstr "yapılandırma dosyası oluştur" #: lazarusidestrconsts.srkmeccopy msgctxt "lazarusidestrconsts.srkmeccopy" msgid "Copy" msgstr "Kopyala" #: lazarusidestrconsts.srkmeccopyadd msgid "Copy (Add to Clipboard)" msgstr "Kopyala (panoya kopyala)" #: lazarusidestrconsts.srkmeccopyaddcurrentline msgid "Copy current line (Add to Clipboard)" msgstr "Şimdiki satırı kopyala (panoya kopyala)" #: lazarusidestrconsts.srkmeccopycurrentline msgid "Copy current line" msgstr "Şimdiki satırı kopyala" #: lazarusidestrconsts.srkmeccopyeditornewwindow msgid "Copy editor to new window" msgstr "Editörü yeni pencereye kopyala" #: lazarusidestrconsts.srkmeccopyeditornextwindow msgid "Copy editor to next free window" msgstr "Düzenleyiciyi sonraki boş pencereye kopyala" #: lazarusidestrconsts.srkmeccopyeditorprevwindow msgid "Copy editor to prior free window" msgstr "Düzenleyiciyi önceki boş pencereye kopyala" #: lazarusidestrconsts.srkmeccut msgctxt "lazarusidestrconsts.srkmeccut" msgid "Cut" msgstr "Kes" #: lazarusidestrconsts.srkmeccutadd msgid "Cut (Add to Clipboard)" msgstr "Kes (Panoya ekle)" #: lazarusidestrconsts.srkmeccutaddcurrentline msgid "Cut current line (Add to Clipboard)" msgstr "Şimdiki satırı kes (panoya kopyala)" #: lazarusidestrconsts.srkmeccutcurrentline msgid "Cut current line" msgstr "Şimdiki satırı kes" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" msgstr "Satırın başına kadar sil" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" msgstr "İmleçteki karakteri sil" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" msgstr "Satırın sonuna kadar sil" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" msgstr "Son Karakteri Sil" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" msgstr "Sözcüğün başlangıcına sil" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" msgstr "Geçerli satırı sil" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" msgstr "Sözcüğün sonuna kadar sil" #: lazarusidestrconsts.srkmecdetach msgid "Detach from program" msgstr "Programdan kopma" #: lazarusidestrconsts.srkmecdiff msgid "Diff" msgstr "Diff" #: lazarusidestrconsts.srkmecdown msgid "Move cursor down" msgstr "İmleci aşağıya taşı" #: lazarusidestrconsts.srkmecduplicateline msgid "Duplicate line (or lines in selection)" msgstr "Yinelenen satır (veya seçimdeki satırlar)" #: lazarusidestrconsts.srkmecduplicateselection msgid "Duplicate selection" msgstr "Seçimi çoğalt" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "İmleci mutlak sonuna getir" #: lazarusidestrconsts.srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "İmleci mutlak başlangıca getir" #: lazarusidestrconsts.srkmecemptymethods msgid "Empty Methods ..." msgstr "Boş Yöntemler ..." #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" msgstr "IDE seçenekleri" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" msgstr "değiştir/ değerlendir" #: lazarusidestrconsts.srkmecextractproc msgctxt "lazarusidestrconsts.srkmecextractproc" msgid "Extract Procedure" msgstr "Prosedürü çıkart" #: lazarusidestrconsts.srkmecexttool #, object-pascal-format msgid "External tool %d" msgstr "Dış araç %d" #: lazarusidestrconsts.srkmecexttoolsettings msgid "External tools settings" msgstr "Harici araçlar ayarları" #: lazarusidestrconsts.srkmecfind msgid "Find Text" msgstr "Metni Bul" #: lazarusidestrconsts.srkmecfindblockotherend msgid "Find block other end" msgstr "Blok diğer ucunu bul" #: lazarusidestrconsts.srkmecfindblockstart msgid "Find block start" msgstr "Blok başlangıcını bul" #: lazarusidestrconsts.srkmecfinddeclaration msgid "Find Declaration" msgstr "Bildirimi Bul" #: lazarusidestrconsts.srkmecfindidentifierrefs msgid "Find Identifier References" msgstr "Tanımlayıcı Referanslarını Bul" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in Files" msgstr "Dosyalarda Bul" #: lazarusidestrconsts.srkmecfindnext msgid "Find Next" msgstr "Sonrakini Bul" #: lazarusidestrconsts.srkmecfindnextwordoccurrence msgid "Find Next Word Occurrence" msgstr "Sonraki kelime oluşumunu bul" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find Overloads" msgstr "Aşırı yük bul" #: lazarusidestrconsts.srkmecfindoverloadscapt msgid "Find Overloads ..." msgstr "Aşırı Yük Bulun ..." #: lazarusidestrconsts.srkmecfindprevious msgid "Find Previous" msgstr "Önceki Bul" #: lazarusidestrconsts.srkmecfindprevwordoccurrence msgid "Find Previous Word Occurrence" msgstr "Önceki kelime oluşumunu bul" #: lazarusidestrconsts.srkmecfindproceduredefinition msgid "Find Procedure Definiton" msgstr "Prosedür Tanımını Bul" #: lazarusidestrconsts.srkmecfindproceduremethod msgid "Find Procedure Method" msgstr "Prosedür Yöntemi Bul" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" msgstr "İmlece Katla" #: lazarusidestrconsts.srkmecfoldlevel #, object-pascal-format msgid "Fold to Level %d" msgstr "Katlama seviyesi %d" #: lazarusidestrconsts.srkmecgotoeditor #, object-pascal-format msgid "Go to editor %d" msgstr "Editöre git %d" #: lazarusidestrconsts.srkmecgotoincludedirective msgid "Go to include directive of current include file" msgstr "Geçerli dosya dahil etme direktifini