msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: 2006-11-03 19:03+0100\n" "Last-Translator: J.Salvador Pérez \n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts.dlfmouseresetall msgid "Reset all settings" msgstr "" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" msgstr "" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" msgstr "" #: lazarusidestrconsts.dlfmousesimplediff msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" msgstr "" #: lazarusidestrconsts.dlfmousesimplegenericsect msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" msgid "General" msgstr "General" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on Mouse down" msgstr "" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move" msgstr "" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlfmousesimplerightmovecaret msgid "Right mouse includes caret move" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsect msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlfmousesimpletextsectalt msgid "Alt-Key sets column mode" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel msgid "Ctrl Left Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump" msgid "jumps to implementation" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock msgid "jumps to implementation/other block end" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone" msgid "nothing" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline msgid "Double Click selects line" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectdrag msgid "Drag Selection (copy/paste)" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidgoto msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto" msgid "jumps to implementation" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidlabel msgid "Middle Button" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone" msgid "nothing" msgstr "" #: lazarusidestrconsts.dlfmousesimpletextsectmidpaste msgid "paste selection" msgstr "" #: lazarusidestrconsts.dlfmousesimplewarning msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" msgstr "" #: lazarusidestrconsts.dlfreadonlycolor msgctxt "lazarusidestrconsts.dlfreadonlycolor" msgid "Read Only" msgstr "Només lectura" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" msgstr "Minúscules, primera lletra Maj." #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "" #: lazarusidestrconsts.dlgaddhiattrbracketmatch msgid "Brackets highlight" msgstr "" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtree msgid "Code folding tree" msgstr "" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint msgid "Enabled breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrerrorline msgid "Error line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrexecutionpoint msgid "Execution point" msgstr "" #: lazarusidestrconsts.dlgaddhiattrfoldedcode msgid "Folded code marker" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupgutter msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgroupline msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" msgid "Line" msgstr "Línia" #: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit msgid "Syncron Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlgaddhiattrgutterseparator msgid "Gutter Separator" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightall msgid "Incremental others" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightword msgid "Highlight current word" msgstr "" #: lazarusidestrconsts.dlgaddhiattrincrementalsearch msgid "Incremental search" msgstr "" #: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint msgid "Invalid breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrlinehighlight msgid "Current line highlight" msgstr "" #: lazarusidestrconsts.dlgaddhiattrlinenumber msgid "Line number" msgstr "" #: lazarusidestrconsts.dlgaddhiattrmodifiedline msgid "Modified line" msgstr "" #: lazarusidestrconsts.dlgaddhiattrmouselink msgid "Mouse link" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditarea msgid "Selected Area" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" msgid "Active Cell" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditother msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" msgid "Other Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrsyncroeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" msgid "Syncronized Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" msgid "Active Cell" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditother msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" msgid "Other Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtemplateeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" msgid "Syncronized Cells" msgstr "" #: lazarusidestrconsts.dlgaddhiattrtextblock msgid "Text block" msgstr "" #: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint msgid "Unknown breakpoint" msgstr "" #: lazarusidestrconsts.dlgaddhiattrwordgroup msgid "Word-Brackets" msgstr "" #: lazarusidestrconsts.dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" msgstr "Trajectòria del codi font addicional de tots el projectes (.pp;.pas)" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" msgstr "Afegeix punt i coma" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Ajusta la línia de sobre a causa del comentari de davant" #: lazarusidestrconsts.dlgallfiles msgid "All files" msgstr "Tots els fitxers" #: lazarusidestrconsts.dlgalphabetically msgid "Alphabetically" msgstr "Alfabèticament" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always visible cursor" msgstr "" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" msgstr "" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" msgstr "Avisa al compilar" #: lazarusidestrconsts.dlgapplicationsettings msgid "Application Settings" msgstr "Paràmetres de l'aplicació" #: lazarusidestrconsts.dlgassemblerdefault msgctxt "lazarusidestrconsts.dlgassemblerdefault" msgid "Default" msgstr "Predeterminat" #: lazarusidestrconsts.dlgassertcode msgid "Include Assertion Code" msgstr "Inclou el codi afirmat" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" msgstr "Crea les formes automàticament" #: lazarusidestrconsts.dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" msgstr "Quan es creen noves formes, afegeix-les a les formes creades automàticament" #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" msgstr "Elimina el fitxer automàticament" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse when typing" msgstr "" #: lazarusidestrconsts.dlgautoindent msgid "Auto indent" msgstr "" #: lazarusidestrconsts.dlgautoremoveemptymethods msgid "Auto remove empty methods" msgstr "" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" msgstr "Canvia el nom del fitxer a minúscules automàticament" #: lazarusidestrconsts.dlgautosave msgid "Auto save" msgstr "Desa automàticament" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" msgstr "Formes disponibles:" #: lazarusidestrconsts.dlgbackcolor msgid "Background" msgstr "Rerefons" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(Cap subdirectori)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "El mateix nom (a un subdirectori)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" msgstr "Darrera dels mètodes" #: lazarusidestrconsts.dlgblockgroupoptions msgid "Selection:" msgstr "" #: lazarusidestrconsts.dlgblockindent msgid "Block indent" msgstr "" #: lazarusidestrconsts.dlgblockindenttype msgid "Indent method" msgstr "" #: lazarusidestrconsts.dlgblockindenttypecopy msgid "Space/tab as prev Line" msgstr "" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" msgstr "" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" msgstr "" #: lazarusidestrconsts.dlgbp7cptb msgid "TP/BP 7.0 Compatible" msgstr "Compatible amb TP/BP 7.0" #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" msgstr "" #: lazarusidestrconsts.dlgbrowsemsgfilter msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*" msgstr "" #: lazarusidestrconsts.dlgbutapply msgid "Apply" msgstr "Aplica" #: lazarusidestrconsts.dlgcancel msgctxt "lazarusidestrconsts.dlgcancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.dlgcasesensitive msgctxt "lazarusidestrconsts.dlgcasesensitive" msgid "&Case Sensitive" msgstr "" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" msgstr "" #: lazarusidestrconsts.dlgccoresults msgid "Results" msgstr "" #: lazarusidestrconsts.dlgccotest msgctxt "lazarusidestrconsts.dlgccotest" msgid "Test" msgstr "Prova" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "" #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "" #: lazarusidestrconsts.dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." msgstr "" #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "" #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "" #: lazarusidestrconsts.dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." msgstr "" #: lazarusidestrconsts.dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "" #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "" #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" msgstr "Ordre de la classe" #: lazarusidestrconsts.dlgcdtlast msgid "Last" msgstr "Últim" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" msgstr "minúscules" #: lazarusidestrconsts.dlgcdtpreview msgid "Preview (Max line length = 1)" msgstr "Visualització prèvia (long. màx. línia = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" msgstr "Prefix de llegir" #: lazarusidestrconsts.dlgcdtstoredpostfix msgid "Stored postfix" msgstr "Postfix de desat" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" msgstr "MAJÚSCULES" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" msgstr "Prefix de la variable" #: lazarusidestrconsts.dlgcdtwriteprefix msgid "Write prefix" msgstr "Prefix d'escriure" #: lazarusidestrconsts.dlgcentercursorline msgid "Center Cursor Line" msgstr "Centra la línia del cursor" #: lazarusidestrconsts.dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" msgstr "Anomena i desa - fica el nom dels fitxers Pascal en minúscules" #: lazarusidestrconsts.dlgcheckconsistency msgid "Check consistency" msgstr "Verifica la consistència" #: lazarusidestrconsts.dlgcheckpackagesonformcreate msgid "Check packages on form create" msgstr "" #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Tria un fitxer de plantilla (*.dci)" #: lazarusidestrconsts.dlgclassinsertpolicy msgid "Class part insert policy" msgstr "Política d'inserir parts de classes" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "Mostra els botons de tancar en el llibre de notes" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" msgstr "Esquema de Color" #: lazarusidestrconsts.dlgcmacro msgid "C Style Macros (global)" msgstr "Macroinstruccions estil C (global)" #: lazarusidestrconsts.dlgcoansistr msgid "Use Ansi Strings" msgstr "Utilitza Ansi Strings" #: lazarusidestrconsts.dlgcoasis msgid "As-Is" msgstr "Com és" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style:" msgstr "" #: lazarusidestrconsts.dlgcocfgcmpmessages msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" msgid "Messages" msgstr "" #: lazarusidestrconsts.dlgcochecks msgid "Checks:" msgstr "Comprovacions:" #: lazarusidestrconsts.dlgcocompilation msgid "Compilation" msgstr "Compilació" #: lazarusidestrconsts.dlgcoconditionals msgid "Conditionals" msgstr "" #: lazarusidestrconsts.dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" msgstr "Operadors estil C (*=, +=, /= i -=)" #: lazarusidestrconsts.dlgcocreatechildnode msgid "Create child node" msgstr "" #: lazarusidestrconsts.dlgcocreatemakefile msgctxt "lazarusidestrconsts.dlgcocreatemakefile" msgid "Create Makefile" msgstr "Crea Makefile" #: lazarusidestrconsts.dlgcocreatenodeabove msgid "Create node above" msgstr "" #: lazarusidestrconsts.dlgcocreatenodebelow msgid "Create node below" msgstr "" #: lazarusidestrconsts.dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" msgstr "Genera informació de depuració pel DBX (Compilació més lenta)" #: lazarusidestrconsts.dlgcodebugging msgid "Debugging:" msgstr "Depuració" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Afegeix la trajectòria addicional del depurador (cap):" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" msgstr "Creació del codi" #: lazarusidestrconsts.dlgcodefoldingmouse msgctxt "lazarusidestrconsts.dlgcodefoldingmouse" msgid "Mouse" msgstr "" #: lazarusidestrconsts.dlgcodegeneration msgid "Code" msgstr "Codi" #: lazarusidestrconsts.dlgcodetoolsopts msgid "CodeTools Options" msgstr "Opcions de les eines del codi" #: lazarusidestrconsts.dlgcofast msgid "Faster Code" msgstr "Codi més ràpid" #: lazarusidestrconsts.dlgcogdb msgid "Generate Debugging Info For GDB (Slows Compiling)" msgstr "Genera informació de depuració pel GDB (Compilació més lenta)" #: lazarusidestrconsts.dlgcogenerate msgid "Generate:" msgstr "Genera:" #: lazarusidestrconsts.dlgcoheaptrc msgid "Use Heaptrc Unit" msgstr "Utilitza unitat Heaptrc" #: lazarusidestrconsts.dlgcoincfiles msgid "Include Files (-Fi):" msgstr "Fitxers Inclosos (-Fi):" #: lazarusidestrconsts.dlgcoinherited msgctxt "lazarusidestrconsts.dlgcoinherited" msgid "Inherited" msgstr "Heretat" #: lazarusidestrconsts.dlgcokeepvarsreg msgid "Keep certain variables in registers" msgstr "" #: lazarusidestrconsts.dlgcolibraries msgid "Libraries (-Fl):" msgstr "Biblioteques (-Fl):" #: lazarusidestrconsts.dlgcolinking msgid "Linking" msgstr "Enllaçament" #: lazarusidestrconsts.dlgcoloadsave msgid "Load/Save" msgstr "Carrega/Desa" #: lazarusidestrconsts.dlgcolor msgid "Color" msgstr "" #: lazarusidestrconsts.dlgcolorlink msgid "(Edit Color)" msgstr "" #: lazarusidestrconsts.dlgcommandlineparameters msgid "Command line parameters" msgstr "" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "Paràmetres de la línia d'ordres (sense nom d'aplicació)" #: lazarusidestrconsts.dlgcomovedown msgid "Move down" msgstr "" #: lazarusidestrconsts.dlgcomoveleveldown msgid "Move level down" msgstr "" #: lazarusidestrconsts.dlgcomovelevelup msgid "Move level up" msgstr "" #: lazarusidestrconsts.dlgcomoveup msgid "Move up" msgstr "" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler Messages" msgstr "" #: lazarusidestrconsts.dlgcompileroptions msgctxt "lazarusidestrconsts.dlgcompileroptions" msgid "Compiler Options" msgstr "Opcions del compilador" #: lazarusidestrconsts.dlgcompleteproperties msgid "Complete properties" msgstr "Completa les propietats" #: lazarusidestrconsts.dlgconfigfiles msgid "Config Files:" msgstr "Fitxers de configuració:" #: lazarusidestrconsts.dlgconormal msgid "Normal Code" msgstr "Codi normal" #: lazarusidestrconsts.dlgcoopts msgid "Options: " msgstr "Opcions: " #: lazarusidestrconsts.dlgcoother msgctxt "lazarusidestrconsts.dlgcoother" msgid "Other" msgstr "Altres" #: lazarusidestrconsts.dlgcooverflow msgid "Overflow" msgstr "Sobreeiximent" #: lazarusidestrconsts.dlgcoparsing msgid "Parsing" msgstr "Analització" #: lazarusidestrconsts.dlgcopypastekeepfolds msgid "Copy/Paste with fold info" msgstr "" #: lazarusidestrconsts.dlgcopywordatcursoroncopynone msgid "Copy word on copy none" msgstr "" #: lazarusidestrconsts.dlgcorange msgid "Range" msgstr "Abast" #: lazarusidestrconsts.dlgcoshowerr msgid "Show Errors" msgstr "Mostra els errors" #: lazarusidestrconsts.dlgcoshowoptions #, fuzzy #| msgid "Show Options" msgid "&Show Options" msgstr "Mostra les opcions" #: lazarusidestrconsts.dlgcosmaller msgid "Smaller Code" msgstr "Codi més petit" #: lazarusidestrconsts.dlgcosmartlinkable msgid "Smart Linkable" msgstr "Enllaçament intel·ligent" #: lazarusidestrconsts.dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Altres fonts (fitxers .pp/.pas, només utilitzat per l'IDE no pel compilador)" #: lazarusidestrconsts.dlgcostack msgid "Stack" msgstr "Pila" #: lazarusidestrconsts.dlgcostrip msgid "Strip Symbols From Executable" msgstr "Elimina els símbols de l'executable" #: lazarusidestrconsts.dlgcounitstyle msgid "Unit Style:" msgstr "Estil de la unitat:" #: lazarusidestrconsts.dlgcouseasdefault msgid "Use these compiler options as default for new projects" msgstr "" #: lazarusidestrconsts.dlgcovalgrind msgid "Generate code for valgrind" msgstr "Genera codi pel Valgrind" #: lazarusidestrconsts.dlgcoverbosity msgid "Verbosity" msgstr "" #: lazarusidestrconsts.dlgcppinline msgid "C++ Styled INLINE" msgstr "INLINE estil C++" #: lazarusidestrconsts.dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "El cursor darrera EOL" #: lazarusidestrconsts.dlgcursorgroupoptions msgid "Cursor:" msgstr "" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Cursor skips selection" msgstr "" #: lazarusidestrconsts.dlgcursorskipstab msgid "Cursor skips tabs" msgstr "" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Extensions definides per l'usuari (.pp.xxx)" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" msgstr "Tipus i trajectòria del depurador" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" msgstr "Font de l'editor predeterminat" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" msgstr "Valor per defecte" #: lazarusidestrconsts.dlgdelphi2ext msgid "Delphi 2 Extensions" msgstr "Extensions de Delphi 2" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " msgstr "Elimina la plantilla" #: lazarusidestrconsts.dlgdeplhicomp msgid "Delphi Compatible" msgstr "Compatible amb Delphi" #: lazarusidestrconsts.dlgdesktop msgid "Desktop" msgstr "Escriptori" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " msgstr "" #: lazarusidestrconsts.dlgdesktopfiles msgid "Desktop files" msgstr "Fitxers de l'escriptori" #: lazarusidestrconsts.dlgdesktophints msgid "Hints" msgstr "" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " msgstr "" #: lazarusidestrconsts.dlgdesktopmisc msgid "Misc Options" msgstr "" #: lazarusidestrconsts.dlgdirection msgid "Direction" msgstr "Direcció" #: lazarusidestrconsts.dlgdirectorydoesnotexist msgid "Directory does not exist" msgstr "El directori no existeix" #: lazarusidestrconsts.dlgdisableantialiasing msgid "Disable anti-aliasing" msgstr "" #: lazarusidestrconsts.dlgdividercolordefault msgid "Use right margin color" msgstr "" #: lazarusidestrconsts.dlgdividerdrawdepth msgid "Draw divider level" msgstr "" #: lazarusidestrconsts.dlgdividernestcolor msgid "Nested line color" msgstr "" #: lazarusidestrconsts.dlgdivideronoff msgid "Draw divider" msgstr "" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" msgstr "" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" msgstr "" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" msgstr "" #: lazarusidestrconsts.dlgdivpasstructglobalname msgid "Class/Struct" msgstr "" #: lazarusidestrconsts.dlgdivpasstructlocalname msgid "Class/Struct (local)" msgstr "" #: lazarusidestrconsts.dlgdivpastryname msgid "Try/Except" msgstr "" #: lazarusidestrconsts.dlgdivpasunitsectionname msgid "Unit sections" msgstr "" #: lazarusidestrconsts.dlgdivpasusesname msgid "Uses clause" msgstr "" #: lazarusidestrconsts.dlgdivpasvarglobalname msgid "Var/Type" msgstr "" #: lazarusidestrconsts.dlgdivpasvarlocalname msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgdownword msgctxt "lazarusidestrconsts.dlgdownword" msgid "Down" msgstr "Avall" #: lazarusidestrconsts.dlgedadd msgid "Add..." msgstr "Afegeix" #: lazarusidestrconsts.dlgedback msgid "Back" msgstr "Torna" #: lazarusidestrconsts.dlgedbold msgid "Bold" msgstr "Negreta" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" msgstr "Subdirectori" #: lazarusidestrconsts.dlgedcodetempl msgid "Code templates" msgstr "Plantilles del codi" #: lazarusidestrconsts.dlgedcolor #, fuzzy #| msgid "Syntax highlight" msgctxt "lazarusidestrconsts.dlgedcolor" msgid "Colors" msgstr "Color" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Complete blocks" msgstr "" #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" msgstr "Extensió definida per l'usuari" #: lazarusidestrconsts.dlgeddelay msgid "Delay" msgstr "Retard" #: lazarusidestrconsts.dlgeddelete msgctxt "lazarusidestrconsts.dlgeddelete" msgid "Delete" msgstr "Elimina" #: lazarusidestrconsts.dlgeddisplay msgid "Display" msgstr "Visualitza a pantalla" #: lazarusidestrconsts.dlgededit msgid "Edit..." msgstr "Edita" #: lazarusidestrconsts.dlgedfiles msgid "Editor files" msgstr "Fitxers de l'editor" #: lazarusidestrconsts.dlgedhintcommand msgid "Hint: click on the command you want to edit" msgstr "Suggeriment: Feu un clic a l'ordre que voleu editar" #: lazarusidestrconsts.dlgedidcomlet msgctxt "lazarusidestrconsts.dlgedidcomlet" msgid "Identifier completion" msgstr "Completa l'identificador" #: lazarusidestrconsts.dlgedinvert msgid "Invert" msgstr "" #: lazarusidestrconsts.dlgedital msgid "Italic" msgstr "Itàlica" #: lazarusidestrconsts.dlgeditorfont msgid "Editor font" msgstr "Font de l'editor" #: lazarusidestrconsts.dlgeditorfontheight msgid "Editor font height" msgstr "Alçada fonts editor" #: lazarusidestrconsts.dlgeditoroptions msgctxt "lazarusidestrconsts.dlgeditoroptions" msgid "Editor options" msgstr "" #: lazarusidestrconsts.dlgedmisc msgid "Misc" msgstr "" #: lazarusidestrconsts.dlgednoerr msgid "No errors in key mapping found." msgstr "No s'han trobat errors en els accessos ràpids" #: lazarusidestrconsts.dlgedoff msgid "Off" msgstr "" #: lazarusidestrconsts.dlgedon msgid "On" msgstr "" #: lazarusidestrconsts.dlgedunder msgid "Underline" msgstr "Subratllat" #: lazarusidestrconsts.dlgedusedefcolor msgid "Use default color" msgstr "Utilitza el color per omissió" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" msgstr "" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" msgstr "" #: lazarusidestrconsts.dlgentirescope msgid "&Entire Scope" msgstr "" #: lazarusidestrconsts.dlgenvask msgid "Ask" msgstr "Demana" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Nota: Els fitxers del projecte son tots els fitxers del directori del projecte" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" msgstr "Còpia de seguretat" #: lazarusidestrconsts.dlgenvcolors msgctxt "lazarusidestrconsts.dlgenvcolors" msgid "Colors" msgstr "Colors" #: lazarusidestrconsts.dlgenvfiles msgid "Files" msgstr "Fitxers" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" msgstr "Graella" #: lazarusidestrconsts.dlgenvlanguage msgctxt "lazarusidestrconsts.dlgenvlanguage" msgid "Language" msgstr "Llenguatge" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" msgstr "Línies de la guia" #: lazarusidestrconsts.dlgenvmisc msgctxt "lazarusidestrconsts.dlgenvmisc" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgenvnone msgctxt "lazarusidestrconsts.dlgenvnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.dlgenvotherfiles msgid "Other files" msgstr "Altres fitxers" #: lazarusidestrconsts.dlgenvproject msgid "Project" msgstr "Projecte" #: lazarusidestrconsts.dlgenvtype msgctxt "lazarusidestrconsts.dlgenvtype" msgid "Type" msgstr "Tipus" #: lazarusidestrconsts.dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" msgstr "" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra char spacing" msgstr "" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" msgstr "Espaiat extra entre línies" #: lazarusidestrconsts.dlgextsymb msgid "Use external gdb debug symbols file" msgstr "" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" msgstr "Extensions d'Arxiu" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" msgstr "Cerca el text al cursor" #: lazarusidestrconsts.dlgfoldlfmitem msgid "Item" msgstr "" #: lazarusidestrconsts.dlgfoldlfmlist msgid "List <>" msgstr "" #: lazarusidestrconsts.dlgfoldlfmobject msgid "Object (inherited, inline)" msgstr "" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" msgstr "" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" msgstr "" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" msgstr "" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" msgstr "" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" msgstr "" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" msgstr "" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" msgstr "" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" msgid "Procedure" msgstr "Procediment" #: lazarusidestrconsts.dlgfoldpasprogram msgctxt "lazarusidestrconsts.dlgfoldpasprogram" msgid "Program" msgstr "programa" #: lazarusidestrconsts.dlgfoldpasrecord msgid "Record" msgstr "" #: lazarusidestrconsts.dlgfoldpasrepeat msgid "Repeat" msgstr "" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" msgstr "" #: lazarusidestrconsts.dlgfoldpasunit msgctxt "lazarusidestrconsts.dlgfoldpasunit" msgid "Unit" msgstr "Unitat" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" msgstr "" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" msgstr "" #: lazarusidestrconsts.dlgfoldpasuses msgctxt "lazarusidestrconsts.dlgfoldpasuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcdata msgid "CData" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcomment msgid "Comment" msgstr "" #: lazarusidestrconsts.dlgfoldxmldoctype msgid "DocType" msgstr "" #: lazarusidestrconsts.dlgfoldxmlnode msgid "Node" msgstr "" #: lazarusidestrconsts.dlgfoldxmlprocess msgid "Processing Instruction" msgstr "" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" msgstr "Color primer pla " #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "Política d'inserir procediments" #: lazarusidestrconsts.dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Manté l'ordre dels procediments" #: lazarusidestrconsts.dlgfpcpath msgid "Compiler path (e.g. %s)" msgstr "Trajectòria del compilador (%s)" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" msgstr "Directori del codi font del FPC" #: lazarusidestrconsts.dlgframecolor msgid "Frame color" msgstr "" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" msgstr "Editor de forma" #: lazarusidestrconsts.dlgfromcursor msgid "&From Cursor" msgstr "" #: lazarusidestrconsts.dlgfropts msgctxt "lazarusidestrconsts.dlgfropts" msgid "Options" msgstr "Opcions" #: lazarusidestrconsts.dlggeneratedwarf msgid "Generate dwarf debug information" msgstr "" #: lazarusidestrconsts.dlggetposition msgid "Get position" msgstr "Posició" #: lazarusidestrconsts.dlgglobal msgid "&Global" msgstr "" #: lazarusidestrconsts.dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" msgstr "Compatible amb GPC (GNU Pascal Compiler)" #: lazarusidestrconsts.dlggprof msgid "Generate code for gprof" msgstr "Genera codi pel gprof" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" msgstr "Color capturador" #: lazarusidestrconsts.dlggridcolor msgid "Grid color" msgstr "Color de la graella" #: lazarusidestrconsts.dlggridx msgid "Grid size X" msgstr "Tamany X de la graella" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" msgstr "Tamany horitzontal del pas de la graella" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" msgstr "Tamany Y de la graella" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" msgstr "Tamany vertical del pas de la graella" #: lazarusidestrconsts.dlggroupcodeexplorer msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" msgid "Code Explorer" msgstr "" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" msgstr "" #: lazarusidestrconsts.dlggroupdebugger msgid "Debugger" msgstr "" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" msgstr "" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" msgid "Environment" msgstr "Entorn" #: lazarusidestrconsts.dlggrouphelp msgctxt "lazarusidestrconsts.dlggrouphelp" msgid "Help" msgstr "Ajuda" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" msgstr "" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" msgstr "Mostra les línies de la guia" #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" msgstr "Color del canal" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" msgstr "" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" msgstr "" #: lazarusidestrconsts.dlggutterwidth msgid "Gutter width" msgstr "Ample del canal" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" msgstr "Desplaça mitja pàgina" #: lazarusidestrconsts.dlgheapsize msgid "Heap Size" msgstr "Tamany del montícul" #: lazarusidestrconsts.dlgheightpos msgid "Height:" msgstr "Alçada" #: lazarusidestrconsts.dlghideideonrun msgid "Hide IDE windows on run" msgstr "Amaga les finestres de l'IDE durant l'execució" #: lazarusidestrconsts.dlghidemessagesicons msgid "Hide Messages Icons" msgstr "" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" msgstr "" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" msgstr "" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Cursor" msgstr "" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Cursor" msgstr "" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" msgstr "" #: lazarusidestrconsts.dlghintsunused msgid "Show Hints for unused units in main source" msgstr "Mostra els suggeriments per les unitats no utilitzades en la font principal" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "La tecla d'inici salta al començament més proper" #: lazarusidestrconsts.dlghostapplication msgid "Host application" msgstr "Aplicació de l'amfitrió" #: lazarusidestrconsts.dlgidentifiercompletion msgctxt "lazarusidestrconsts.dlgidentifiercompletion" msgid "Identifier completion" msgstr "Completa l'identificador" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" msgstr "Política d'identificador" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" msgstr "" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" msgstr "Ignora" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" msgstr "Inclou les variables del sistema" #: lazarusidestrconsts.dlgindentcodeto msgid "Indent code to" msgstr "Sagna el codi a" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Indent and Tabs:" msgstr "" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" msgstr "Davant dels mètodes" #: lazarusidestrconsts.dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "El nom del constructor ha de ser 'init' (el del destructor ha de ser 'done')" #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" msgstr "Insereix espai després de" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" msgstr "Insereix espai davant de" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" msgstr "Interval en seg." #: lazarusidestrconsts.dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Salt (p.ex. Salta mètodes)" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep cursor X position" msgstr "" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" msgstr "Accessos ràpids" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" msgstr "Errors dels accessos ràpids" #: lazarusidestrconsts.dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "Combinació d'accessos ràpids" #: lazarusidestrconsts.dlgkeywordpolicy msgid "Keyword policy" msgstr "Política de paraula clau" #: lazarusidestrconsts.dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Permet LABEL i GOTO" #: lazarusidestrconsts.dlglang msgctxt "lazarusidestrconsts.dlglang" msgid "Language" msgstr "Llenguatge" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" msgstr "Últim (p.ex. al final del codi font)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Directori Lazarus (predeterminat per a tots els projectes)" #: lazarusidestrconsts.dlgleftpos msgid "Left:" msgstr "Esquerra:" #: lazarusidestrconsts.dlglefttopclr #, fuzzy #| msgid "color for left, top" msgid "Guid lines Left,Top" msgstr "Color per esquerra, amunt" #: lazarusidestrconsts.dlglevel1opt msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts.dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts.dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts.dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" msgstr "Nivell 0 (sense optimitzacions extres)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" msgstr "Divisió entre línies" #: lazarusidestrconsts.dlglinklibraries msgid "Link Style:" msgstr "Estil d'enllaçament" #: lazarusidestrconsts.dlglinksmart msgid "Link Smart" msgstr "Enllaçament intel·ligent" #: lazarusidestrconsts.dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" msgstr "Mostra els números de línia en errors en temps d'execució en seguiments inversos" #: lazarusidestrconsts.dlgloaddfile msgid "Load desktop settings from file" msgstr "Carrega els paràmetres de l'escriptori des del fitxer" #: lazarusidestrconsts.dlgmainmenu msgid "Main Menu" msgstr "Menú principal" #: lazarusidestrconsts.dlgmainviewforms msgid "View project forms" msgstr "Mostra les formes del projecte" #: lazarusidestrconsts.dlgmainviewframes msgid "View project frames" msgstr "" #: lazarusidestrconsts.dlgmainviewunits msgid "View project units" msgstr "Mostra les unitats del projecte" #: lazarusidestrconsts.dlgmakepath msgid "Make path" msgstr "Trajectòria de Make" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" msgstr "Marge i canal" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" msgstr "Color del marcador" #: lazarusidestrconsts.dlgmarkupgroup msgid "Word under Caret Highlight" msgstr "" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Match word boundaries for words up to this length:" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore Keywords" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable Timer for Markup Current Word" msgstr "" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim Spaces (when highlighting current selection)" msgstr "" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" msgstr "Número màxim de comptador" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" msgstr "Longitud màxima de la línia" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" msgstr "Núm.màx. de fitxers recents" #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" msgstr "Màx.fitxers projecte recents" #: lazarusidestrconsts.dlgmethodinspolicy msgid "Method insert policy" msgstr "Política d'inserir mètodes" #: lazarusidestrconsts.dlgminimizeallonminimizemain msgid "Minimize all on minimize main" msgstr "Minimitza totes les finestes en minimitzar la principal" #: lazarusidestrconsts.dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "Barreja els mètodes i les propietats" #: lazarusidestrconsts.dlgmousefoldbutton msgctxt "lazarusidestrconsts.dlgmousefoldbutton" msgid "Button" msgstr "" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.dlgmousefoldbuttonmiddle msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle" msgid "Middle" msgstr "" #: lazarusidestrconsts.dlgmousefoldbuttonright msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.dlgmousefoldcolfoldall msgid "Fold All (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolfoldone msgid "Fold One (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolunfoldall msgid "Unfold All (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolunfoldone msgid "Unfold One (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldenabled msgctxt "lazarusidestrconsts.dlgmousefoldenabled" msgid "Enabled" msgstr "" #: lazarusidestrconsts.dlgmousefoldexpfoldall msgid "Fold All (All Expanded)" msgstr "" #: lazarusidestrconsts.dlgmousefoldexpfoldone msgid "Fold One (All Expanded)" msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup2 msgid "Setting 2" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmousefoldmodifierctrl msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmousefoldmodifiershift msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn2 msgid "Double" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn3 msgid "Triple" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn4 msgid "Quad" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnadd msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd" msgid "Add" msgstr "Afegeix" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtncancel msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.dlgmouseoptbtndel msgctxt "lazarusidestrconsts.dlgmouseoptbtndel" msgid "Delete" msgstr "Elimina" #: lazarusidestrconsts.dlgmouseoptbtndown msgctxt "lazarusidestrconsts.dlgmouseoptbtndown" msgid "Down" msgstr "Avall" #: lazarusidestrconsts.dlgmouseoptbtnexport msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport" msgid "Export" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgid "Extra 1" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgid "Extra 2" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnimport msgid "Import" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnok msgctxt "lazarusidestrconsts.dlgmouseoptbtnok" msgid "Ok" msgstr "D'acord" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.dlgmouseoptbtnudp msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp" msgid "Change" msgstr "Canvia" #: lazarusidestrconsts.dlgmouseoptbtnup msgctxt "lazarusidestrconsts.dlgmouseoptbtnup" msgid "Up" msgstr "Amunt" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" msgstr "" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" msgstr "" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" msgstr "" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadalt msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcontext msgid "Context" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcount msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadctrl msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptheaddesc msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" msgid "Order" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" msgstr "" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodalt msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.dlgmouseoptmodctrl msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" msgid "Text" msgstr "Text" #: lazarusidestrconsts.dlgmouseoptnodeselect msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" msgid "Selection" msgstr "Selecció" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" msgstr "" #: lazarusidestrconsts.dlgmouseoptotheracthint msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..." msgstr "" #: lazarusidestrconsts.dlgmouseoptotheracttoggle msgid "Filter Mod-Keys" msgstr "" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmsgs msgctxt "lazarusidestrconsts.dlgmsgs" msgid "Messages" msgstr "" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" msgstr "Sel·lecció múltiple" #: lazarusidestrconsts.dlgnaming msgid "Naming" msgstr "Anomenat" #: lazarusidestrconsts.dlgnoautomaticrenaming #, fuzzy #| msgid "no automatic renaming" msgid "No automatic renaming" msgstr "no canviïs el nom automàticament" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" msgstr "" #: lazarusidestrconsts.dlgnotebooktabpos msgid "Source notebook tabs position" msgstr "" #: lazarusidestrconsts.dlgnotebooktabposbottom msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom" msgid "Bottom" msgstr "" #: lazarusidestrconsts.dlgnotebooktabposleft msgctxt "lazarusidestrconsts.dlgnotebooktabposleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.dlgnotebooktabposright msgctxt "lazarusidestrconsts.dlgnotebooktabposright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.dlgnotebooktabpostop msgctxt "lazarusidestrconsts.dlgnotebooktabpostop" msgid "Top" msgstr "" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" msgstr "No separis la línia després de:" #: lazarusidestrconsts.dlgnotsplitlinefront msgid "Do not split line In front of:" msgstr "No separis la línia abans de:" #: lazarusidestrconsts.dlgobjinsp msgctxt "lazarusidestrconsts.dlgobjinsp" msgid "Object Inspector" msgstr "" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height" msgstr "Alçada de l'element" #: lazarusidestrconsts.dlgoimiscellaneous msgctxt "lazarusidestrconsts.dlgoimiscellaneous" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgoioptions msgctxt "lazarusidestrconsts.dlgoioptions" msgid "Options" msgstr "Opcions" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" msgstr "" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" msgstr "" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" msgstr "" #: lazarusidestrconsts.dlgoptimiz msgid "Optimizations:" msgstr "Optimitzacions:" #: lazarusidestrconsts.dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "Altres fitxers d'unitats (-Fu) (El delimitador és punt i coma):" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite Block" msgstr "" #: lazarusidestrconsts.dlgpackagegraph msgid "Package Graph" msgstr "" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" msgstr "Suggeriments per a la paleta de components" #: lazarusidestrconsts.dlgpasext msgid "Default pascal extension" msgstr "Extensió Pascal predeterminada" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" msgstr "Passa les opcions a l'enllaçador (el delimitador és l'espai)" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent Block" msgstr "" #: lazarusidestrconsts.dlgpersistentcursor msgid "Persistent cursor" msgstr "" #: lazarusidestrconsts.dlgpldpackagegroup msgid "Package group" msgstr "" #: lazarusidestrconsts.dlgpoapplication msgid "Application" msgstr "Aplicació" #: lazarusidestrconsts.dlgpoclearicon msgid "Clear Icon" msgstr "" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" msgstr "" #: lazarusidestrconsts.dlgpofroms msgid "Forms" msgstr "Formes" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" msgstr "" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" msgstr "" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" msgstr "" #: lazarusidestrconsts.dlgpoicondescnone msgctxt "lazarusidestrconsts.dlgpoicondescnone" msgid "(none)" msgstr "" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" msgstr "" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" msgid "Miscellaneous" msgstr "Miscel·lània" #: lazarusidestrconsts.dlgpooutputsettings msgid "Output Settings" msgstr "Paràmetres de la sortida" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" msgstr "" #: lazarusidestrconsts.dlgposavesession msgid "Session" msgstr "Sessió" #: lazarusidestrconsts.dlgpotargetfilename msgid "Target file name:" msgstr "Nom del fitxer destinació:" #: lazarusidestrconsts.dlgpotitle msgid "Title:" msgstr "Títol" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" msgstr "" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest file to enable themes (windows only)" msgstr "" #: lazarusidestrconsts.dlgprojectoptions msgid "Project Options" msgstr "Opcions del projecte" #: lazarusidestrconsts.dlgprojectoptionsfor msgid "Options for Project: %s" msgstr "" #: lazarusidestrconsts.dlgprojfiles msgid "Project files" msgstr "Fitxers de projecte" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt On Replace" msgstr "" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" msgstr "Ompleix les propietats" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" msgstr "Nom de propietat" #: lazarusidestrconsts.dlgqopenlastprj msgid "Open last project at start" msgstr "Obre l'últim projecte a l'iniciar" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" msgstr "" #: lazarusidestrconsts.dlgqshowcompiledialog msgid "Show compile dialog" msgstr "" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" msgstr "Mostra la graella" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" msgstr "Ajusta a la graella" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" msgstr "" #: lazarusidestrconsts.dlgregularexpressions msgid "&Regular Expressions" msgstr "" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" msgstr "Reemplaça Tot" #: lazarusidestrconsts.dlgreplacewith msgid "&Replace With" msgstr "&Reemplaça amb" #: lazarusidestrconsts.dlgreport msgid "Report" msgstr "Informa" #: lazarusidestrconsts.dlgrightbottomclr #, fuzzy #| msgid "color for right, bottom" msgid "Guide lines Right,Bottom" msgstr "Color per dreta, avall" #: lazarusidestrconsts.dlgrightclickselects msgid "Right Click selects" msgstr "Clic dret selecciona" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" msgstr "Marge dret" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" msgstr "Directori de treball" #: lazarusidestrconsts.dlgrubberbandselectsgrandchildren msgid "Select grandchildren" msgstr "" #: lazarusidestrconsts.dlgruberbandcreationcolor #, fuzzy #| msgid "Creation" msgid "Rubberband Creation" msgstr "Creació" #: lazarusidestrconsts.dlgruberbandselectioncolor #, fuzzy #| msgid "Selection" msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" msgid "Rubberband Selection" msgstr "Selecció" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Pantalla(no per win32, p.ex. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts.dlgrunoenvironment msgctxt "lazarusidestrconsts.dlgrunoenvironment" msgid "Environment" msgstr "Entorn" #: lazarusidestrconsts.dlgrunolocal msgid "Local" msgstr "Local" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" msgstr "Variables del sistema" #: lazarusidestrconsts.dlgrunousedisplay msgid "Use display" msgstr "Utilitza la pantalla" #: lazarusidestrconsts.dlgrunouseroverrides msgid "User overrides" msgstr "L'usuari substitueix" #: lazarusidestrconsts.dlgrunovalue msgctxt "lazarusidestrconsts.dlgrunovalue" msgid "Value" msgstr "" #: lazarusidestrconsts.dlgrunovariable msgid "Variable" msgstr "Variable" #: lazarusidestrconsts.dlgrunparameters msgid "Run parameters" msgstr "Executa els paràmetres" #: lazarusidestrconsts.dlgsavedfile msgid "Save desktop settings to file" msgstr "Desa els paràmetres de l'escriptori al fitxer" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" msgstr "" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "Desa l'informació de l'editor pels fitxers tancats" #: lazarusidestrconsts.dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "Desa l'informació de l'editor només per fitxers del projecte" #: lazarusidestrconsts.dlgscope msgid "Scope" msgstr "Abast" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" msgstr "Desplaça un menys" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling:" msgstr "" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" msgstr "Desplaça fins el final del fitxer" #: lazarusidestrconsts.dlgscrollpastendline #, fuzzy #| msgid "Scroll past end of line" msgid "Caret past end of line" msgstr "Desplaça fins el final de la línia" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." msgstr "L'usuari ha finalitzat la recerca." #: lazarusidestrconsts.dlgsearchcaption msgid "Searching..." msgstr "Cercant..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" msgstr "trajectòries" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected Text" msgstr "" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" msgstr "Predetermina tots els elements" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" msgstr "Predetermina l'element" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" msgstr "Variable de propietat" #: lazarusidestrconsts.dlgshowcaps msgid "Show component captions" msgstr "Mostra els rètols dels components" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "Mostra els procediments compilats" #: lazarusidestrconsts.dlgshowcompileroptions msgid "Show compiler options" msgstr "Mostra les opcions del compilador" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" msgstr "" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" msgstr "Mostra els condicionals" #: lazarusidestrconsts.dlgshowdebuginfo msgid "Show debug info" msgstr "Mostra l'informació de la depuració" #: lazarusidestrconsts.dlgshowdefinedmacros msgid "Show defined macros" msgstr "Mostra les macroinstruccions definides" #: lazarusidestrconsts.dlgshowedrhints msgid "Show editor hints" msgstr "Mostra els suggeriments de l'editor" #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" msgstr "Mostra-ho tot" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "Mostra informació per l'executable (sols Win32)" #: lazarusidestrconsts.dlgshowgeneralinfo msgid "Show general info" msgstr "Mostra l'informació general" #: lazarusidestrconsts.dlgshowgutterhints msgid "Show gutter hints" msgstr "Mostra els suggeriments sense importància" #: lazarusidestrconsts.dlgshowhint msgid "Show Hints" msgstr "Mostra les indicacions" #: lazarusidestrconsts.dlgshowlinenumbers msgctxt "lazarusidestrconsts.dlgshowlinenumbers" msgid "Show line numbers" msgstr "Mostra els números de línia" #: lazarusidestrconsts.dlgshownotes msgid "Show Notes" msgstr "Mostra les notes" #: lazarusidestrconsts.dlgshownothing msgid "Show nothing (only errors)" msgstr "No mostris res (només els errors)" #: lazarusidestrconsts.dlgshowprocserror msgid "Show all procs on error" msgstr "Mostra tots els processos quan es trobi un error" #: lazarusidestrconsts.dlgshowscrollhint msgid "Show scroll hint" msgstr "Mostra el suggeriment deplaçat" #: lazarusidestrconsts.dlgshowsummary msgid "Show summary" msgstr "Mostra el reportatge" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" msgstr "Mostra els fitxers escollits" #: lazarusidestrconsts.dlgshowusedfiles msgid "Show used files" msgstr "Mostra els fitxers utilitzats" #: lazarusidestrconsts.dlgshowwarnings msgid "Show Warnings" msgstr "Mostra els avisos" #: lazarusidestrconsts.dlgskipforwarddeclarations msgid "Skip forward declarations" msgstr "" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" msgstr "Tabuladors intel·ligents" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Símbol darrera (.pp~)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Comptador (.pp;1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Símbol davant (.~pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Ajusta a les línies de la guia" #: lazarusidestrconsts.dlgspacenotcosmos msgctxt "lazarusidestrconsts.dlgspacenotcosmos" msgid "Space" msgstr "Espaiat" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "Suggeriments pels botons ràpids principals (obre, guarda, ...)" #: lazarusidestrconsts.dlgsrcedit msgctxt "lazarusidestrconsts.dlgsrcedit" msgid "Source Editor" msgstr "" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" msgstr "Origen" #: lazarusidestrconsts.dlgstatickeyword msgid "Static Keyword in Objects" msgstr "Paraula clau Static en els objectes" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Atura després del nombre d'errors:" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" msgstr "" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" msgstr "Opcions de la sintaxi" #: lazarusidestrconsts.dlgtabindent msgid "Tab indents blocks" msgstr "El tabulador sagna blocs" #: lazarusidestrconsts.dlgtabnumbersnotebook msgid "Show tab numbers in notebook" msgstr "" #: lazarusidestrconsts.dlgtabstospaces msgid "Tabs to spaces" msgstr "Tabuladors a espais" #: lazarusidestrconsts.dlgtabwidths msgctxt "lazarusidestrconsts.dlgtabwidths" msgid "Tab widths" msgstr "" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" msgstr "" #: lazarusidestrconsts.dlgtargetos msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" msgstr "" #: lazarusidestrconsts.dlgtargetplatform msgid "Target Platform:" msgstr "" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" msgstr "" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" msgstr "Directori per a muntar els projectes de prova" #: lazarusidestrconsts.dlgtexttofing msgid "&Text to Find" msgstr "Cerca el &text" #: lazarusidestrconsts.dlgthedirectory msgid "The directory \"" msgstr "El directori \"" #: lazarusidestrconsts.dlgtimesecondunit msgid "sec" msgstr "segons" #: lazarusidestrconsts.dlgtooltipeval msgid "Tooltip expression evaluation" msgstr "Avaluació de l'expressió del rètol indicador de funcions" #: lazarusidestrconsts.dlgtooltiptools msgid "Tooltip symbol Tools" msgstr "Eines del símbol del rètol indicador de funcions" #: lazarusidestrconsts.dlgtoppos msgid "Top:" msgstr "Límit superior:" #: lazarusidestrconsts.dlgtplfname msgid "Template file name" msgstr "Nom fit. Plantilla" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim Spaces Style" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" msgstr "" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Suprimeix els espais finals" #: lazarusidestrconsts.dlguncertopt msgid "Uncertain Optimizations" msgstr "Optimitzacions incertes" #: lazarusidestrconsts.dlgundoaftersave msgid "Undo after save" msgstr "Desfés després de desar" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo:" msgstr "" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" msgstr "" #: lazarusidestrconsts.dlgunitdepbrowse msgctxt "lazarusidestrconsts.dlgunitdepbrowse" msgid "Open" msgstr "" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" msgstr "Dependències de les unitats" #: lazarusidestrconsts.dlgunitdeprefresh msgid "Refresh" msgstr "Refresca" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" msgstr "" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" msgstr "" #: lazarusidestrconsts.dlgupword msgctxt "lazarusidestrconsts.dlgupword" msgid "Up" msgstr "Amunt" #: lazarusidestrconsts.dlgusecodefolding msgid "Code folding" msgstr "" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional Compiler Config File" msgstr "" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider drawing" msgstr "" #: lazarusidestrconsts.dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "Utilitza el fitxer de configuració normalitzat (fpc.cfg)" #: lazarusidestrconsts.dlguselaunchingapp msgid "Use launching application" msgstr "Utilitza l'aplicació llançadora" #: lazarusidestrconsts.dlgusemsgfile msgid "Use messages file" msgstr "" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Utilitza el ressaltat de sintaxi" #: lazarusidestrconsts.dlgvaluecolor msgctxt "lazarusidestrconsts.dlgvaluecolor" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" msgstr "Detall durant la compilació:" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" msgstr "Canal visible" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" msgstr "Marge dret visible" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole Words Only" msgstr "" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" msgstr "Ample" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" msgstr "" #: lazarusidestrconsts.dlgwindow msgctxt "lazarusidestrconsts.dlgwindow" msgid "Window" msgstr "Finestra" #: lazarusidestrconsts.dlgwinpos msgid "Window Positions" msgstr "Posicions de les finestres" #: lazarusidestrconsts.dlgwordspolicies msgctxt "lazarusidestrconsts.dlgwordspolicies" msgid "Words" msgstr "Paraules" #: lazarusidestrconsts.dlgwrdpreview msgctxt "lazarusidestrconsts.dlgwrdpreview" msgid "Preview" msgstr "Visualització prèvia" #: lazarusidestrconsts.dlgwritefpclogo msgid "Write an FPC logo" msgstr "Escriu un logotipus FPC" #: lazarusidestrconsts.fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "Els components multi seleccionats han de ser d'una sola forma" #: lazarusidestrconsts.fdmalignword msgid "Align" msgstr "Alinea" #: lazarusidestrconsts.fdmdeleteselection #, fuzzy #| msgid "Delete selection" msgid "Delete Selection" msgstr "Elimina la selecció" #: lazarusidestrconsts.fdmmirrorhorizontal #, fuzzy #| msgid "Mirror horizontal" msgid "Mirror Horizontal" msgstr "Mirall horitzontal" #: lazarusidestrconsts.fdmmirrorvertical #, fuzzy #| msgid "Mirror vertical" msgid "Mirror Vertical" msgstr "Mirall vertical" #: lazarusidestrconsts.fdmorder msgctxt "lazarusidestrconsts.fdmorder" msgid "Order" msgstr "" #: lazarusidestrconsts.fdmorderbackone #, fuzzy #| msgid "Back one" msgid "Back One" msgstr "Enrere u" #: lazarusidestrconsts.fdmorderforwardone #, fuzzy #| msgid "Forward one" msgid "Forward One" msgstr "Endavant u" #: lazarusidestrconsts.fdmordermovetoback #, fuzzy #| msgid "Move to back" msgid "Move to Back" msgstr "Mou al fons" #: lazarusidestrconsts.fdmordermovetofront #, fuzzy #| msgid "Move to front" msgid "Move to Front" msgstr "Mou al front" #: lazarusidestrconsts.fdmsaveformasxml #, fuzzy #| msgid "Save form as xml" msgid "Save form as XML" msgstr "Desa forma com xml" #: lazarusidestrconsts.fdmscaleword msgid "Scale" msgstr "Escala" #: lazarusidestrconsts.fdmselectall msgctxt "lazarusidestrconsts.fdmselectall" msgid "Select All" msgstr "Selecciona-ho tot" #: lazarusidestrconsts.fdmsizeword msgid "Size" msgstr "Tamany" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "Opció: Desplaça a graella" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "Opció: Desplaça a línies de la guia" #: lazarusidestrconsts.fdmtaborder msgid "Tab Order..." msgstr "" #: lazarusidestrconsts.fdmzorder msgid "Z-order" msgstr "" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" msgstr "" #: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." msgstr "" #: lazarusidestrconsts.lisa2paddfile msgid "Add File" msgstr "Afegeix el fitxer" #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" msgstr "Afegeix els fitxers" #: lazarusidestrconsts.lisa2paddfilestopackage msgid "Add files to package" msgstr "Afegeix els fitxers al paquet" #: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" msgstr "Afegeix els fitxers LFM i LRS, si existeixen" #: lazarusidestrconsts.lisa2paddtopackage msgid "Add to package" msgstr "Afegeix al paquet" #: lazarusidestrconsts.lisa2paddunit msgid "Add Unit" msgstr "Afegeix la unitat" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "" #: lazarusidestrconsts.lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Nom de classe ambigu" #: lazarusidestrconsts.lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Nom d'unitat ambigu" #: lazarusidestrconsts.lisa2pancestortype msgid "Ancestor Type" msgstr "Tipus d'avantpassat" #: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Dependències Interrompudes" #: lazarusidestrconsts.lisa2pchooseanexistingfile msgid "" msgstr "" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "Ja existeix el nom de la classe" #: lazarusidestrconsts.lisa2pcreatenewfile msgid "Create new file" msgstr "Crea nou arxiu" #: lazarusidestrconsts.lisa2pdependency msgid "Dependency" msgstr "Dependència" #: lazarusidestrconsts.lisa2pexistingfile msgid "%sExisting file: %s%s%s" msgstr "%sFitxer existent: %s%s%s" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "Ja existeix el fitxer" #: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." msgstr "El fitxer %s%s%s ja existeix en el projecte." #: lazarusidestrconsts.lisa2pfilealreadyinpackage msgid "File already in package" msgstr "El fitxer ja és al paquet" #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" msgstr "El fitxer està essent utilitzat" #: lazarusidestrconsts.lisa2pfilename msgid "File name:" msgstr "Nom del fitxer:" #: lazarusidestrconsts.lisa2pfilename2 msgid "Filename" msgstr "Nom del fitxer" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" msgstr "El fitxer no és una unitat" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "El tipus d'avantpassat no és vàlid" #: lazarusidestrconsts.lisa2pinvalidcircle msgid "Invalid Circle" msgstr "El cercle no és vàlid" #: lazarusidestrconsts.lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "El nom de la classe no és vàlid" #: lazarusidestrconsts.lisa2pinvalidfile msgid "Invalid file" msgstr "El fitxer no és vàlid" #: lazarusidestrconsts.lisa2pinvalidfilename msgid "Invalid filename" msgstr "El nom del fitxer no és vàlid" #: lazarusidestrconsts.lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "El nom de la unitat no és vàlid" #: lazarusidestrconsts.lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." msgstr "%s%s%s no és un nom d'unitat vàlid" #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" msgstr "Nou nom de classe:" #: lazarusidestrconsts.lisa2pnewcomponent msgid "New Component" msgstr "Nou component" #: lazarusidestrconsts.lisa2pnewfile msgid "New File" msgstr "Nou Arxiu" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgstr "No s'ha trobat cap paquet per la dependència %s%s%s.