eklemek için gidin" #: lazarusidestrconsts.srkmecgotolinenumber msgid "Go to Line Number" msgstr "Satır Numarasına Git" #: lazarusidestrconsts.srkmecgotomarker #, object-pascal-format msgid "Go to bookmark %d" msgstr "İşaretleyiciye git %d" #: lazarusidestrconsts.srkmecgotoxy msgid "Goto XY" msgstr "XY ye git" #: lazarusidestrconsts.srkmecguessmisplacedifdef msgid "Guess Misplaced $IFDEF" msgstr "Sanırım Yanlış Yerleştirilmiş $IFDEF" #: lazarusidestrconsts.srkmechalfwordleft msgid "Move cursor part-word left (e.g. CamelCase)" msgstr "İmleci kısmi-sola hareket ettir (örneğin CamelCase)" #: lazarusidestrconsts.srkmechalfwordright msgid "Move cursor part-word right (e.g. CamelCase)" msgstr "İmleci kısmi-sağa hareket ettir (örneğin CamelCase)" #: lazarusidestrconsts.srkmecimestr msgid "Ime Str" msgstr "Ime Str" #: lazarusidestrconsts.srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "ChangeLog girişini ekle" #: lazarusidestrconsts.srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "Karakter Haritasından Ekle" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "CVS anahtar kelime Yazarını Ekle" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "CVS anahtar kelimesini tarih ekle" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "CVS anahtar kelime Üstbilgisini Ekle" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "CVS anahtar kelime kimliğini ekle" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "CVS anahtar kelime Günlüğü ekle" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "CVS anahtar kelime Adını ekle" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "CVS anahtar kelime Revizyon ekle" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "CVS anahtar kelime Kaynağı Ekle" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" msgstr "Geçerli tarih ve saati ekle" #: lazarusidestrconsts.srkmecinsertfilename msgid "Insert Full Filename" msgstr "Tam Dosya Adı Girin" #: lazarusidestrconsts.srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "GPL bildirimini ekle" #: lazarusidestrconsts.srkmecinsertgplnoticetranslated msgid "Insert GPL notice (translated)" msgstr "GPL bildirimini ekle (çevrilmiş)" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" msgstr "Bir GUID ekle" #: lazarusidestrconsts.srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "LGPL bildirimini ekleyin" #: lazarusidestrconsts.srkmecinsertlgplnoticetranlated msgid "Insert LGPL notice (translated)" msgstr "LGPL bildirimini ekleyin (tercüme edildi)" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" msgstr "Satır sonu, imleci bırak" #: lazarusidestrconsts.srkmecinsertmitnotice msgid "Insert MIT notice" msgstr "MIT bildirimi ekle" #: lazarusidestrconsts.srkmecinsertmitnoticetranslated msgid "Insert MIT notice (translated)" msgstr "MIT bildirimi ekle (çevrilmiş)" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" msgstr "Mod ekle" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "Değiştirilmiş LGPL bildirimini ekle" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated msgid "Insert modified LGPL notice (translated)" msgstr "Değiştirilmiş LGPL bildirimini ekle (çevrilmiş)" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" msgstr "Mevcut kullanıcı adını ekle" #: lazarusidestrconsts.srkmecinspect msgid "inspect" msgstr "denetle" #: lazarusidestrconsts.srkmecinvertassignment msgctxt "lazarusidestrconsts.srkmecinvertassignment" msgid "Invert Assignment" msgstr "Atamayı Ters Çevir" #: lazarusidestrconsts.srkmeckeymapleft msgctxt "lazarusidestrconsts.srkmeckeymapleft" msgid "Left" msgstr "Sol" #: lazarusidestrconsts.srkmeckeymapright msgctxt "lazarusidestrconsts.srkmeckeymapright" msgid "Right" msgstr "Sağ" #: lazarusidestrconsts.srkmecleft msgid "Move cursor left" msgstr "İmleci sola taşı" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" msgstr "Satır sonu ve imleci hareket ettir" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" msgstr "İmleci satır sonuna taşı" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" msgstr "Hat seçme modu" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" msgstr "İmleci satır başlangıcına taşı" #: lazarusidestrconsts.srkmeclinetextstart msgid "Move cursor to text start in line" msgstr "İmleci, satırdaki metnin başlangıcına taşı" #: lazarusidestrconsts.srkmeclockeditor msgid "Lock Editor" msgstr "Editörü Kilitle" #: lazarusidestrconsts.srkmecmakeresourcestring msgid "Make Resource String" msgstr "Kaynak Stringi Oluşturun" #: lazarusidestrconsts.srkmecmatchbracket msgid "Go to matching bracket" msgstr "Eşleşen ayraça git" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" msgstr "Editörü sola taşı" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "Editörü en sola kaydır" #: lazarusidestrconsts.srkmecmoveeditornewwindow msgid "Move editor to new window" msgstr "Editörü yeni pencereye taşı" #: lazarusidestrconsts.srkmecmoveeditornextwindow msgid "Move editor to next free window" msgstr "Editörü bir sonraki boş pencereye taşı" #: lazarusidestrconsts.srkmecmoveeditorprevwindow msgid "Move editor to prior free window" msgstr "Editörü önce boş pencereye taşı" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" msgstr "Editörü sağa taşı" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "Editörün en sağına git" #: lazarusidestrconsts.srkmecmovelinedown msgid "Move line down" msgstr "Satırı aşağı taşı" #: lazarusidestrconsts.srkmecmovelineup msgid "Move line up" msgstr "Satırı yukarı taşı" #: lazarusidestrconsts.srkmecmoveselectdown msgid "Move selection down" msgstr "Seçileni aşağı taşı" #: lazarusidestrconsts.srkmecmoveselectleft msgid "Move selection left" msgstr "Seçileni sola taşı" #: lazarusidestrconsts.srkmecmoveselectright msgid "Move selection right" msgstr "Seçileni sağa taşı" #: lazarusidestrconsts.srkmecmoveselectup msgid "Move selection up" msgstr "Seçileni yukarı taşı" #: lazarusidestrconsts.srkmecmultipaste msgctxt "lazarusidestrconsts.srkmecmultipaste" msgid "MultiPaste" msgstr "Çoklu Yapıştır" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" msgstr "Sonraki Yer İşareti" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" msgstr "Sonraki editöre git" #: lazarusidestrconsts.srkmecnexteditorinhistory msgid "Go to next editor in history" msgstr "Geçmişteki bir sonraki editöre geç" #: lazarusidestrconsts.srkmecnextsharededitor msgid "Go to next editor with same Source" msgstr "Aynı Kaynakta Sonraki Düzenleyiciye Git" #: lazarusidestrconsts.srkmecnextwindow msgid "Go to next window" msgstr "Bir sonraki pencereye git" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" msgstr "Normal seçim modu" #: lazarusidestrconsts.srkmecopenfileatcursor msgid "Open File at Cursor" msgstr "İmleçte Dosyayı Aç" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" msgstr "Üzerine Yazma Modu" #: lazarusidestrconsts.srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "İmleci sayfanın altına getir" #: lazarusidestrconsts.srkmecpagedown msgid "Move cursor down one page" msgstr "İmleci bir sayfa aşağıya taşı" #: lazarusidestrconsts.srkmecpageleft msgid "Move cursor left one page" msgstr "İmleci bir sayfa sola taşı" #: lazarusidestrconsts.srkmecpageright msgid "Move cursor right one page" msgstr "İmleci bir sayfa sağa taşı" #: lazarusidestrconsts.srkmecpagetop msgid "Move cursor to top of page" msgstr "İmleci sayfanın üstüne getir" #: lazarusidestrconsts.srkmecpageup msgid "Move cursor up one page" msgstr "İmleci bir sayfa yukarı taşı" #: lazarusidestrconsts.srkmecpaste msgctxt "lazarusidestrconsts.srkmecpaste" msgid "Paste" msgstr "Yapıştır" #: lazarusidestrconsts.srkmecpasteascolumns msgid "Paste (as Columns)" msgstr "Yapıştır (Sütun olarak)" #: lazarusidestrconsts.srkmecpause msgid "pause program" msgstr "programı duraklat" #: lazarusidestrconsts.srkmecpluginmulticaretclearall msgid "Clear all extra carets" msgstr "Tüm ekstra imleçleri temizle" #: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove msgid "Cursor keys clear all extra carets" msgstr "İmleç tuşları tüm ekstra imleçleri temizler" #: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall msgid "Cursor keys move all extra carets" msgstr "İmleç tuşları tüm ekstra imleçlere taşır" #: lazarusidestrconsts.srkmecpluginmulticaretsetcaret msgid "Add extra caret" msgstr "Ekstra imleç ekle" #: lazarusidestrconsts.srkmecpluginmulticarettogglecaret msgid "Toggle extra caret" msgstr "Ekstra imleç arasında geçiş yap" #: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret msgid "Remove extra caret" msgstr "Ekstra imleci kaldır" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" msgstr "Önceki Yer İşareti" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" msgstr "Önceki düzenleyiciye git" #: lazarusidestrconsts.srkmecpreveditorinhistory msgid "Go to previous editor in history" msgstr "Geçmişte önceki editöre git" #: lazarusidestrconsts.srkmecprevsharededitor msgid "Go to prior editor with same Source" msgstr "Aynı Kaynaktan Önceki Düzenleyiciye Git" #: lazarusidestrconsts.srkmecprevwindow msgid "Go to prior window" msgstr "Önceki pencereye git" #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" msgstr "hızlı derle, bağlantı yok" #: lazarusidestrconsts.srkmecremovebreakpoint msgid "remove breakpoint" msgstr "kesme noktasını kaldır" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove Empty Methods" msgstr "Boş Metodları Kaldır" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove Unused Units" msgstr "Kullanılmayan Birimleri (unitleri) Kaldır" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename Identifier" msgstr "Tanımlayıcıyı Yeniden Adlandır" #: lazarusidestrconsts.srkmecreplace msgid "Replace Text" msgstr "Metni Değiştir" #: lazarusidestrconsts.srkmecreportingbug msgid "Reporting a bug" msgstr "Bir hatayı bildir" #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" msgstr "hata ayıklayıcıyı sıfırlayın" #: lazarusidestrconsts.srkmecright msgid "Move cursor right" msgstr "İmleci sağa taşı" #: lazarusidestrconsts.srkmecrun msgid "run program" msgstr "programı çalıştır" #: lazarusidestrconsts.srkmecrunfile msgid "run file" msgstr "dosya çalıştır" #: lazarusidestrconsts.srkmecrunparameters msgid "run parameters" msgstr "parametreleri çalıştır" #: lazarusidestrconsts.srkmecrunwithdebugging msgid "run with debugging" msgstr "hata ayıklama ile çalıştır" #: lazarusidestrconsts.srkmecrunwithoutdebugging msgid "run without debugging" msgstr "hata ayıklamasız çalıştır" #: lazarusidestrconsts.srkmecscrolldown msgid "Scroll down one line" msgstr "Bir satır aşağı kaydır" #: lazarusidestrconsts.srkmecscrollleft msgid "Scroll left one char" msgstr "Sola kaydır" #: lazarusidestrconsts.srkmecscrollright msgid "Scroll right one char" msgstr "Sağa kaydır" #: lazarusidestrconsts.srkmecscrollup msgid "Scroll up one line" msgstr "Bir satır yukarı kaydır" #: lazarusidestrconsts.srkmecseldown msgid "Select Down" msgstr "Aşağı Seç" #: lazarusidestrconsts.srkmecselectall msgctxt "lazarusidestrconsts.srkmecselectall" msgid "Select All" msgstr "Hepsini seç" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Sekmeleri seçimdeki boşluklara dönüştür" #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" msgstr "Mutlak son için seç" #: lazarusidestrconsts.srkmecseleditortop msgid "Select to absolute beginning" msgstr "Mutlak başlangıç için seç" #: lazarusidestrconsts.srkmecselgotoxy msgid "Select Goto XY" msgstr "Seçili XY ye git" #: lazarusidestrconsts.srkmecselhalfwordleft msgid "Select part-word left (e.g. CamelCase)" msgstr "Parça sözcüğü soldan seçin (örneğin CamelCase)" #: lazarusidestrconsts.srkmecselhalfwordright msgid "Select part-word right (e.g. CamelCase)" msgstr "Parça sözcüğü sağdan seçin (örneğin CamelCase)" #: lazarusidestrconsts.srkmecselleft msgid "Select Left" msgstr "Sol Seç" #: lazarusidestrconsts.srkmecsellineend msgctxt "lazarusidestrconsts.srkmecsellineend" msgid "Select Line End" msgstr "Satır Sonunu Seç" #: lazarusidestrconsts.srkmecsellinestart msgctxt "lazarusidestrconsts.srkmecsellinestart" msgid "Select Line Start" msgstr "Satır Başını Seç" #: lazarusidestrconsts.srkmecsellinetextstart msgid "Select to text start in line" msgstr "Satırda metne başlamak için seçin" #: lazarusidestrconsts.srkmecselpagebottom msgctxt "lazarusidestrconsts.srkmecselpagebottom" msgid "Select Page Bottom" msgstr "Sayfa Altını Seç" #: lazarusidestrconsts.srkmecselpagedown msgid "Select Page Down" msgstr "Sayfa Sonu Seç" #: lazarusidestrconsts.srkmecselpageleft msgid "Select Page Left" msgstr "Sayfa Solunu Seç" #: lazarusidestrconsts.srkmecselpageright msgid "Select Page Right" msgstr "Sayfayı Sağını Seç" #: lazarusidestrconsts.srkmecselpagetop msgctxt "lazarusidestrconsts.srkmecselpagetop" msgid "Select Page Top" msgstr "Sayfa Üstünü Seç" #: lazarusidestrconsts.srkmecselpageup msgid "Select Page Up" msgstr "Sayfa Başı Seç" #: lazarusidestrconsts.srkmecselright msgid "Select Right" msgstr "Sağ Seç" #: lazarusidestrconsts.srkmecselsmartwordleft msgid "Smart select word left (start/end of word)" msgstr "Akıllı kelime seç sol (kelimenin başlangıcı / bitişi)" #: lazarusidestrconsts.srkmecselsmartwordright msgid "Smart select word right (start/end of word)" msgstr "Akıllı kelime seç sağ (kelimenin başlangıcı / bitişi)" #: lazarusidestrconsts.srkmecselsticky msgid "Start sticky selecting" msgstr "Yapışkan seçimi başlat" #: lazarusidestrconsts.srkmecselstickycol msgid "Start sticky selecting (Columns)" msgstr "Yapışkan seçimi başlat (Sütunlar)" #: lazarusidestrconsts.srkmecselstickyline msgid "Start sticky selecting (Line)" msgstr "Yapışkan seçimi başlat (Hat)" #: lazarusidestrconsts.srkmecselstickystop msgid "Stop sticky selecting" msgstr "Yapışkan seçimi durdur" #: lazarusidestrconsts.srkmecselup msgid "Select Up" msgstr "Yukarı Seç" #: lazarusidestrconsts.srkmecselwordendleft msgid "Select word-end left" msgstr "Sözcük sonu solu seç" #: lazarusidestrconsts.srkmecselwordendright msgid "Select word-end right" msgstr "Sözcük sonu sağı seç" #: lazarusidestrconsts.srkmecselwordleft msgctxt "lazarusidestrconsts.srkmecselwordleft" msgid "Select Word Left" msgstr "Soldan Sözcük Seçin" #: lazarusidestrconsts.srkmecselwordright msgctxt "lazarusidestrconsts.srkmecselwordright" msgid "Select Word Right" msgstr "Sağdan Sözcük Seçin" #: lazarusidestrconsts.srkmecsetfreebookmark msgid "Set a free Bookmark" msgstr "Serbest bir Yer İşareti ayarla" #: lazarusidestrconsts.srkmecsetmarker #, object-pascal-format msgid "Set bookmark %d" msgstr "İşaretçi %d 'yi ayarla" #: lazarusidestrconsts.srkmecshifttab msgid "Shift Tab" msgstr "Shift Sekmesi" #: lazarusidestrconsts.srkmecshowabstractmethods msgid "Show Abstract Methods" msgstr "Soyut Metotları Göster" #: lazarusidestrconsts.srkmecshowcodecontext msgid "Show Code Context" msgstr "Kod Bağlamını Göster" #: lazarusidestrconsts.srkmecshowexecutionpoint msgid "show execution point" msgstr "yürütme noktasını göster" #: lazarusidestrconsts.srkmecsmartwordleft msgid "Smart move cursor left (start/end of word)" msgstr "Akıllı hareket imleci sola (kelimenin başlangıcı / bitişi)" #: lazarusidestrconsts.srkmecsmartwordright msgid "Smart move cursor right (start/end of word)" msgstr "Akıllı imleci sağa hareket ettirin (kelimenin başlangıcı / bitişi)" #: lazarusidestrconsts.srkmecstopprogram msgid "stop program" msgstr "programı durdur" #: lazarusidestrconsts.srkmecsynmacroplay msgid "Play Macro" msgstr "Makro Oynat" #: lazarusidestrconsts.srkmecsynmacrorecord msgid "Record Macro" msgstr "Makro Kaydet" #: lazarusidestrconsts.srkmecsynpsyncroedaddcell msgid "Add Cell" msgstr "Hücre Ekle" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase msgid "Add Cell (case-sensitive)" msgstr "Hücre Ekle (büyük/küçük harfe duyarlı)" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx msgid "Add Cell (context-sensitive)" msgstr "Hücre Ekle (içeriğe duyarlı)" #: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase msgid "Add Cell (context & case-sensitive)" msgstr "Hücre Ekle (bağlam ve büyük/küçük harfe duyarlı)" #: lazarusidestrconsts.srkmecsynpsyncroedcellend msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" msgid "Goto last pos in cell" msgstr "Hücrenin son konumuna git" #: lazarusidestrconsts.srkmecsynpsyncroedcellhome msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" msgid "Goto first pos in cell" msgstr "Hücrenin ilk konumuna git" #: lazarusidestrconsts.srkmecsynpsyncroedcellselect msgid "Select Cell" msgstr "Hücreyi seçin" #: lazarusidestrconsts.srkmecsynpsyncroeddelcell msgid "Remove current Cell" msgstr "Geçerli Hücreyi Kaldır" #: lazarusidestrconsts.srkmecsynpsyncroedescape msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" msgid "Escape" msgstr "Kaçış" #: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft msgid "Grow cell on the left" msgstr "Soldaki hücreyi büyütün" #: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright msgid "Grow cell on the right" msgstr "Sağdaki hücreyi büyütün" #: lazarusidestrconsts.srkmecsynpsyncroednextcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" msgid "Next Cell" msgstr "Bir Sonraki Hücre" #: lazarusidestrconsts.srkmecsynpsyncroednextcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" msgid "Next Cell (all selected)" msgstr "Sonraki Hücre (tüm seçilenler)" #: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell" msgid "Next Cell (firsts only)" msgstr "Sonraki Hücre (yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel" msgid "Next Cell (all selected / firsts only)" msgstr "Sonraki Hücre (tüm seçilenler / yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynpsyncroedprevcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" msgid "Previous Cell" msgstr "Önceki Hücre" #: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" msgid "Previous Cell (all selected)" msgstr "Önceki Hücre (tüm seçilenler)" #: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell" msgid "Previous Cell (firsts only)" msgstr "Önceki Hücre (yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel" msgid "Previous Cell (all selected / firsts only)" msgstr "Önceki Hücre (tüm seçilenler / sadece ilkler)" #: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft msgid "Shrink cell on the left" msgstr "Soldaki hücreyi küçültün" #: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright msgid "Shrink cell on the right" msgstr "Sağdaki hücreyi küçültün" #: lazarusidestrconsts.srkmecsynpsyncroedstart msgid "Start Syncro edit" msgstr "Syncro düzenlenmeye başla" #: lazarusidestrconsts.srkmecsynpsyncroedstartcase msgid "Start Syncro edit (case-sensitive)" msgstr "Syncro düzenlemesini başlat (büyük/küçük harfe duyarlı)" #: lazarusidestrconsts.srkmecsynpsyncroedstartctx msgid "Start Syncro edit (context-sensitive)" msgstr "Syncro düzenlemesini başlat (içeriğe duyarlı)" #: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase msgid "Start Syncro edit (context & case-sensitive)" msgstr "Syncro düzenlemesini başlat (bağlam ve büyük/küçük harfe duyarlı)" #: lazarusidestrconsts.srkmecsynptmpledcellend msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" msgid "Goto last pos in cell" msgstr "Hücrenin son konumuna git" #: lazarusidestrconsts.srkmecsynptmpledcellhome msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" msgid "Goto first pos in cell" msgstr "Hücrenin ilk konumuna git" #: lazarusidestrconsts.srkmecsynptmpledcellselect msgid "Select cell" msgstr "Hücreyi seçin" #: lazarusidestrconsts.srkmecsynptmpledescape msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" msgid "Escape" msgstr "Kaçış" #: lazarusidestrconsts.srkmecsynptmpledfinish msgid "Finish" msgstr "Bitiş" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" msgstr "Bir Sonraki Hücre" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" msgstr "Sonraki Hücre (döndür)" #: lazarusidestrconsts.srkmecsynptmplednextcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" msgid "Next Cell (all selected)" msgstr "Sonraki Hücre (tüm seçilenler)" #: lazarusidestrconsts.srkmecsynptmplednextcellselrotate msgid "Next Cell (rotate / all selected)" msgstr "Sonraki Hücre (döndür / tüm seçilenler)" #: lazarusidestrconsts.srkmecsynptmplednextfirstcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell" msgid "Next Cell (firsts only)" msgstr "Sonraki Hücre (yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate msgid "Next Cell (rotate / firsts only)" msgstr "Sonraki Hücre (yalnızca ilk önce döndür / döndür)" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel" msgid "Next Cell (all selected / firsts only)" msgstr "Sonraki Hücre (tüm seçilenler / yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate msgid "Next Cell (rotate / all selected / firsts only)" msgstr "Sonraki Hücre (döndür / tüm seçilenler / sadece ilkler)" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" msgstr "Önceki Hücre" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" msgid "Previous Cell (all selected)" msgstr "Önceki Hücre (tüm seçilenler)" #: lazarusidestrconsts.srkmecsynptmpledprevfirstcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell" msgid "Previous Cell (firsts only)" msgstr "Önceki Hücre (yalnızca ilkler)" #: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel" msgid "Previous Cell (all selected / firsts only)" msgstr "Önceki Hücre (tüm seçilenler / sadece ilkler)" #: lazarusidestrconsts.srkmecsyntaxcheck msgid "Syntax Check" msgstr "Sözdizimi Kontrolü" #: lazarusidestrconsts.srkmectoggleassembler msgid "View assembler" msgstr "Montajcıyı görüntüle" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle breakpoint" msgstr "kesme noktası aç/kapat" #: lazarusidestrconsts.srkmectogglebreakpointenabled msgid "enable/disable breakpoint" msgstr "kesme noktasını etkinleştir/pasifleştir" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" msgstr "Kesme noktalarını görüntüle" #: lazarusidestrconsts.srkmectogglecallstack msgid "View call stack" msgstr "Çağrı yığınını görüntüle" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" msgstr "Kod tarayıcıyı görüntüle" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Kod Gezgini'ni görüntüle" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" msgstr "Bileşen paletini görüntüle" #: lazarusidestrconsts.srkmectoggledebuggerout msgid "View debugger output" msgstr "Hata ayıklayıcı çıktısını görüntüle" #: lazarusidestrconsts.srkmectoggleformunit msgid "Switch between form and unit" msgstr "Form ve birim arasında geçiş" #: lazarusidestrconsts.srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "Belge Düzenleyiciyi Görüntüle" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgid "View IDE speed buttons" msgstr "IDE hızlı düğmelerini görüntüle" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" msgstr "Yerel değişkenleri görüntüle" #: lazarusidestrconsts.srkmectogglemarker #, object-pascal-format msgid "Toggle bookmark %d" msgstr "İşaretçi %d 'yi değiştir" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" msgstr "Geçerli Kelime vurgusunu değiştir" #: lazarusidestrconsts.srkmectogglememviewer msgctxt "lazarusidestrconsts.srkmectogglememviewer" msgid "View Mem viewer" msgstr "" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" msgstr "Mesajları görüntüle" #: lazarusidestrconsts.srkmectogglemode msgid "Toggle Mode" msgstr "Modu aç/kapat" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Nesne Denetçisini Görüntüle" #: lazarusidestrconsts.srkmectoggleregisters msgid "View registers" msgstr "Kayıtları görüntüle" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "Görüntüleme kısıtlama tarayıcısı" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" msgstr "Arama Sonuçlarını Görüntüle" #: lazarusidestrconsts.srkmectogglesourceeditor msgid "View Source Editor" msgstr "Kaynak Düzenleyiciyi Görüntüle" #: lazarusidestrconsts.srkmectogglewatches msgid "View watches" msgstr "Saatleri görüntüle" #: lazarusidestrconsts.srkmecunfoldall msgctxt "lazarusidestrconsts.srkmecunfoldall" msgid "Unfold all" msgstr "Hepsini aç" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" msgstr "İmleçte Aç" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" msgstr "bilinmeyen editör komutu" #: lazarusidestrconsts.srkmecunusedunits msgid "Unused Units ..." msgstr "Kullanılmayan Birimler (Unitler) ..." #: lazarusidestrconsts.srkmecup msgid "Move cursor up" msgstr "İmleci yukarı taşı" #: lazarusidestrconsts.srkmecviewanchoreditor msgid "View anchor editor" msgstr "Çapa editörünü görüntüle" #: lazarusidestrconsts.srkmecviewcomponents msgid "View components" msgstr "Bileşenleri görüntüle" #: lazarusidestrconsts.srkmecvieweditormacros msgid "View editor macros" msgstr "Editör makrolarını görüntüle" #: lazarusidestrconsts.srkmecviewforms msgid "View forms" msgstr "Formları görüntüle" #: lazarusidestrconsts.srkmecviewhistory msgctxt "lazarusidestrconsts.srkmecviewhistory" msgid "View History" msgstr "Geçmişi Görüntüle" #: lazarusidestrconsts.srkmecviewpseudoterminal msgid "View console in/output" msgstr "Terminal Çıkışını Görüntüle" #: lazarusidestrconsts.srkmecviewtaborder msgid "View Tab Order" msgstr "Sekme Sırasını Görüntüle" #: lazarusidestrconsts.srkmecviewthreads msgctxt "lazarusidestrconsts.srkmecviewthreads" msgid "View Threads" msgstr "Konuları Görüntüle" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Birim bağımlılıklarını görüntüle" #: lazarusidestrconsts.srkmecviewunitinfo msgid "View unit information" msgstr "Birim bilgilerini görüntüle" #: lazarusidestrconsts.srkmecviewunits msgid "View units" msgstr "Birimleri görüntüle" #: lazarusidestrconsts.srkmecwordcompletion