%sSi us plau, escolliu un paquet existent." #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" msgstr "El nom del paquet és massa llarg" #: lazarusidestrconsts.lisa2ppalettepage msgid "Palette Page:" msgstr "Pàgina de paleta:" #: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" msgstr "Les unitats pascal han de tenir l'extensió .pp o .pas" #: lazarusidestrconsts.lisa2psavefiledialog msgid "Save file dialog" msgstr "" #: lazarusidestrconsts.lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Acurta o allarga nom d'arxiu" #: lazarusidestrconsts.lisa2pshowall msgid "Show all" msgstr "Mostra-ho tot" #: lazarusidestrconsts.lisa2pswitchpaths msgid "Switch Paths" msgstr "Commutar trajectòries" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "El tipus avantpassat %s%s%s té el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." msgstr "El tipus avantpassat %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgstr "El nom de classe %s%s%s i tipus avantpassat %s%s%s son el mateix." #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgstr "El nom de classe %s%s%s ja existeix en%s el paquet %s%sFitxer: %s%s%s" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgstr "El nom de classe %s%s%s té el mateix nom que%s la unitat %s%s%s." #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." msgstr "El nom de classe %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." msgstr "El fitxer %s%s%s ja és al paquet." #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "El fitxer %s%s%s és part del projecte actual.%sÉs una mala idea compartir fitxers entre projectes i paquets." #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." msgstr "El paquet ja té una dependència pel paquet %s%s%s." #: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgstr "El nom de paquet %s%s%s no és vàlid.%sSi us plau, escolliu un paquet existent." #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." msgstr "El nom de pàgina %s%s%s és massa llarg (max 100 car.)" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" msgstr "El nom d'unitat %s%s%s ja existeix en el paquet:%s%s" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." msgstr "El nom d'unitat %s%s%s ja existeix en aquest paquet." #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." msgstr "El nom d'unitat %s%s%s no correspon al nom de fitxer." #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." msgstr "El nom d'unitat %s%s%s és el mateix que el d'un component registrat.%sUtilitzar-lo pot causar missatges d'error estranys." #: lazarusidestrconsts.lisa2punitfilename msgid "Unit file name:" msgstr "Nom de fitxer de la unitat:" #: lazarusidestrconsts.lisa2punitfilename2 msgid "Unit File Name:" msgstr "Nom de fitxer de la unitat:" #: lazarusidestrconsts.lisa2punitname msgid "Unit Name:" msgstr "Nom de la unitat:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts.lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "El nom de la unitat no és vàlid" #: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" msgstr "Explora la unitat per nom d'unitat i procediment de registre" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" msgstr "" #: lazarusidestrconsts.lisabcreationfailed msgid "Error occured during Application Bundle creation: " msgstr "" #: lazarusidestrconsts.lisabortall msgid "Abort all" msgstr "Avortar tot" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" msgstr "Avorta totes les càrregues" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" msgstr "Avorta carrega del projecte" #: lazarusidestrconsts.lisabortwholeloading msgid "Abort whole loading" msgstr "" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" msgstr "" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" msgstr "Quant al Lazarus" #: lazarusidestrconsts.lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." msgstr "" #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." msgstr "" #: lazarusidestrconsts.lisaboutofficial msgid "Official:" msgstr "" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "Un %s no pot manegar TControls. %sNomés hi podeu posar components no visuals." #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" msgstr "" #: lazarusidestrconsts.lisaction msgid "Action:" msgstr "" #: lazarusidestrconsts.lisactions msgid "Actions:" msgstr "" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Activa sintaxi d'expressións regulars pel texte i reemplaçament (més similar a perl)" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" msgstr "" #: lazarusidestrconsts.lisadddirectory msgid "Add directory" msgstr "" #: lazarusidestrconsts.lisaddfilesofdirectory msgid "Add files of directory" msgstr "" #: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Opcions addicionals del compilador heretades dels paquets" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" msgstr "" #: lazarusidestrconsts.lisaddpackagerequirement msgid "Add package requirement?" msgstr "" #: lazarusidestrconsts.lisaddpackagetoproject msgid "Add package %s to project?" msgstr "" #: lazarusidestrconsts.lisaddpackagetoproject2 msgid "Add package to project" msgstr "" #: lazarusidestrconsts.lisaddparameterbrackets msgid "Add parameter brackets" msgstr "" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" msgstr "Voleu afegir %s al projecte?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "" #: lazarusidestrconsts.lisaddunitinterfaces msgid "Add unit interfaces" msgstr "" #: lazarusidestrconsts.lisaddunitnotrecommended msgid "Add unit (not recommended)" msgstr "" #: lazarusidestrconsts.lisaddvalue msgid "Add value:" msgstr "" #: lazarusidestrconsts.lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Afegeix el fitxer a un paquet" #: lazarusidestrconsts.lisaf2pdestinationpackage msgid "Destination Package" msgstr "Paquet de destinació" #: lazarusidestrconsts.lisaf2pfiletype msgid "File Type" msgstr "Tipus de fitxer" #: lazarusidestrconsts.lisaf2phasregisterprocedure msgid "Has Register procedure" msgstr "Té procediment del registre" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" msgstr "El paquet no és vàlid" #: lazarusidestrconsts.lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" msgstr "L'ID del paquet no és vàlida: %s%s%s" #: lazarusidestrconsts.lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" msgstr "Unitat virtual (el codi font no és al paquet)" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "El paquet només és de lectura" #: lazarusidestrconsts.lisaf2ppackagenotfound msgid "Package %s%s%s not found." msgstr "No s'ha trobat el paquet %s%s%s." #: lazarusidestrconsts.lisaf2pshowall msgid "Show All" msgstr "Mostra-ho tot" #: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage" msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts.lisaf2pthepackageisreadonly msgid "The package %s is read only." msgstr "El paquet %s és de només lectura." #: lazarusidestrconsts.lisaf2punitname msgid "Unit Name: " msgstr "Nom de la unitat: " #: lazarusidestrconsts.lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Ja existeix un fitxer %s%s%s. %sVoleu que el substitueixi?" #: lazarusidestrconsts.lisalignment msgid "Alignment" msgstr "Alineació" #: lazarusidestrconsts.lisallblockslooksok msgid "All blocks looks ok." msgstr "Tots els blocs semblen correctes." #: lazarusidestrconsts.lisallfiles msgid "All Files" msgstr "Tots els arxius" #: lazarusidestrconsts.lisallinheritedoptions msgid "All inherited options" msgstr "" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" msgstr "" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Permet la recerca per múltiples línies" #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened msgid "All your modifications to %s%s%s%swill be lost and the file reopened." msgstr "" #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" msgstr "" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts.lisalways msgid "Always" msgstr "" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" msgstr "" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" msgstr "" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgstr "" #: lazarusidestrconsts.lisambiguousfilesfound msgid "Ambiguous files found" msgstr "" #: lazarusidestrconsts.lisambiguousunitfound msgid "Ambiguous Unit found" msgstr "" #: lazarusidestrconsts.lisambiguousunitfound2 msgid "Ambiguous unit found" msgstr "" #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "" #: lazarusidestrconsts.lisanchorenabledhint msgid "Enabled = Include %s in Anchors" msgstr "" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "" #: lazarusidestrconsts.lisanchortobottomsidekeepborderspace msgid "Anchor to bottom side of sibling, keep border space" msgstr "" #: lazarusidestrconsts.lisanchortoleftsidekeepborderspace msgid "Anchor to left side of sibling, keep border space" msgstr "" #: lazarusidestrconsts.lisanchortorightsidekeepborderspace msgid "Anchor to right side of sibling, keep border space" msgstr "" #: lazarusidestrconsts.lisanchortotopsidekeepborderspace msgid "Anchor to top side of sibling, keep border space" msgstr "" #: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgstr "Va ocorrer un error durant l'ultima execució mentre s'hi carregava %s!%s%sCarregar aquest projecte de nou?" #: lazarusidestrconsts.lisappendshortdescriptiontolongdescription msgid "Append short description to long description" msgstr "" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." msgstr "Aplicació%sUn programa gràfic lcl/freepascal. El Lazarus manté automàticament el fitxer del programa" #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" msgstr "" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "apply build flags (-B) to dependencies too" msgstr "" #: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects msgid "A project unit can not be used by other packages/projects" msgstr "" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "" #: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." msgstr "" #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Demana abans de reemplaçar cada text trobat" #: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform msgid "Ask for component name after putting it on a designer form" msgstr "" #: lazarusidestrconsts.lisaskforfilenameonnewfile msgid "Ask for file name on new file" msgstr "" #: lazarusidestrconsts.lisasknameoncreate msgid "Ask name on create" msgstr "" #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" msgstr "" #: lazarusidestrconsts.lisautocompletionon msgid "Auto completion: on" msgstr "" #: lazarusidestrconsts.lisautocontinue msgid "Auto Continue" msgstr "" #: lazarusidestrconsts.lisautocontinueafter msgid "Auto continue after:" msgstr "" #: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles msgid "Automatically convert .lfm files to .lrs include files" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" msgstr "" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" msgstr "" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" msgstr "" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" msgstr "" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" msgstr "" #: lazarusidestrconsts.lisautomaticfeatures msgid "Automatic features" msgstr "" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" msgstr "" #: lazarusidestrconsts.lisavailablepackages msgid "Available packages" msgstr "Paquets disponibles" #: lazarusidestrconsts.lisbackupchangedfiles msgid "Make backup of changed files" msgstr "" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" msgstr "Ha fallat la còpia de seguretat" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Canviar el nom del paquet o versió, trenca les dependències. Voleu canviar aquestes dependències també?%sSeleccioneu Si per canviar totes les dependències llistades.%sSeleccioneu - Ignora - per trencar les dependències i continuar." #: lazarusidestrconsts.lisbegins msgid "begins" msgstr "" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" msgstr "" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always Build before Run" msgstr "" #: lazarusidestrconsts.lisbfbuild msgctxt "lazarusidestrconsts.lisbfbuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lisbfbuildcommand msgid "Build Command" msgstr "" #: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts.lisbfrun msgctxt "lazarusidestrconsts.lisbfrun" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.lisbfruncommand msgid "Run Command" msgstr "" #: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor ..." msgstr "" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (Leave empty for file path)" msgstr "" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2 msgid "Working Directory (Leave empty for file path)" msgstr "" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" msgstr "" #: lazarusidestrconsts.lisborderspace msgid "BorderSpace" msgstr "" #: lazarusidestrconsts.lisbottom msgctxt "lazarusidestrconsts.lisbottom" msgid "Bottom" msgstr "" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "" #: lazarusidestrconsts.lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" msgstr "Inferiors" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisbottomspaceequally msgid "Bottom space equally" msgstr "Iguala els espais inferiors" #: lazarusidestrconsts.lisbreak msgctxt "lazarusidestrconsts.lisbreak" msgid "Break" msgstr "" #: lazarusidestrconsts.lisbreakpointproperties msgid "Breakpoint Properties" msgstr "" #: lazarusidestrconsts.lisbrowseforcompiler msgid "Browse for Compiler (%s)" msgstr "Navega pel Compilador (%s)" #: lazarusidestrconsts.lisbtnbreak msgctxt "lazarusidestrconsts.lisbtnbreak" msgid "Break" msgstr "" #: lazarusidestrconsts.lisbtncontinue msgctxt "lazarusidestrconsts.lisbtncontinue" msgid "Continue" msgstr "Continuar" #: lazarusidestrconsts.lisbtnfind msgid "&Find" msgstr "" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" msgstr "" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "build all files of project/package/IDE" msgstr "" #: lazarusidestrconsts.lisbuildidewithpackages msgid "build IDE with packages" msgstr "" #: lazarusidestrconsts.lisbuildinglazarusfailed msgid "Building Lazarus failed" msgstr "" #: lazarusidestrconsts.lisbuildmode msgid "Build mode" msgstr "" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" msgstr "Munta un projecte nou" #: lazarusidestrconsts.lisbuildnumber msgid "Build Number" msgstr "Munta el número" #: lazarusidestrconsts.lisbuildvariables msgid "Build variables" msgstr "" #: lazarusidestrconsts.liscallingtocreatemakefilefromfailed msgid "Calling %s to create Makefile from %s failed." msgstr "" #: lazarusidestrconsts.liscancel msgctxt "lazarusidestrconsts.liscancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "" #: lazarusidestrconsts.liscancelloadingunit msgid "Cancel loading unit" msgstr "Cancel·lar carrega de l'unitat" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" msgstr "Cancel·la canvi de nom" #: lazarusidestrconsts.liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "No es pot copiar el component de nivell superior." #: lazarusidestrconsts.liscannotcreatefile msgid "Can not create file %s%s%s" msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts.liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" msgstr "No es pot trobar l'iniciador del Lazarus:%s%s" #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "" #: lazarusidestrconsts.lisccdchangeclassof msgid "Change Class of %s" msgstr "" #: lazarusidestrconsts.lisccdnoclass msgid "no class" msgstr "" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "" #: lazarusidestrconsts.lisccochecktestdir msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects" msgstr "" #: lazarusidestrconsts.lisccocompilernotanexe msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "" #: lazarusidestrconsts.lisccocontains msgid "contains " msgstr "" #: lazarusidestrconsts.lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "" #: lazarusidestrconsts.lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "" #: lazarusidestrconsts.lisccoenglishmessagefilemissing msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg" msgstr "" #: lazarusidestrconsts.lisccoerrorcaption msgctxt "lazarusidestrconsts.lisccoerrorcaption" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " msgstr "" #: lazarusidestrconsts.lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "" #: lazarusidestrconsts.lisccohasnewline msgid "new line symbols" msgstr "" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " msgstr "" #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" msgstr "" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" msgstr "" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" msgstr "" #: lazarusidestrconsts.lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" msgstr "" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" msgstr "" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" msgstr "" #: lazarusidestrconsts.lisccoppuexiststwice msgid "ppu exists twice: %s, %s" msgstr "" #: lazarusidestrconsts.lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." msgstr "" #: lazarusidestrconsts.lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "" #: lazarusidestrconsts.lisccorelunitpathfoundincfg msgid "relative unit path found in fpc cfg: %s" msgstr "" #: lazarusidestrconsts.lisccoseveralcompilers msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "" #: lazarusidestrconsts.lisccoskip msgid "Skip" msgstr "" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" msgstr "" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." msgstr "" #: lazarusidestrconsts.lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "" #: lazarusidestrconsts.lisccounabletocreatetestpascalfile msgid "Unable to create Test pascal file \"%s\"." msgstr "" #: lazarusidestrconsts.lisccounabletogetfiledate msgid "Unable to get file date of %s." msgstr "" #: lazarusidestrconsts.lisccounusualchars msgid "unusual characters" msgstr "" #: lazarusidestrconsts.lisccowarningcaption msgid "Warning" msgstr "" #: lazarusidestrconsts.lisccowarningmsg msgid "WARNING: " msgstr "" #: lazarusidestrconsts.lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "" #: lazarusidestrconsts.liscecategories msgid "Categories" msgstr "" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" msgstr "" #: lazarusidestrconsts.lisceconstants msgid "Constants" msgstr "" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" msgstr "" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" msgstr "" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" msgstr "" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" msgstr "" #: lazarusidestrconsts.liscefilter msgid "(Filter)" msgstr "(Filtre)" #: lazarusidestrconsts.liscefollowcursor msgid "Follow cursor" msgstr "" #: lazarusidestrconsts.liscein msgid "%s in %s" msgstr "" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" msgstr "" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" msgstr "" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" msgstr "" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" msgstr "" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" msgstr "" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" msgstr "" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" msgstr "" #: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling" msgstr "" #: lazarusidestrconsts.liscenterform msgid "Center form" msgstr "" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" msgstr "Centra a la finestra" #: lazarusidestrconsts.liscenters msgid "Centers" msgstr "Centres" #: lazarusidestrconsts.lisceomode msgid "Preferred Exhibition Mode" msgstr "" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" msgstr "" #: lazarusidestrconsts.lisceomodesource msgid "Source" msgstr "" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" msgstr "Mai, sols manualment" #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "" #: lazarusidestrconsts.lisceoonidle msgid "On idle" msgstr "" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" msgstr "Actualitza automàticament" #: lazarusidestrconsts.lisceothergroup msgctxt "lazarusidestrconsts.lisceothergroup" msgid "Other" msgstr "Altres" #: lazarusidestrconsts.lisceoupdate msgid "Update" msgstr "" #: lazarusidestrconsts.lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "" #: lazarusidestrconsts.lisceprocedures msgid "Procedures" msgstr "" #: lazarusidestrconsts.lisceproperties msgctxt "lazarusidestrconsts.lisceproperties" msgid "Properties" msgstr "" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" msgstr "" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observerations about" msgstr "" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" msgstr "" #: lazarusidestrconsts.liscetodos msgid "ToDos" msgstr "" #: lazarusidestrconsts.liscetypes msgid "Types" msgstr "" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" msgstr "" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" msgstr "" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" msgstr "" #: lazarusidestrconsts.lisceuses msgctxt "lazarusidestrconsts.lisceuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.liscevariables msgid "Variables" msgstr "" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" msgstr "" #: lazarusidestrconsts.lischangeclass msgid "Change Class" msgstr "Canvia la Classe" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" msgstr "" #: lazarusidestrconsts.lischangefile msgid "Change file" msgstr "" #: lazarusidestrconsts.lischangeparent msgid "Change Parent..." msgstr "" #: lazarusidestrconsts.lischaracter msgid "Character" msgstr "" #: lazarusidestrconsts.lischaractermap msgid "Character Map" msgstr "Mapa de Caràcters" #: lazarusidestrconsts.lischeckchangesondiskwithloading msgid "Check changes on disk with loading" msgstr "" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "check if the next token in source is an end and if not returns lineend + end; + lineend" msgstr "" #: lazarusidestrconsts.lischeckoptions msgid "Check options" msgstr "" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" msgstr "Tria un nom diferent" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." msgstr "" #: lazarusidestrconsts.lischooseanameforthenewcomponent msgid "Choose a name for the new component" msgstr "" #: lazarusidestrconsts.lischooseapascalfileforindentationexamples msgid "Choose a pascal file for indentation examples" msgstr "" #: lazarusidestrconsts.lischoosecompilerpath msgid "Choose compiler filename (%s)" msgstr "Tria el nom del fitxer del compilador (%s)" #: lazarusidestrconsts.lischoosedebuggerpath msgid "Choose debugger filename" msgstr "Tria el nom del depurador" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Tria una unitat Delphi (*.pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" msgstr "Tria el directori" #: lazarusidestrconsts.lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "Tria un directori del codi font del FPC" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "Tria un directori del Lazarus" #: lazarusidestrconsts.lischoosemakepath msgid "Choose make path" msgstr "Tria la trajectòria per a crear" #: lazarusidestrconsts.lischoosename msgid "Choose name" msgstr "" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "Tria un dels següents elements per crear un nou Arxiu" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "Tria un dels següents elements per crear un nou Paquet" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "Tra un dels següents elements per crear un nou Projecte" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Tria el codi font del programa (*.pp, *.pas, *.lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Tria l'estructura per a contenir la selecció" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" msgstr "" #: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." msgstr "" #: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked msgid "Classes and properties exist. Values were not checked." msgstr "" #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgstr "La classe %s%s%s no està registrada com a component de classe. %sNo es pot enganxar" #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" msgstr "No s'ha trobat la classe" #: lazarusidestrconsts.lisclassofmethodnotfound msgid "Class %s%s%s of method %s%s%s not found." msgstr "" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" msgstr "Neteja el directori" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" msgstr "Neteja els subdirectoris" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Manté tots els fitxers de text" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "Manté els fitxers que coincideixin amb el filtre" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "Elimina els fitxers que concordin amb el filtre" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Sintaxi simple (p.ex. * en lloc de .*)" #: lazarusidestrconsts.liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Neteja el codi del Lazarus" #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" msgstr "" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" msgstr "" #: lazarusidestrconsts.lisclearkeymapping msgid "Clear Key Mapping" msgstr "" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "" #: lazarusidestrconsts.lisclose msgid "&Close" msgstr "Tan&ca" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "Opcions específiques de l'interfície LCL" #: lazarusidestrconsts.liscmparameter msgid "Parameter" msgstr "Paràmetre" #: lazarusidestrconsts.liscmplstcomponents msgctxt "lazarusidestrconsts.liscmplstcomponents" msgid "Components" msgstr "" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" msgstr "" #: lazarusidestrconsts.liscmplstlist msgid "List" msgstr "" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" msgstr "" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "" #: lazarusidestrconsts.liscocallon msgid "Call on:" msgstr "Marqueu:" #: lazarusidestrconsts.liscocallonbuild msgctxt "lazarusidestrconsts.liscocallonbuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.liscocalloncompile msgctxt "lazarusidestrconsts.liscocalloncompile" msgid "Compile" msgstr "Compila" #: lazarusidestrconsts.liscocallonrun msgctxt "lazarusidestrconsts.liscocallonrun" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "%s%sClica D'Acord si estàs segur de fer-ho." #: lazarusidestrconsts.liscocommand msgctxt "lazarusidestrconsts.liscocommand" msgid "Command:" msgstr "Ordre:" #: lazarusidestrconsts.liscodebrowser msgid "Code browser" msgstr "" #: lazarusidestrconsts.liscodeexplorer msgctxt "lazarusidestrconsts.liscodeexplorer" msgid "Code Explorer" msgstr "" #: lazarusidestrconsts.liscodefault msgid "default (%s)" msgstr "pred. (%s)" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" msgstr "" #: lazarusidestrconsts.liscodehelpaddlinkbutton msgid "Add link" msgstr "Afegeix enllaçament" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" msgstr "Afegeix trajectòria" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" msgstr "" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" msgstr "" #: lazarusidestrconsts.liscodehelpcreatebutton msgid "Create help item" msgstr "" #: lazarusidestrconsts.liscodehelpdeletelinkbutton msgid "Delete link" msgstr "" #: lazarusidestrconsts.liscodehelpdeletepathbutton msgid "Remove path" msgstr "" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" msgstr "" #: lazarusidestrconsts.liscodehelperrorstag msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" msgstr "" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" msgstr "Ejemple" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "Insereix marca de formateig en cursiva" #: lazarusidestrconsts.liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintvartag msgid "Insert var formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpinherited msgctxt "lazarusidestrconsts.liscodehelpinherited" msgid "Inherited" msgstr "Heretat" #: lazarusidestrconsts.liscodehelpinsertalink msgid "Insert a link ..." msgstr "" #: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpmainformcaption msgid "FPDoc editor" msgstr "" #: lazarusidestrconsts.liscodehelpnodocumentation msgctxt "lazarusidestrconsts.liscodehelpnodocumentation" msgid "(none)" msgstr "" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" msgstr "" #: lazarusidestrconsts.liscodehelppathsgroupbox msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox" msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts.liscodehelpreplacebutton msgctxt "lazarusidestrconsts.liscodehelpreplacebutton" msgid "Replace" msgstr "" #: lazarusidestrconsts.liscodehelpsavebutton msgctxt "lazarusidestrconsts.liscodehelpsavebutton" msgid "Save" msgstr "" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" msgstr "Vore tambè" #: lazarusidestrconsts.liscodehelpshortdescriptionof msgid "Short description of" msgstr "" #: lazarusidestrconsts.liscodehelpshorttag msgid "Short" msgstr "" #: lazarusidestrconsts.liscodehelpshowemptymethods msgid "Show empty methods" msgstr "" #: lazarusidestrconsts.liscodehelpshowunusedunits msgid "Show unused units" msgstr "" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" msgstr "" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" msgstr "" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" msgstr "" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" msgstr "" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" msgid "Add" msgstr "Afegeix" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" msgstr "Afegeix la plantilla del codi" #: lazarusidestrconsts.liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " msgstr "Ja existeix un testimoni %s%s%s !" #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on ..." msgstr "" #: lazarusidestrconsts.liscodetemplchange msgctxt "lazarusidestrconsts.liscodetemplchange" msgid "Change" msgstr "Canvia" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" msgstr "Comentari:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" msgstr "Edita la plantilla del codi" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.liscodetempltoken msgid "Token:" msgstr "Testimoni" #: lazarusidestrconsts.liscodetools msgid "CodeTools" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsaction msgid "Action: %s" msgstr "Acció: %s" #: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "Els nodes generats automàticament ni es poden editar, %sni poden tenir nodes fills" #: lazarusidestrconsts.liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "%s, generat automàticament" #: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." msgstr "Els nodes generats automàticament no poden ser editats" #: lazarusidestrconsts.liscodetoolsdefsblock msgid "Block" msgstr "Bloc" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "Editor de les definicions de les eines del codi" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" msgstr "Vista Prèvia de les definicions de les eines del codi" #: lazarusidestrconsts.liscodetoolsdefscompilerpath msgid "compiler path" msgstr "trajectòria del compilador" #: lazarusidestrconsts.liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Converteix el node" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "Crea les definicions pel directori %s" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "Crea les definicions pel compilador Free Pascal" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal SVN Sources" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" msgstr "Crea les definicions pel directori del Lazarus" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" msgstr "Crea les definicions pel projecte %s" #: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "Crea les macroinstruccions FPC i les trajectòries per un directori de projecte FPC" #: lazarusidestrconsts.liscodetoolsdefsdefine msgid "Define" msgstr "Defineix" #: lazarusidestrconsts.liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "Defineix el recurs" #: lazarusidestrconsts.liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Elimina el node" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "El %s directori principal, %s on Borland a instal·lat totes les fonts %s. Per exemple: C:/Programme/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "El directori principal %s, on Borland ha instal·lat totes les fonts %s i que son utilitzades per aquest projecte.%s Per exemple: C:/Programme/Borland/Delphi%s" #: lazarusidestrconsts.liscodetoolsdefsdescription msgid "Description:" msgstr "Descripció" #: lazarusidestrconsts.liscodetoolsdefsdirectory msgid "%s directory" msgstr "%s directori" #: lazarusidestrconsts.liscodetoolsdefsedit msgctxt "lazarusidestrconsts.liscodetoolsdefsedit" msgid "Edit" msgstr "Edita" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" msgstr "Else" #: lazarusidestrconsts.liscodetoolsdefselseif msgid "ElseIf" msgstr "ElseIf" #: lazarusidestrconsts.liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" msgstr "S'ha produït un error mentre es llegia %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" msgstr "S'ha produït un error mentre es llegia el fitxer d'informació del projecte %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" msgstr "S'ha produït un error mentre s'escrivia %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" msgstr "S'ha produït un error mentre s'escrivia l'informació del projecte al fitxer %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefsexit msgctxt "lazarusidestrconsts.liscodetoolsdefsexit" msgid "Exit" msgstr "Surt" #: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave msgid "Exit without Save" msgstr "Surt sense desar" #: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC SVN source directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsif msgid "If" msgstr "If" #: lazarusidestrconsts.liscodetoolsdefsifdef msgid "IfDef" msgstr "IfDef" #: lazarusidestrconsts.liscodetoolsdefsifndef msgid "IfNDef" msgstr "IfNDef" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Directori" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "Insereix plantilla del directori del Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "Insereix plantilla de projecte Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "Insereix plantilla del directori del Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "Insereix plantilla del projecte Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "Insereix plantilla del compilador Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "Insereix plantilla de projecte Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "Insereix plantilla del compilador Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "Insereix plantilla del projecte Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "Insereix plantilla del compilador Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "Insereix plantilla del directori Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "Insereix plantilla de projecte Kylix 3" #: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "Insereix plantilla del directori Lazarus" #: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "Insereix el node com a fill" #: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "Insereix el node avall" #: lazarusidestrconsts.liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "Insereix la plantilla" #: lazarusidestrconsts.liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "El pare no és vàlid" #: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "El node pare no és vàlid" #: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "El node anterior no és vàlid" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s,%si que son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" #: lazarusidestrconsts.liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" msgstr "Directori del Lazarus" #: lazarusidestrconsts.liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "Mou el node avall" #: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "Mou el node un nivell avall" #: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "Mou el node un nivell amunt" #: lazarusidestrconsts.liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "Mou el node amunt" #: lazarusidestrconsts.liscodetoolsdefsname msgctxt "lazarusidestrconsts.liscodetoolsdefsname" msgid "Name:" msgstr "Nom:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" msgstr "Nou node" #: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "El node i el seu fill només son vàlids per aquest projecte" #: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "El node és només de lectura" #: lazarusidestrconsts.liscodetoolsdefsnoneselected msgid "none selected" msgstr "cap de seleccionat" #: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." msgstr "El node pare no pot contenir nodes fills" #: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "El node anterior no pot contenir nodes fill" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 msgid "%s project directory" msgstr "directori del projecte %s" #: lazarusidestrconsts.liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsreaderror msgid "Read error" msgstr "S'ha produït un error de lectura" #: lazarusidestrconsts.liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "Desa i surt" #: lazarusidestrconsts.liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Node seleccionat" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "El directori del projecte Free Pascal" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal SVN source directory." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." msgstr "El directori principal del Lazarus" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "La trajectòria al compilador Free Pascal.