msgid "Word Completion" msgstr "Kelime Tamamlama" #: lazarusidestrconsts.srkmecwordendleft msgid "Move cursor word-end left" msgstr "İmleci kelime sonu sola taşı" #: lazarusidestrconsts.srkmecwordendright msgid "Move cursor word-end right" msgstr "İmleci kelime sonu sağa taşı" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" msgstr "İmleci kelime soluna taşı" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" msgstr "İmleci kelime sağına taşı" #: lazarusidestrconsts.srkmeczoomin msgid "Zoom in" msgstr "Yakınlaştır" #: lazarusidestrconsts.srkmeczoomout msgid "Zoom out" msgstr "Uzaklaştır" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" msgstr "Komut tuşlarını düzenle" #: lazarusidestrconsts.synfcontinuewithnextmouseupaction msgid "Continue with next mouse up action" msgstr "Bir sonraki fare yukarı hareketle devam et" #: lazarusidestrconsts.synffoldcomments msgid "Fold comments" msgstr "Yorumları katla" #: lazarusidestrconsts.synffoldcommentsinselection msgid "Fold comments in selection" msgstr "Seçimdeki yorumları katla" #: lazarusidestrconsts.synffoldinactiveifdef msgid "Fold inactive Ifdef" msgstr "Pasif Ifdef katla" #: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate msgid "Fold inactive Ifdef (exclude mixed state)" msgstr "Pasif Ifdef'i katla(karma durumu hariç)" #: lazarusidestrconsts.synffoldinactiveifdefinselection msgid "Fold inactive Ifdef in selection" msgstr "Seçilen pasif ifdef'i katla" #: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate msgid "Fold inactive Ifdef in selection (exclude mixed state)" msgstr "Seçilen pasif ifdef'i katla (karma durum hariç)" #: lazarusidestrconsts.synfhidecomments msgid "Hide comments" msgstr "Yorumları gizle" #: lazarusidestrconsts.synfhidecommentsinselection msgid "Hide comments in selection" msgstr "Seçilen yorumları gizle" #: lazarusidestrconsts.synfmatchactionbuttonofmousedown msgid "Match action button of mouse down" msgstr "Fareyle eşleşen eylem düğmesi aşağı" #: lazarusidestrconsts.synfmatchactionlineofmousedown msgid "Match action line of mouse down" msgstr "Fare hareket çizgisini aşağıya ile eşleştir" #: lazarusidestrconsts.synfmatchactionmodifiersofmousedown msgid "Match action modifiers of mouse down" msgstr "Fareyle aşağı hareket eylemi değiştiricileri" #: lazarusidestrconsts.synfmatchactionposofmousedown msgid "Match action pos of mouse down" msgstr "Farenin hareket pos'unu aşağıya ile eşleştir" #: lazarusidestrconsts.synfsearchallactionofmousedown msgid "Search all action of mouse down" msgstr "Farenin tüm hareketlerini aşağıya doğru ara" #: lazarusidestrconsts.synfunfoldactiveifdef msgid "Unfold active Ifdef" msgstr "Etkin Ifdef'i aç" #: lazarusidestrconsts.synfunfoldactiveifdefinselection msgid "Unfold active Ifdef in selection" msgstr "Seçimdeki etkin Ifdef'i aç" #: lazarusidestrconsts.synfunfoldall msgctxt "lazarusidestrconsts.synfunfoldall" msgid "Unfold all" msgstr "Hepsini aç" #: lazarusidestrconsts.synfunfoldallifdef msgid "Unfold all Ifdef" msgstr "Tüm Ifdef'leri aç" #: lazarusidestrconsts.synfunfoldallifdefinselection msgid "Unfold all Ifdef in selection" msgstr "Seçilen tüm Ifdef'i aç" #: lazarusidestrconsts.synfunfoldallinselection msgid "Unfold all in selection" msgstr "Seçilenin tümünü aç" #: lazarusidestrconsts.synfunfoldcomments msgid "Unfold comments" msgstr "Yorumları açın" #: lazarusidestrconsts.synfunfoldcommentsinselection msgid "Unfold comments in selection" msgstr "Seçilen yorumları aç" #: lazarusidestrconsts.synfunfoldinactiveifdef msgid "Unfold inactive Ifdef" msgstr "Etkin olmayan Ifdef'i açın" #: lazarusidestrconsts.synfunfoldinactiveifdefinselection msgid "Unfold inactive Ifdef in selection" msgstr "Seçimdeki etkin olmayan Ifdef'i açın" #: lazarusidestrconsts.uefilerocap msgid "File is readonly" msgstr "Dosya salt okunur" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" msgstr "Dosya \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." msgstr "\" yazılabilir değil." #: lazarusidestrconsts.uelocked msgid "Locked" msgstr "Kilitli" #: lazarusidestrconsts.uemacrorecording msgid "Recording" msgstr "Kayıt" #: lazarusidestrconsts.uemacrorecordingpaused msgid "Rec-pause" msgstr "Kayıt-duraklat" #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "İmleç Ekleme ve İzleme" #: lazarusidestrconsts.uemaddwatchpointatcursor msgid "Add Watch&Point At Cursor" msgstr "İmleçte İzle ve Nokta Ekle" #: lazarusidestrconsts.uembookmarknset #, object-pascal-format msgid "Bookmark &%s: %s" msgstr "Yer imi &%s: %s" #: lazarusidestrconsts.uembookmarknunset #, object-pascal-format msgid "Bookmark &%s" msgstr "Yer imi &%s" #: lazarusidestrconsts.uembookmarknunsetdisabled #, object-pascal-format msgid "Bookmark %s" msgstr "Yer imi %s" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" msgstr "&Diğer tüm sayfaları kapat" #: lazarusidestrconsts.uemcloseotherpagesplain msgid "Close All Other Pages" msgstr "Tüm D&iğer Sayfaları Kapat" #: lazarusidestrconsts.uemcloseotherpagesright msgid "Close Pages on the &Right" msgstr "&Sağdaki sayfaları kapat" #: lazarusidestrconsts.uemcloseotherpagesrightplain msgid "Close Pages on the Right" msgstr "Sağdaki sayfaları kapat" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" msgstr "&Sayfayı kapat" #: lazarusidestrconsts.uemcopyfilename msgid "Copy Filename" msgstr "Dosya Adını Kopyala" #: lazarusidestrconsts.uemcopytonewwindow msgid "Clone to New Window" msgstr "Yeni Pencereye Klonla" #: lazarusidestrconsts.uemcopytootherwindow msgid "Clone to Other Window" msgstr "Diğer Pencereye Klonla" #: lazarusidestrconsts.uemcopytootherwindownew msgctxt "lazarusidestrconsts.uemcopytootherwindownew" msgid "New Window" msgstr "Yeni Pencere" #: lazarusidestrconsts.uemdebugword msgctxt "lazarusidestrconsts.uemdebugword" msgid "Debug" msgstr "Hata ayıklama" #: lazarusidestrconsts.uemencoding msgid "Encoding" msgstr "Kodlama" #: lazarusidestrconsts.uemevaluatemodify msgid "&Evaluate/Modify ..." msgstr "&Değerlendir/Değiştir ..." #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" msgstr "&Deklarasyon Bul" #: lazarusidestrconsts.uemfindinotherwindow msgid "Find in other Window" msgstr "Diğer Pencerede Bul" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" msgstr "& Yer İmine Git" #: lazarusidestrconsts.uemgotobookmarks msgid "Goto Bookmark ..." msgstr "&Yer İmine Git." #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" msgstr "İşaretleyici" #: lazarusidestrconsts.ueminspect msgctxt "lazarusidestrconsts.ueminspect" msgid "&Inspect ..." msgstr "&Denetle..." #: lazarusidestrconsts.ueminvertassignment msgctxt "lazarusidestrconsts.ueminvertassignment" msgid "Invert Assignment" msgstr "Atamayı Ters Çevir" #: lazarusidestrconsts.uemlineending msgid "Line Ending" msgstr "Satır Sonu" #: lazarusidestrconsts.uemlockpage msgid "&Lock Page" msgstr "&Sayfayı kilitle" #: lazarusidestrconsts.uemmovepageleft msgid "Move Page Left" msgstr "Sayfa Sola Taşı" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move Page Leftmost" msgstr "Sayfa En Sola Taşı" #: lazarusidestrconsts.uemmovepageright msgid "Move Page Right" msgstr "Sayfayı sağa Taşı" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move Page Rightmost" msgstr "Sayfayı en sağa taşı" #: lazarusidestrconsts.uemmovetonewwindow msgid "Move to New Window" msgstr "Yeni Pencereye Taşı" #: lazarusidestrconsts.uemmovetootherwindow msgid "Move to Other Window" msgstr "Diğer Pencereye Taşı" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" msgid "New Window" msgstr "Yeni Pencere" #: lazarusidestrconsts.uemnextbookmark msgid "Goto Next Bookmark" msgstr "Sonraki Yer imine git" #: lazarusidestrconsts.uemodified msgid "Modified" msgstr "Değiştirilmiş" #: lazarusidestrconsts.uemopenfileatcursor msgid "&Open File at Cursor" msgstr "&İmleç Dosyasını Aç" #: lazarusidestrconsts.uemprevbookmark msgid "Goto Previous Bookmark" msgstr "Önceki yer imine Git" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" msgstr "Prosedüre Atla" #: lazarusidestrconsts.uemreadonly msgctxt "lazarusidestrconsts.uemreadonly" msgid "Read Only" msgstr "Salt okunur" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" msgstr "Yeniden düzenle" #: lazarusidestrconsts.uemsetfreebookmark msgctxt "lazarusidestrconsts.uemsetfreebookmark" msgid "Set a Free Bookmark" msgstr "Serbest Yer İşareti Oluşturun" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" msgstr "Satır Numaralarını Göster" #: lazarusidestrconsts.uemsource msgctxt "lazarusidestrconsts.uemsource" msgid "Source" msgstr "Kaynak" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" msgstr "&Yer imini değiştir" #: lazarusidestrconsts.uemtogglebookmarknset #, object-pascal-format msgid "Toggle Bookmark &%s: %s" msgstr "Yer imini değiştir &%s: %s" #: lazarusidestrconsts.uemtogglebookmarknunset #, object-pascal-format msgid "Toggle Bookmark &%s" msgstr "Yer imini değiştir &%s" #: lazarusidestrconsts.uemtogglebookmarks msgid "Toggle Bookmark ..." msgstr "Yer imini değiştir." #: lazarusidestrconsts.uemtogglebreakpoint msgid "Toggle &Breakpoint" msgstr "Kesme &noktası değiştir" #: lazarusidestrconsts.uemviewcallstack msgctxt "lazarusidestrconsts.uemviewcallstack" msgid "View Call Stack" msgstr "Çağrı Yığını Göster" #: lazarusidestrconsts.uenotimplcap msgid "Not implemented yet" msgstr "Henüz uygulanmadı" #: lazarusidestrconsts.uepins msgid "INS" msgstr "INS" #: lazarusidestrconsts.uepovr msgid "OVR" msgstr "OVR" #: lazarusidestrconsts.uepreadonly msgid "Readonly" msgstr "Salt Okunur" #: lazarusidestrconsts.uepselchars #, object-pascal-format msgid "%d" msgstr "" #: lazarusidestrconsts.uepselcol msgid "COL" msgstr "" #: lazarusidestrconsts.uepselcxchars #, object-pascal-format msgid "%d * %d" msgstr "" #: lazarusidestrconsts.uepselline #, fuzzy #| msgid "Line" msgctxt "lazarusidestrconsts.uepselline" msgid "LINE" msgstr "Satır" #: lazarusidestrconsts.uepselnorm msgid "DEF" msgstr "" #: lazarusidestrconsts.unitdepoptionsforpackage msgid "Options for Package graph" msgstr "Paket grafiği için seçenekler" #: lazarusidestrconsts.unitdepoptionsforunit msgid "Options for Unit graph" msgstr "Birim grafiği için seçenekler" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" msgstr "Versiyon bilgisi"