%s Per exemple %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etcfpc.cfg%s." #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "El directori del projecte %s, %s el qual conté el fitxer .dpr, dpk" #: lazarusidestrconsts.liscodetoolsdefsundefine msgid "Undefine" msgstr "Indefineix" #: lazarusidestrconsts.liscodetoolsdefsundefineall msgid "Undefine All" msgstr "Indefineix-ho tot" #: lazarusidestrconsts.liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "Indefineix el recurs" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Valor com a text" #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" msgstr "variable:" #: lazarusidestrconsts.liscodetoolsdefswriteerror msgid "Write error" msgstr "S'ha produït un error d'escriptura" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" msgstr "A" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" msgstr "" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" msgstr "Dos punts" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" msgstr "Coma" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" msgid "Identifier" msgstr "Identificador" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" msgstr "Paraula clau" #: lazarusidestrconsts.liscodetoolsoptsnewline msgid "Newline" msgstr "Nova línia" #: lazarusidestrconsts.liscodetoolsoptsnone msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" msgstr "Número" #: lazarusidestrconsts.liscodetoolsoptsok msgctxt "lazarusidestrconsts.liscodetoolsoptsok" msgid "Ok" msgstr "D'acord" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" msgstr "Punt" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Punt i coma" #: lazarusidestrconsts.liscodetoolsoptsspace msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" msgid "Space" msgstr "Espaiat" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" msgstr "Constant alfanumèrica" #: lazarusidestrconsts.liscodetoolsoptssymbol msgid "Symbol" msgstr "Símbol" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" msgstr "Executa després de" #: lazarusidestrconsts.liscoexecutebefore msgid "Execute before" msgstr "Executa abans de" #: lazarusidestrconsts.liscollapseallclasses msgid "Collapse all classes" msgstr "" #: lazarusidestrconsts.liscollapseallpackages msgid "Collapse all packages" msgstr "" #: lazarusidestrconsts.liscollapseallunits msgid "Collapse all units" msgstr "" #: lazarusidestrconsts.liscommandafter msgid "Command after" msgstr "" #: lazarusidestrconsts.liscommandafterinvalid msgid "Command after invalid" msgstr "Ordre no vàlida" #: lazarusidestrconsts.liscommandafterpublishingmodule msgid "Command after publishing module" msgstr "Ordre després de publicar el mòdul" #: lazarusidestrconsts.liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Paràmetres de la línia d'ordres del programa" #: lazarusidestrconsts.liscompileidewithoutlinking msgid "Compile IDE (without linking)" msgstr "Compila l'IDE (sense enllaçar)" #: lazarusidestrconsts.liscompiler msgid "Compiler" msgstr "Compilador" #: lazarusidestrconsts.liscompilererror msgid "Compiler error" msgstr "S'ha produït un error del compilador" #: lazarusidestrconsts.liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" msgstr "S'ha produït un error: el compilador %s no és vàlid." #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" msgstr "Nom del fitxer del compilador" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgstr "Suggeriment: podeu triar la trajectòria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectòria del compilador" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "Nota: No s'ha trobat el fitxer de configuració de les eines del codi, s'utilitzen els valors predeterminats" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "Nota: S'està carregant el fitxer de les opcions de les eines del codi antic: " #: lazarusidestrconsts.liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "Opcions del compilador pel projecte: %s" #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" msgstr "%s (s'està compilant ...)" #: lazarusidestrconsts.liscomponent msgid "Component" msgstr "" #: lazarusidestrconsts.liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" msgstr "El nom de component %s%s%s és paraula clau" #: lazarusidestrconsts.liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" msgstr "El nom de component %s%s%s no és un identificador vàlid" #: lazarusidestrconsts.liscomppalfindcomponent msgid "Find component" msgstr "Cerca component" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" msgstr "Obre el paquet" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" msgstr "Obre la unitat" #: lazarusidestrconsts.liscomptest #, fuzzy #| msgid "Test" msgctxt "lazarusidestrconsts.liscomptest" msgid "&Test" msgstr "Prova" #: lazarusidestrconsts.liscondition msgid "Condition" msgstr "" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" msgstr "Directori de configuració del Lazarus" #: lazarusidestrconsts.lisconfigurebuild msgid "Configure Build %s" msgstr "" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" msgstr "" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" msgstr "Confirma els canvis" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" msgstr "" #: lazarusidestrconsts.lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" msgstr "Vols reconstruïr Lazarus?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "" #: lazarusidestrconsts.lisconfirmpackageaction msgctxt "lazarusidestrconsts.lisconfirmpackageaction" msgid "Action" msgstr "" #: lazarusidestrconsts.lisconfirmpackagenewpackageset msgid "New package set" msgstr "" #: lazarusidestrconsts.lisconfirmpackageoldpackageset msgid "Old package set" msgstr "" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" msgstr "" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" msgstr "" #: lazarusidestrconsts.liscontains msgid "contains" msgstr "" #: lazarusidestrconsts.liscontextsensitive msgid "Context sensitive" msgstr "" #: lazarusidestrconsts.liscontinue msgctxt "lazarusidestrconsts.liscontinue" msgid "Continue" msgstr "Continuar" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Continua sense carregar la forma" #: lazarusidestrconsts.liscontributors msgid "Contributors" msgstr "" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" msgstr "El control necessita pare" #: lazarusidestrconsts.lisconvautoremoveproperties msgid "Automatic removal of unknown properties" msgstr "" #: lazarusidestrconsts.lisconversionerror msgid "Conversion error" msgstr "S'ha produït un error de conversió" #: lazarusidestrconsts.lisconvert msgid "Convert" msgstr "" #: lazarusidestrconsts.lisconvertencoding msgid "Convert encoding" msgstr "" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" msgstr "" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" msgstr "" #: lazarusidestrconsts.lisconverttarget1 msgid "Lazarus/LCL" msgstr "" #: lazarusidestrconsts.lisconverttarget2 msgid "Lazarus/LCL for Windows only" msgstr "" #: lazarusidestrconsts.lisconverttarget3 msgid "Both Lazarus/LCL and Delphi" msgstr "" #: lazarusidestrconsts.lisconvtypereplacements msgid "Type Replacements" msgstr "" #: lazarusidestrconsts.lisconvtypestoreplace msgid "Types to replace" msgstr "" #: lazarusidestrconsts.lisconvunitreplacements msgid "Unit Replacements" msgstr "" #: lazarusidestrconsts.lisconvunitstoreplace msgid "Units to replace" msgstr "" #: lazarusidestrconsts.lisconvunitstypesproperties msgid "Units, Types and Properties" msgstr "" #: lazarusidestrconsts.liscopyall msgid "Copy All" msgstr "" #: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" msgstr "" #: lazarusidestrconsts.liscopyallitemstoclipboard msgid "Copy all items to clipboard" msgstr "" #: lazarusidestrconsts.liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" msgstr "Copia tots els missatges al porta-retalls" #: lazarusidestrconsts.liscopyalloutputclipboard msgid "Copy all output to clipboard" msgstr "" #: lazarusidestrconsts.liscopydescription msgid "Copy description to clipboard" msgstr "" #: lazarusidestrconsts.liscopyerror msgid "Copy Error" msgstr "S'ha produït un error de còpia" #: lazarusidestrconsts.liscopyerror2 msgid "Copy error" msgstr "S'ha produït un error de còpia" #: lazarusidestrconsts.liscopyidentifier msgid "Copy %s%s%s to clipboard" msgstr "" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "Copiar una forma sencera no està implementat." #: lazarusidestrconsts.liscopyitemtoclipboard msgid "Copy item to clipboard" msgstr "" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy selected items to clipboard" msgstr "" #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" msgstr "" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "Explora els missatges del FPC" #: lazarusidestrconsts.liscoscanformakemessages msgid "Scan for Make messages" msgstr "Explora els missatges de Make" #: lazarusidestrconsts.liscoshowallmessages msgid "Show all messages" msgstr "Mostra tots els missatges" #: lazarusidestrconsts.liscoskipcallingcompiler msgid "Skip calling Compiler" msgstr "No cridis el compilador" #: lazarusidestrconsts.liscotargetosspecificoptions msgid "Target OS specific options" msgstr "Opcions especifiques del SO de destinació" #: lazarusidestrconsts.liscouldnotadditomainsource msgid "Could not add %s{$I %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddrtomainsource msgid "Could not add %s{$R %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddtomainsource msgid "Could not add %s%s%s to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremovefrommainsource msgid "Could not remove %s%s%s from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoveifrommainsource msgid "Could not remove %s{$I %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoverfrommainsource msgid "Could not remove %s{$R %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscovarious msgid "%s (various)" msgstr "%s (varis)" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Avís: El fitxer de configuració addicional del compilador té el mateix nom que un dels fitxers normalitzats de configuració que utilitza el FreePascal. Això pot comportar que NOMÉS s'analitzi el fitxer addicional i es salti el normalitzat." #: lazarusidestrconsts.liscpopenpackage msgid "Open Package %s" msgstr "Obre Paquet %s" #: lazarusidestrconsts.liscpopenunit msgid "Open Unit %s" msgstr "Obre Unitat %s" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" msgstr "Creeu primer un projecte!" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" msgstr "" #: lazarusidestrconsts.liscreatefunction msgid "Create function" msgstr "" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" msgstr "" #: lazarusidestrconsts.liscreateit msgid "Create it" msgstr "" #: lazarusidestrconsts.liscreatenewproject msgid "Create new project" msgstr "" #: lazarusidestrconsts.liscreateproject msgid "Create project" msgstr "" #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" msgstr "Tria un directori" #: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "Valors del directori de les eines del codi" #: lazarusidestrconsts.lisctdefdefinetemplates msgid "Define templates" msgstr "Defineix plantilles" #: lazarusidestrconsts.lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts.lisctdefsopenpreview msgid "Open Preview" msgstr "Obre la vista prèvia" #: lazarusidestrconsts.lisctdefstools msgid "Tools" msgstr "Eines" #: lazarusidestrconsts.lisctdefvariable msgid "Variable: %s" msgstr "Variable: %s" #: lazarusidestrconsts.lisctdefvariablename msgid "Variable Name" msgstr "Nom de la variable" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" msgstr "Plantilles" #: lazarusidestrconsts.lisctinsertmacro msgid "Insert Macro" msgstr "Insereix Macroinstrucció" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" msgstr "Per favor sel·lecciona una macroinstrucció" #: lazarusidestrconsts.lisctselectcodemacro msgid "Select Code Macro" msgstr "Sel·lecciona Macroinstrucció de Codi" #: lazarusidestrconsts.liscurrent msgid "Current" msgstr "" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Columna del cursor en l'editor actual" #: lazarusidestrconsts.liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "La línia del cursor en l'editor actual" #: lazarusidestrconsts.liscustomoptions msgid "custom options" msgstr "opcions personalitzades" #: lazarusidestrconsts.liscustomoptions2 msgid "Custom options" msgstr "Opcions personalitzades" #: lazarusidestrconsts.liscustomprogram msgid "Custom Program" msgstr "Programa personalitzat" #: lazarusidestrconsts.liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." msgstr "Programa personalitzat%sUn programa FreePascal." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" msgstr "" #: lazarusidestrconsts.lisdate msgid "Date" msgstr "Data" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "No s'ha especificat cap depurador" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgstr "No s'hi ha especificat cap depurador.%sEstablir punts de parada no tindrà cap efecte fins que configures un depurador al dialeg d'opcións del depurador en el menú." #: lazarusidestrconsts.lisdebuggererror msgid "Debugger error" msgstr "S'ha produït un error del depurador" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgstr "S'ha produït un error del depurador%sAtenció!! el depurador a entrat en estat d'error%sDeseu el vostre treball ara mateix!!%sPremeu Atura i espereu el millor ..." #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" msgstr "Depurador invàlid" #: lazarusidestrconsts.lisdebugging msgid "%s (debugging ...)" msgstr "%s (s'està depurant ...)" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Trajectòria de cerca addicional" #: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Punt de parada" #: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Neteja la bitacora al ejecutar" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Opcions generals de depuració" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "Opcions específiques del depurador (Depen del tipus de depurador)" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgid "Event Log" msgstr "Bitàcora d'events" #: lazarusidestrconsts.lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "Gestionat per" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "Gestionat pel Depurador" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "Gestionat pel Programa" #: lazarusidestrconsts.lisdebugoptionsfrmid msgid "ID" msgstr "ID" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "Ignora aquestes excepcions" #: lazarusidestrconsts.lisdebugoptionsfrminterface msgid "Interface" msgstr "Interficie" #: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto msgid "Limit linecount to" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmname msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" msgid "Name" msgstr "Nom" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Lazarus Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmoutput msgid "Output" msgstr "Eixida" #: lazarusidestrconsts.lisdebugoptionsfrmprocess msgid "Process" msgstr "Procés" #: lazarusidestrconsts.lisdebugoptionsfrmresume msgid "Resume" msgstr "Continua" #: lazarusidestrconsts.lisdebugoptionsfrmresumehandled msgid "Resume Handled" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled msgid "Resume Unhandled" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmsignals msgid "Signals" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmthread msgid "Thread" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmwindow msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow" msgid "Window" msgstr "Finestra" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" msgstr "No es pot carregar el fitxer" #: lazarusidestrconsts.lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." msgstr "No es pot carregar el fitxer %s%s%s." #: lazarusidestrconsts.lisdecimal msgid "Decimal" msgstr "" #: lazarusidestrconsts.lisdefaultvalue msgid "Default value" msgstr "" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" msgstr "" #: lazarusidestrconsts.lisdeleteallbreakpoints msgid "Delete all breakpoints?" msgstr "" #: lazarusidestrconsts.lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" msgstr "" #: lazarusidestrconsts.lisdeleteallselectedbreakpoints msgid "Delete all selected breakpoints?" msgstr "" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Esborrar tots aquestos arxius?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "" #: lazarusidestrconsts.lisdeletebreakpoint msgid "Delete Breakpoint" msgstr "" #: lazarusidestrconsts.lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" msgstr "" #: lazarusidestrconsts.lisdeletebuildmode msgid "Delete build mode" msgstr "" #: lazarusidestrconsts.lisdeletebuildmode2 msgid "Delete build mode?" msgstr "" #: lazarusidestrconsts.lisdeletebuildmode3 msgid "Delete build mode %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletebuildvar msgid "Delete build variable %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletefilefailed msgid "Delete file failed" msgstr "Ha fallat l'eliminació del fitxer" #: lazarusidestrconsts.lisdeleteoldfile msgid "Delete old file %s%s%s?" msgstr "Voleu eliminar el fitxer antic %s%s%s?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" msgstr "" #: lazarusidestrconsts.lisdeleterow msgid "Delete row" msgstr "" #: lazarusidestrconsts.lisdeleteselectedfiles msgid "Delete selected files" msgstr "" #: lazarusidestrconsts.lisdeletesetting msgid "Delete setting" msgstr "" #: lazarusidestrconsts.lisdeletesetting2 msgid "Delete setting?" msgstr "" #: lazarusidestrconsts.lisdeletesetting3 msgid "Delete setting %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletevalue msgid "Delete value %s%s%s" msgstr "" #: lazarusidestrconsts.lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." msgstr "Ha fallat l'eliminació del fitxer %s%s%s." #: lazarusidestrconsts.lisdelphi msgid "Delphi" msgstr "" #: lazarusidestrconsts.lisdelphipackage msgid "Delphi package" msgstr "" #: lazarusidestrconsts.lisdelphiproject msgid "Delphi project" msgstr "Projecte Delphi" #: lazarusidestrconsts.lisdelphiunit msgid "Delphi unit" msgstr "" #: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename msgid "There is already another component with the name %s%s%s." msgstr "Ja hi ha un altre component amb el nom %s%s%s." #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" msgstr "Directori de destinació" #: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "El directori de destinació %s%s%s no és correcte.%sSi us plau, escolliu-ne la trajectòria completa." #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "No distingeixis entre majúscules i minúscules" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "Ignora si s'han afegit o eliminat línies buides" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "Ignora les diferències al final de la línia (p.ex. #10 = #13#10)" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "Ignora la quantitat d'espais" #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "Ignora els espais (excepte #10, #13#10)" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "Ignora els espais al final de la línia" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "Ignora els espais al començament de la línia" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" msgstr "Selecció única" #: lazarusidestrconsts.lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "Obre les diferències a l'editor" #: lazarusidestrconsts.lisdiffdlgtext1 msgid "Text1" msgstr "Text1" #: lazarusidestrconsts.lisdiffdlgtext2 msgid "Text2" msgstr "Text2" #: lazarusidestrconsts.lisdigits msgid "Digits:" msgstr "" #: lazarusidestrconsts.lisdirectives msgid "Directives" msgstr "" #: lazarusidestrconsts.lisdirectorynotfound msgid "Directory %s%s%s not found." msgstr "" #: lazarusidestrconsts.lisdirectorynotwritable msgid "Directory not writable" msgstr "" #: lazarusidestrconsts.lisdisableallinsamesource msgid "Disable All in same source" msgstr "" #: lazarusidestrconsts.lisdisablebreakpoint msgid "Disable Breakpoint" msgstr "" #: lazarusidestrconsts.lisdisabled msgid "Disabled" msgstr "" #: lazarusidestrconsts.lisdisablegroup msgid "Disable Group" msgstr "" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" msgstr "Descarta els canvis" #: lazarusidestrconsts.lisdiskdiffchangedfiles msgid "Changed files:" msgstr "Fitxers canviats:" #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Feu un clic en els elements d'amunt per veure'n les diferencies" #: lazarusidestrconsts.lisdiskdifferrorreadingfile msgid "Error reading file: %s" msgstr "S'ha produït un error mentre es llegia el fitxer: %s" #: lazarusidestrconsts.lisdiskdiffignorediskchanges msgid "Ignore disk changes" msgstr "Ignora els canvis del disc" #: lazarusidestrconsts.lisdiskdiffrevertall msgid "Reload from disk" msgstr "Torna a carregar del disc" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "Alguns fitxers han canviat al disc:" #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Distingeix entre lletres grans i petites p.ex. A i a" #: lazarusidestrconsts.lisdocumentationeditor msgid "Documentation Editor" msgstr "Editor de documentació" #: lazarusidestrconsts.lisdoesnotexists msgid "%s does not exists: %s" msgstr "" #: lazarusidestrconsts.lisdonotclosetheide msgid "Do not close the IDE" msgstr "No tanques l'IDE" #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" msgstr "" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "do not compile dependencies" msgstr "" #: lazarusidestrconsts.lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "No mostris la finestra de venvinguda" #: lazarusidestrconsts.lisdonotshowthismessageagain msgid "Do not show this message again" msgstr "" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" msgstr "" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Copia els components seleccionats al porta-retalls" #: lazarusidestrconsts.lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Retalla els components seleccionats al porta-retalls" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" msgstr "Mou component u cap enrere" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" msgstr "Mou component u cap endavant" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" msgstr "Mou component al fons" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" msgstr "Mou component al front" #: lazarusidestrconsts.lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Enganxa els components seleccionats des del porta-retalls" #: lazarusidestrconsts.lisdsgselectparentcomponent msgid "Select parent component" msgstr "Selecciona el component pare" #: lazarusidestrconsts.lisduplicatefoundofvalue msgid "Duplicate found of value %s%s%s." msgstr "" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgstr "" #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" msgstr "" #: lazarusidestrconsts.lisedoptschoosescheme msgid "Choose Scheme" msgstr "Tria un Esquema" #: lazarusidestrconsts.lisedtdefallpackages msgid "All packages" msgstr "Tots els paquets" #: lazarusidestrconsts.lisedtdefcurrentproject msgid "Current Project" msgstr "Projecte actual" #: lazarusidestrconsts.lisedtdefcurrentprojectdirectory msgid "Current Project Directory" msgstr "Directori del projecte actual" #: lazarusidestrconsts.lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" msgstr "Afegeix trajectòria font global" #: lazarusidestrconsts.lisedtdefprojectincpath msgid "Project IncPath" msgstr "IncPath del projecte" #: lazarusidestrconsts.lisedtdefprojectsrcpath msgid "Project SrcPath" msgstr "Trajectòria del codi font del projecte" #: lazarusidestrconsts.lisedtdefprojectunitpath msgid "Project UnitPath" msgstr "Trajectòria de les unitats del projecte" #: lazarusidestrconsts.lisedtdefsallprojects msgid "All projects" msgstr "Tots els projectes" #: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" msgstr "fica mode FPC a DELPHI" #: lazarusidestrconsts.lisedtdefsetfpcmodetofpc msgid "set FPC mode to FPC" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" msgstr "fica mode FPC a GPC" #: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas msgid "set FPC mode to MacPas" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" msgstr "fica mode FPC aTP" #: lazarusidestrconsts.lisedtdefsetiocheckson msgid "set IOCHECKS on" msgstr "activa IOCHECKS" #: lazarusidestrconsts.lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" msgstr "activa OVERFLOWCHECKS" #: lazarusidestrconsts.lisedtdefsetrangecheckson msgid "set RANGECHECKS on" msgstr "activa RANGECHECKS" #: lazarusidestrconsts.lisedtdefuseheaptrcunit msgid "use HeapTrc unit" msgstr "utilitza la unitat HeapTrc" #: lazarusidestrconsts.lisedtdefuselineinfounit msgid "use LineInfo unit" msgstr "utilitza la unitat LineInfo" #: lazarusidestrconsts.lisedtexttoolalt msgctxt "lazarusidestrconsts.lisedtexttoolalt" msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Una eina vàlida necessita al menys, títol i nom de fitxer" #: lazarusidestrconsts.lisedtexttoolctrl msgctxt "lazarusidestrconsts.lisedtexttoolctrl" msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" msgstr "Edita l'eina" #: lazarusidestrconsts.lisedtexttoolinsert msgid "Insert" msgstr "Insereix" #: lazarusidestrconsts.lisedtexttoolkey msgctxt "lazarusidestrconsts.lisedtexttoolkey" msgid "Key" msgstr "Tecla" #: lazarusidestrconsts.lisedtexttoolmacros msgid "Macros" msgstr "Macroinstruccions" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" msgstr "Paràmetres:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Nom de programa:" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" msgstr "Explora a la sortida els missatges del compilador Free Pascal" #: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" msgstr "Explora a la sortida els missatges de Make" #: lazarusidestrconsts.lisedtexttoolshift msgctxt "lazarusidestrconsts.lisedtexttoolshift" msgid "Shift" msgstr "Tecla de majúscules" #: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Es requereix títol i nom de fitxer" #: lazarusidestrconsts.lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Directori de treball:" #: lazarusidestrconsts.lisemdall msgid "All" msgstr "" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" msgstr "" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" msgstr "" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" msgstr "" #: lazarusidestrconsts.lisemdpublic msgid "Public" msgstr "" #: lazarusidestrconsts.lisemdpublished msgid "Published" msgstr "" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" msgstr "" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "" #: lazarusidestrconsts.lisempty msgid "Empty" msgstr "" #: lazarusidestrconsts.lisenableall msgid "&Enable All" msgstr "" #: lazarusidestrconsts.lisenableallinsamesource msgid "Enable All in same source" msgstr "" #: lazarusidestrconsts.lisenablebreakpoint msgid "Enable Breakpoint" msgstr "" #: lazarusidestrconsts.lisenabled msgctxt "lazarusidestrconsts.lisenabled" msgid "Enabled" msgstr "" #: lazarusidestrconsts.lisenablegroup msgid "Enable Group" msgstr "" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" msgstr "Permet Macroinstruccions" #: lazarusidestrconsts.lisenclose msgid "Enclose" msgstr "Tanca" #: lazarusidestrconsts.lisencloseselection msgctxt "lazarusidestrconsts.lisencloseselection" msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2 msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisentertransla msgid "Enter translation language" msgstr "Entra el llenguatge de traducció" #: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" msgstr "Fer doble clic en els missatges salta (cas contari: un clic)" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" msgstr "" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" msgstr "No s'ha trobat el directori" #: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." msgstr "No es pot trobar el directori del codi font del FPC \"%s\"" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "El nom del compilador no és vàlid" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." msgstr "El fitxer del compilador \"%s\" no és executable" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "El nom del depurador no és vàlid" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." msgstr "El fitxer del depurador \"%s\" no és executable" #: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "El directori del Lazarus \"%s\" no sembla correcte. Normalment conté directoris com lcl, debugger, designer, component, ... ." #: lazarusidestrconsts.lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "El nom del fitxer a crear no és vàlid" #: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "El fitxer make \"%s\" no és executable." #: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." msgstr "No s'ha trobat el directori del Lazarus \"%s\"" #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." msgstr "No s'ha trobat el directori de les proves \"%s\"." #: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" msgstr "Nota: Solament estàn supportades trajectòries absolutes" #: lazarusidestrconsts.liseotabwidths msgctxt "lazarusidestrconsts.liseotabwidths" msgid "Tab widths" msgstr "" #: lazarusidestrconsts.liserrinvalidoption msgid "Invalid option at position %d: \"%s\"" msgstr "" #: lazarusidestrconsts.liserrnooptionallowed msgid "Option at position %d does not allow an argument: %s" msgstr "L'opció en la posició %d no permet un argument: %s" #: lazarusidestrconsts.liserroptionneeded msgid "Option at position %d needs an argument : %s" msgstr "" #: lazarusidestrconsts.liserror msgid "Error: " msgstr "S'ha produït un error: " #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" msgstr "S'ha produït un error mentre es creava el fitxer" #: lazarusidestrconsts.liserrorcreatinglrs msgid "Error creating lrs" msgstr "S'ha produït un error mentre es creava lrs" #: lazarusidestrconsts.liserrordeletingfile msgid "Error deleting file" msgstr "S'ha produït un error mentre s'eliminava el fitxer" #: lazarusidestrconsts.liserrorin msgid "Error in %s" msgstr "Hi ha un error a %s" #: lazarusidestrconsts.liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" msgstr "S'ha produït un error mentre s'inicialitzava el programa%s%s%s%s%sError: %s" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" msgstr "" #: lazarusidestrconsts.liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" msgstr "S'ha produït un error mentre es movia el component" #: lazarusidestrconsts.liserrormovingcomponent2 msgid "Error moving component %s:%s" msgstr "S'ha produït un error mentre es movia el component %s:%s" #: lazarusidestrconsts.liserrornamingcomponent msgid "Error naming component" msgstr "" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" msgstr "" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "" #: lazarusidestrconsts.liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "S'ha produït un error mentre es llegia la llista de paquets des del fitxer%s%s%s%s" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" msgstr "" #: lazarusidestrconsts.liserrorreadingxmlfile msgid "Error reading xml file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" msgstr "S'ha produït un error mentre es canviava el nom del fitxer" #: lazarusidestrconsts.liserrors msgctxt "lazarusidestrconsts.liserrors" msgid "Errors" msgstr "Errors" #: lazarusidestrconsts.liserrorsavingto msgid "Error saving %s to%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrorsettingthenameofacomponentto msgid "Error setting the name of a component %s to %s" msgstr "" #: lazarusidestrconsts.liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "S'ha produït un error mentre s'escrivia la llista de paquets al fitxer%s%s%s%s" #: lazarusidestrconsts.liseteditcustomscanners msgid "Edit custom scanners (%s)" msgstr "" #: lazarusidestrconsts.lisevalexpression msgid "Eval expression" msgstr "" #: lazarusidestrconsts.lisevaluate msgid "E&valuate" msgstr "" #: lazarusidestrconsts.liseverynthlinenumber msgid "Every n-th line number:" msgstr "" #: lazarusidestrconsts.lisexamplefile msgid "Example file:" msgstr "" #: lazarusidestrconsts.lisexamples msgid "Examples" msgstr "" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "" #: lazarusidestrconsts.lisexceptiondialog msgid "Debugger Exception Notification" msgstr "" #: lazarusidestrconsts.lisexcludefilter msgid "Exclude Filter" msgstr "" #: lazarusidestrconsts.lisexcludefilter2 msgid "Exclude filter" msgstr "" #: lazarusidestrconsts.lisexecutingcommandafter msgid "Executing command after" msgstr "Executa l'ordre després" #: lazarusidestrconsts.lisexecutingcommandbefore msgid "Executing command before" msgstr "Executa l'ordre abans" #: lazarusidestrconsts.lisexecutionpaused msgid "Execution paused" msgstr "S'ha pausat l'execució" #: lazarusidestrconsts.lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" msgstr "S'ha pausat l'execució%s Adreça: $%s%s Procediment: %s%s Fitxer: %s%s(Algun dia una finestra d'assemblador emergirà aquí :)" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" msgstr "S'ha aturat l'execució" #: lazarusidestrconsts.lisexeprograms msgid "Programs" msgstr "" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" msgstr "" #: lazarusidestrconsts.lisexpandallpackages msgid "Expand all packages" msgstr "" #: lazarusidestrconsts.lisexpandallunits msgid "Expand all units" msgstr "" #: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "Nom del fitxer estès de l'actual fitxer editor" #: lazarusidestrconsts.lisexport msgid "Export ..." msgstr "" #: lazarusidestrconsts.lisexportlist msgid "Export list" msgstr "Exporta la llista" #: lazarusidestrconsts.lisexpression msgid "Expression:" msgstr "" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" msgstr "" #: lazarusidestrconsts.lisextract msgid "Extract" msgstr "Extrau" #: lazarusidestrconsts.lisextractprocedure msgctxt "lazarusidestrconsts.lisextractprocedure" msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External tools" msgstr "Ferramentes Externes" #: lazarusidestrconsts.lisexttoolfailedtoruntool msgid "Failed to run tool" msgstr "S'ha fallat en executar l'eina" #: lazarusidestrconsts.lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "Número màxim d'eines accedides" #: lazarusidestrconsts.lisexttoolmovedown msgctxt "lazarusidestrconsts.lisexttoolmovedown" msgid "Down" msgstr "Avall" #: lazarusidestrconsts.lisexttoolmoveup msgctxt "lazarusidestrconsts.lisexttoolmoveup" msgid "Up" msgstr "Amunt" #: lazarusidestrconsts.lisexttoolremove msgid "Remove" msgstr "Elimina" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Hi ha un màxim de %s eines." #: lazarusidestrconsts.lisexttooltitlecompleted msgid "\"%s\" completed" msgstr "" #: lazarusidestrconsts.lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" msgstr "No es pot executar l'eina %s%s%s:%s%s" #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" msgstr "" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" msgstr "Redueix la pintura del disseny" #: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" msgstr "Pinta els elements dissenyats només a l'ide (redueix sobrecàrrega a ordinadors lents)" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sEl voleu obrir igualment?" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2 msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sEl voleu obrir igualment?" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" msgstr "" #: lazarusidestrconsts.lisfilefilter msgid "File filter" msgstr "" #: lazarusidestrconsts.lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts.lisfilehasnoproject msgid "File has no project" msgstr "" #: lazarusidestrconsts.lisfileisnotwritable msgid "File is not writable" msgstr "No es pot escriure en el fitxer" #: lazarusidestrconsts.lisfileissymlink msgid "File is symlink" msgstr "" #: lazarusidestrconsts.lisfileisvirtual msgid "File %s%s%s is virtual." msgstr "El fitxer %s%s%s és virtual." #: lazarusidestrconsts.lisfilelinkerror msgid "File link error" msgstr "" #: lazarusidestrconsts.lisfilenameaddress msgid "Filename/Address" msgstr "" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "No s'ha trobat el fitxer" #: lazarusidestrconsts.lisfilenotfound2 msgid "File %s%s%s not found.%s" msgstr "No s'ha trobat el fitxer %s%s%s.%s" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" msgstr "No s'ha trobat el fitxer %s%s%s.%sEl voleu crear?%s" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" msgstr "El fitxer no és en minúscules" #: lazarusidestrconsts.lisfilenottext msgid "File not text" msgstr "No és un fitxer de text" #: lazarusidestrconsts.lisfilesettings msgid "File Settings ..." msgstr "" #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" #: lazarusidestrconsts.lisfilter msgid "Filter" msgstr "" #: lazarusidestrconsts.lisfilter2 msgid "(filter)" msgstr "" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" msgstr "" #: lazarusidestrconsts.lisfindfilecasesensitive msgid "&Case sensitive" msgstr "" #: lazarusidestrconsts.lisfindfiledirectoryoptions msgid "Directory options" msgstr "Opcions del directori" #: lazarusidestrconsts.lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" msgstr "Màscara del fitxer (*;*.*;*.bak?)" #: lazarusidestrconsts.lisfindfileincludesubdirectories msgid "Include sub directories" msgstr "Inclou els subdirectoris" #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "" #: lazarusidestrconsts.lisfindfileonlytextfiles msgid "Only text files" msgstr "Només fitxers de text" #: lazarusidestrconsts.lisfindfileregularexpressions msgid "&Regular expressions" msgstr "" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "search all files in &project" msgstr "" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "search all &open files" msgstr "" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "search in &directories" msgstr "" #: lazarusidestrconsts.lisfindfiletexttofind msgid "Text to find:" msgstr "Text a cercar:" #: lazarusidestrconsts.lisfindfilewhere msgid "Where" msgstr "On" #: lazarusidestrconsts.lisfindfilewholewordsonly msgid "&Whole words only" msgstr "" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" msgstr "" #: lazarusidestrconsts.lisfindmissingunit msgid "Find missing unit" msgstr "" #: lazarusidestrconsts.lisfirst msgid "First" msgstr "" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" msgstr "Fixa el fitxer LFM" #: lazarusidestrconsts.lisfloatingpoin msgid "Floating Point" msgstr "" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" msgstr "" #: lazarusidestrconsts.lisform msgid "Form" msgstr "" #: lazarusidestrconsts.lisformaterror msgid "Format error" msgstr "S'ha produït un error de format" #: lazarusidestrconsts.lisformloaderror msgid "Form load error" msgstr "S'ha produït un error mentre es carregava la forma" #: lazarusidestrconsts.lisfpcmakefailed msgid "fpcmake failed" msgstr "" #: lazarusidestrconsts.lisfpcomponents msgctxt "lazarusidestrconsts.lisfpcomponents" msgid "Components" msgstr "Components" #: lazarusidestrconsts.lisfpcresources msgid "FPC resources" msgstr "" #: lazarusidestrconsts.lisfpcsourcedirectoryerror msgid "FPC Source Directory error" msgstr "S'ha produït un error en el directori del codi font del FPC" #: lazarusidestrconsts.lisfpctooold msgid "FPC too old" msgstr "" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " msgstr "" #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lisfpfindpalettecomponent msgid "Find palette component" msgstr "" #: lazarusidestrconsts.lisframe msgid "Frame" msgstr "" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" msgstr "" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" msgstr "" #: lazarusidestrconsts.lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "No s'ha trobat el compilador Free Pascal" #: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts.lisfreepascalsourcedirectory msgid "Freepascal source directory" msgstr "Directori del codi font del FreePascal" #: lazarusidestrconsts.lisfreepascalsourcefile msgid "FreePascal source file" msgstr "Arxiu font FreePascal" #: lazarusidestrconsts.lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" msgstr "No s'ha trobat el codi font del Free Pascal" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" msgstr "" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Fitxers addicionals a cercar (p.e. /trajectòria/*.pas;/trajec2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "Cerca o reanomena l'identificador" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" msgstr "Cerca les referències" #: lazarusidestrconsts.lisfriidentifier msgid "Identifier: %s" msgstr "Identificador: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "en tots els projectes i paquets oberts" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" msgstr "en la unitat actual" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" msgstr "en el projecte principal" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "en el projecte/paquet que es propietari de la unitat actual" #: lazarusidestrconsts.lisfriinvalididentifier msgid "Invalid Identifier" msgstr "L'identificador no és vàlid" #: lazarusidestrconsts.lisfrirename msgid "Rename" msgstr "Canvia el nom" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" msgstr "Canvia el nom de totes les referències" #: lazarusidestrconsts.lisfrirenameto msgid "Rename to" msgstr "Canvia el nom a" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Cerca també en els comentaris" #: lazarusidestrconsts.lisfrisearchwhere msgid "Search where" msgstr "On cercar" #: lazarusidestrconsts.lisfunction msgid "Function" msgstr "" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition msgid "get word at current cursor position" msgstr "" #: lazarusidestrconsts.lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lisgroup msgid "Group" msgstr "" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" msgstr "" #: lazarusidestrconsts.lishashelp msgid "Has Help" msgstr "" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" msgstr "Comentari de capçalera per a la classe" #: lazarusidestrconsts.lishelpentries msgid "Help entries" msgstr "" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" msgstr "" #: lazarusidestrconsts.lishexadecimal msgid "Hexadecimal" msgstr "" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage msgid "Help for FreePascal Compiler message" msgstr "" #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "" #: lazarusidestrconsts.lishintopen msgctxt "lazarusidestrconsts.lishintopen" msgid "Open" msgstr "Obre" #: lazarusidestrconsts.lishintpause msgctxt "lazarusidestrconsts.lishintpause" msgid "Pause" msgstr "" #: lazarusidestrconsts.lishintrun msgctxt "lazarusidestrconsts.lishintrun" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.lishintsave msgctxt "lazarusidestrconsts.lishintsave" msgid "Save" msgstr "" #: lazarusidestrconsts.lishintsaveall msgid "Save all" msgstr "Desa-ho tot" #: lazarusidestrconsts.lishintstepinto msgid "Step Into" msgstr "Pas a pas per instruccions" #: lazarusidestrconsts.lishintstepout msgid "Run until function returns" msgstr "" #: lazarusidestrconsts.lishintstepover msgid "Step Over" msgstr "Pas a pas per funcions" #: lazarusidestrconsts.lishintstop msgctxt "lazarusidestrconsts.lishintstop" msgid "Stop" msgstr "Atura" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "Suggeriment: La funció de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu l'expressió i torneu-ho a provar." #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." msgstr "Suggeriment: La funció de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu només una expressió de cadena i torneu-ho a provar." #: lazarusidestrconsts.lishinttoggleformunit msgid "Toggle Form/Unit" msgstr "Canvia forma/unitat" #: lazarusidestrconsts.lishintviewforms msgid "View Forms" msgstr "Mostra les formes" #: lazarusidestrconsts.lishintviewunits msgid "View Units" msgstr "Mostra les unitats" #: lazarusidestrconsts.lishitcount msgid "Hitcount" msgstr "" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" msgstr "Base de dades" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" msgstr "Opcions de l'ajuda" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" msgstr "Propietats:" #: lazarusidestrconsts.lishlpoptsviewers msgid "Viewers" msgstr "Visualitzadors" #: lazarusidestrconsts.lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" msgstr "Horitzontal" #: lazarusidestrconsts.liside msgid "IDE" msgstr "" #: lazarusidestrconsts.lisidebuildoptions msgid "IDE build options" msgstr "" #: lazarusidestrconsts.lisideintf msgid "IDE Interface" msgstr "" #: lazarusidestrconsts.lisidentifier msgid "identifier" msgstr "" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "" #: lazarusidestrconsts.lisidentifiercontains msgid "Identifier contains ..." msgstr "" #: lazarusidestrconsts.lisideoptions msgid "IDE Options:" msgstr "Opcions IDE:" #: lazarusidestrconsts.lisidetitlestartswithprojectname msgid "IDE title starts with project name" msgstr "" #: lazarusidestrconsts.lisiecoerroraccessingxml msgid "Error accessing xml" msgstr "Error accedint a xml" #: lazarusidestrconsts.lisiecoerroraccessingxmlfile msgid "Error accessing xml file %s%s%s:%s%s" msgstr "Error accedint a l'arxiu xml %s%s%s:%s%s" #: lazarusidestrconsts.lisiecoerrorloadingxml msgid "Error loading xml" msgstr "Error carregant xml" #: lazarusidestrconsts.lisiecoerrorloadingxmlfile msgid "Error loading xml file %s%s%s:%s%s" msgstr "Error carregant l'arxiu xml %s%s%s:%s%s" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" msgstr "Carrega des de l'arxiu" #: lazarusidestrconsts.lisiecoopenorloadcompileroptions msgid "Open or Load Compiler Options" msgstr "Obre o Carrega Opcions del Compilador" #: lazarusidestrconsts.lisiecoopenrecent msgid "Open recent" msgstr "Obre recent" #: lazarusidestrconsts.lisiecorecentfiles msgid "Recent files" msgstr "Arxius recents" #: lazarusidestrconsts.lisiecosavetofile msgid "Save to file" msgstr "Desa a l'arxiu" #: lazarusidestrconsts.lisiecosavetorecent msgid "Save to recent" msgstr "" #: lazarusidestrconsts.lisifdok msgctxt "lazarusidestrconsts.lisifdok" msgid "OK" msgstr "D'Acord" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" msgstr "" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" msgstr "" #: lazarusidestrconsts.lisignorebinaries msgid "Ignore binaries" msgstr "" #: lazarusidestrconsts.lisignoreexceptiontype msgid "Ignore this exception type" msgstr "" #: lazarusidestrconsts.lisignoremissingfile msgid "Ignore missing file" msgstr "Ignora arxiu perdut" #: lazarusidestrconsts.lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" msgstr "" #: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage msgid "Imitate indentation of current unit, project or package" msgstr "" #: lazarusidestrconsts.lisimplementationcommentforclass msgid "Implementation comment for class" msgstr "" #: lazarusidestrconsts.lisimportlist msgid "Import list" msgstr "importar la llista" #: lazarusidestrconsts.lisimpossible msgid "Impossible" msgstr "" #: lazarusidestrconsts.lisincludefilter msgid "Include Filter" msgstr "" #: lazarusidestrconsts.lisincludepath msgid "include path" msgstr "trajectòria dels fitxers inclosos" #: lazarusidestrconsts.lisincludepaths msgid "Include paths" msgstr "" #: lazarusidestrconsts.lisindentation msgid "Indentation" msgstr "" #: lazarusidestrconsts.lisindex msgid "Index" msgstr "" #: lazarusidestrconsts.lisinfobuildabort msgid "Aborted..." msgstr "" #: lazarusidestrconsts.lisinfobuildbuild msgctxt "lazarusidestrconsts.lisinfobuildbuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lisinfobuildcaption msgid "Compile Project" msgstr "" #: lazarusidestrconsts.lisinfobuildcomplile msgid "Compiling..." msgstr "" #: lazarusidestrconsts.lisinfobuilderror msgid "Error..." msgstr "" #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" msgstr "" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" msgstr "" #: lazarusidestrconsts.lisinfobuildlines msgctxt "lazarusidestrconsts.lisinfobuildlines" msgid "Lines:" msgstr "Línies:" #: lazarusidestrconsts.lisinfobuildmakeabort msgctxt "lazarusidestrconsts.lisinfobuildmakeabort" msgid "Abort" msgstr "Avortar" #: lazarusidestrconsts.lisinfobuildnote msgid "Notes:" msgstr "" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success..." msgstr "" #: lazarusidestrconsts.lisinfobuildwarning msgid "Warnings:" msgstr "" #: lazarusidestrconsts.lisinformation msgid "Information" msgstr "" #: lazarusidestrconsts.lisinformationaboutunit msgid "Information about %s" msgstr "Informació de %s" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" msgstr "" #: lazarusidestrconsts.lisinheritedcomponent msgid "Inherited Component" msgstr "" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" msgstr "" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" msgstr "" #: lazarusidestrconsts.lisinsertdate msgid "insert date" msgstr "" #: lazarusidestrconsts.lisinsertdateandtime msgid "insert date and time" msgstr "" #: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring msgid "Insert date and time. Optional: format string" msgstr "" #: lazarusidestrconsts.lisinsertdateoptionalformatstring msgid "Insert date. Optional: format string" msgstr "" #: lazarusidestrconsts.lisinsertendifneeded msgid "insert end if needed" msgstr "" #: lazarusidestrconsts.lisinsertnameofcurrentprocedure msgid "Insert name of current procedure" msgstr "" #: lazarusidestrconsts.lisinsertprintshorttag msgid "Insert PrintShort tag" msgstr "" #: lazarusidestrconsts.lisinsertprintshorttag2 msgid "Insert printshort tag" msgstr "" #: lazarusidestrconsts.lisinsertprocedurehead msgid "insert procedure head" msgstr "" #: lazarusidestrconsts.lisinsertprocedurename msgid "insert procedure name" msgstr "" #: lazarusidestrconsts.lisinserttime msgid "insert time" msgstr "" #: lazarusidestrconsts.lisinserttimeoptionalformatstring msgid "Insert time. Optional: format string" msgstr "" #: lazarusidestrconsts.lisinserturltag msgid "Insert url tag" msgstr "" #: lazarusidestrconsts.lisinspect msgid "&Inspect" msgstr "" #: lazarusidestrconsts.lisinspectdata msgid "Data" msgstr "" #: lazarusidestrconsts.lisinspectdialog msgid "Debug Inspector" msgstr "" #: lazarusidestrconsts.lisinspectmethods msgid "Methods" msgstr "" #: lazarusidestrconsts.lisinspectproperties msgctxt "lazarusidestrconsts.lisinspectproperties" msgid "Properties" msgstr "" #: lazarusidestrconsts.lisinstallationfailed msgid "Installation failed" msgstr "Instal·lació fallida" #: lazarusidestrconsts.lisinstalledpackages msgid "Installed Packages" msgstr "Paquets instal·lats" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" msgstr "Instal·la la selecció" #: lazarusidestrconsts.lisinvalidbuildvarthebuildvarmustbeapascalidentifie msgid "Invalid build variable %s%s%s. The build variable must be a pascal identifier." msgstr "" #: lazarusidestrconsts.lisinvalidcircle msgid "Invalid circle" msgstr "" #: lazarusidestrconsts.lisinvalidcommand msgid "Invalid command" msgstr "L'ordre no és vàlida" #: lazarusidestrconsts.lisinvalidcompilerfilename msgid "Invalid Compiler Filename" msgstr "" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" msgstr "L'eliminació no és vàlida" #: lazarusidestrconsts.lisinvaliddestinationdirectory msgid "Invalid destination directory" msgstr "El directori de destinació no és vàlid" #: lazarusidestrconsts.lisinvalidexpression msgid "Invalid expression:%s%s%s%s" msgstr "" #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "L'expressió no és vàlida.%sSuggeriment: La funció de la cadena del recurs espera una constant de cadena en un sol fitxer. Si us plau, seleccioneu l'expressió i torneu-ho a provar." #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" msgstr "" #: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" msgstr "El directori del codi font de Free Pascal no és vàlid" #: lazarusidestrconsts.lisinvalidmultiselection msgid "Invalid multiselection" msgstr "La multiselecció no és vàlida" #: lazarusidestrconsts.lisinvalidoff msgid "Invalid (Off)" msgstr "" #: lazarusidestrconsts.lisinvalidon msgid "Invalid (On)" msgstr "" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "L'identificador de Pascal no és vàlid" #: lazarusidestrconsts.lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." msgstr "El nom \"%s\" no és un identificador vàlid de Pascal" #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" msgstr "El nom del procediment no és vàlid" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" msgstr "El nom del fitxer del projecte no és vàlid" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" msgstr "La selecció no és vàlida" #: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes msgid "%s is a group. A setting can only be added to normal build modes." msgstr "" #: lazarusidestrconsts.lisisalreadypartoftheproject msgid "%s is already part of the Project." msgstr "%s ja forma part del Projecte." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s no és un nom de projecte vàlid. %s Si us plau, escolliu-ne un altre (p.e. project1.lpi)" #: lazarusidestrconsts.lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." msgstr "" #: lazarusidestrconsts.lisjitform msgid "JIT Form" msgstr "" #: lazarusidestrconsts.liskeep msgid "keep" msgstr "" #: lazarusidestrconsts.liskeepname msgid "Keep name" msgstr "Manté el nom" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" msgstr "Mantin-los i continua" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" msgstr "Ordres personalitzades" #: lazarusidestrconsts.liskeycatdesigner msgid "Designer commands" msgstr "Ordres del dissenyador" #: lazarusidestrconsts.liskeycatobjinspector msgid "Object Inspector commands" msgstr "" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" msgstr "" #: lazarusidestrconsts.liskmaddactiveunittoproject msgid "Add active unit to project" msgstr "" #: lazarusidestrconsts.liskmaddwatch msgid "Add watch" msgstr "" #: lazarusidestrconsts.liskmbuildallfilesofprojectprogram msgid "Build all files of project/program" msgstr "" #: lazarusidestrconsts.liskmbuildprojectprogram msgid "Build project/program" msgstr "" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "" #: lazarusidestrconsts.liskmclassic msgid "Classic" msgstr "Clàssic" #: lazarusidestrconsts.liskmcloseall msgid "Close All" msgstr "" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" msgstr "" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "" #: lazarusidestrconsts.liskmcodetoolsoptions msgid "CodeTools options" msgstr "" #: lazarusidestrconsts.liskmcompileroptions msgid "Compiler options" msgstr "" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config %sBuild File%s" msgstr "" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure custom components" msgstr "" #: lazarusidestrconsts.liskmconfigurehelp msgid "Configure Help" msgstr "" #: lazarusidestrconsts.liskmconfigureinstalledpackages msgid "Configure installed packages" msgstr "" #: lazarusidestrconsts.liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "" #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "" #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi project to Lazarus project" msgstr "" #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit msgid "Convert Delphi unit to Lazarus unit" msgstr "" #: lazarusidestrconsts.liskmconvertdfmfiletolfm msgid "Convert DFM file to LFM" msgstr "" #: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard msgid "Copy selected Components to clipboard" msgstr "" #: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard msgid "Cut selected Components to clipboard" msgstr "" #: lazarusidestrconsts.liskmdeletelastchar msgid "Delete last char" msgstr "" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff editor files" msgstr "" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" msgstr "" #: lazarusidestrconsts.liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "" #: lazarusidestrconsts.liskmeditoroptions msgctxt "lazarusidestrconsts.liskmeditoroptions" msgid "Editor options" msgstr "" #: lazarusidestrconsts.liskmencloseselection msgid "Enclose selection" msgstr "" #: lazarusidestrconsts.liskmevaluatemodify msgid "Evaluate/Modify" msgstr "" #: lazarusidestrconsts.liskmexternaltoolssettings msgid "External Tools settings" msgstr "" #: lazarusidestrconsts.liskmfindincremental msgid "Find incremental" msgstr "" #: lazarusidestrconsts.liskmgotomarker0 msgid "Go to marker 0" msgstr "" #: lazarusidestrconsts.liskmgotomarker1 msgid "Go to marker 1" msgstr "" #: lazarusidestrconsts.liskmgotomarker2 msgid "Go to marker 2" msgstr "" #: lazarusidestrconsts.liskmgotomarker3 msgid "Go to marker 3" msgstr "" #: lazarusidestrconsts.liskmgotomarker4 msgid "Go to marker 4" msgstr "" #: lazarusidestrconsts.liskmgotomarker5 msgid "Go to marker 5" msgstr "" #: lazarusidestrconsts.liskmgotomarker6 msgid "Go to marker 6" msgstr "" #: lazarusidestrconsts.liskmgotomarker7 msgid "Go to marker 7" msgstr "" #: lazarusidestrconsts.liskmgotomarker8 msgid "Go to marker 8" msgstr "" #: lazarusidestrconsts.liskmgotomarker9 msgid "Go to marker 9" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "" #: lazarusidestrconsts.liskminsertdateandtime msgid "Insert date and time" msgstr "" #: lazarusidestrconsts.liskminsertifdef msgid "Insert $IFDEF" msgstr "" #: lazarusidestrconsts.liskminsertusername msgid "Insert username" msgstr "" #: lazarusidestrconsts.liskminspect msgid "Inspect" msgstr "" #: lazarusidestrconsts.liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus (default)" msgstr "" #: lazarusidestrconsts.liskmmacosxapple msgid "Mac OS X (Apple style)" msgstr "" #: lazarusidestrconsts.liskmmacosxlaz msgid "Mac OS X (Lazarus style)" msgstr "" #: lazarusidestrconsts.liskmnewpackage msgid "New package" msgstr "" #: lazarusidestrconsts.liskmnewproject msgid "New project" msgstr "" #: lazarusidestrconsts.liskmnewprojectfromfile msgid "New project from file" msgstr "" #: lazarusidestrconsts.liskmnewunit msgctxt "lazarusidestrconsts.liskmnewunit" msgid "New Unit" msgstr "" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." msgstr "" #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" msgstr "" #: lazarusidestrconsts.liskmpackagegraph msgid "Package graph" msgstr "" #: lazarusidestrconsts.liskmpastecomponentsfromclipboard msgid "Paste Components from clipboard" msgstr "" #: lazarusidestrconsts.liskmpauseprogram msgid "Pause program" msgstr "" #: lazarusidestrconsts.liskmpublishproject msgid "Publish project" msgstr "" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "" #: lazarusidestrconsts.liskmremoveactiveunitfromproject msgid "Remove active unit from project" msgstr "" #: lazarusidestrconsts.liskmrunprogram msgid "Run program" msgstr "" #: lazarusidestrconsts.liskmsaveall msgid "SaveAll" msgstr "" #: lazarusidestrconsts.liskmsaveas msgid "SaveAs" msgstr "" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" msgstr "" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" msgstr "" #: lazarusidestrconsts.liskmselectlineend msgid "Select line end" msgstr "" #: lazarusidestrconsts.liskmselectlinestart msgid "Select line start" msgstr "" #: lazarusidestrconsts.liskmselectpagebottom msgid "Select page bottom" msgstr "" #: lazarusidestrconsts.liskmselectpagetop msgid "Select page top" msgstr "" #: lazarusidestrconsts.liskmselectwordleft msgid "Select word left" msgstr "" #: lazarusidestrconsts.liskmselectwordright msgid "Select word right" msgstr "" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" msgstr "" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set marker 0" msgstr "" #: lazarusidestrconsts.liskmsetmarker1 msgid "Set marker 1" msgstr "" #: lazarusidestrconsts.liskmsetmarker2 msgid "Set marker 2" msgstr "" #: lazarusidestrconsts.liskmsetmarker3 msgid "Set marker 3" msgstr "" #: lazarusidestrconsts.liskmsetmarker4 msgid "Set marker 4" msgstr "" #: lazarusidestrconsts.liskmsetmarker5 msgid "Set marker 5" msgstr "" #: lazarusidestrconsts.liskmsetmarker6 msgid "Set marker 6" msgstr "" #: lazarusidestrconsts.liskmsetmarker7 msgid "Set marker 7" msgstr "" #: lazarusidestrconsts.liskmsetmarker8 msgid "Set marker 8" msgstr "" #: lazarusidestrconsts.liskmsetmarker9 msgid "Set marker 9" msgstr "" #: lazarusidestrconsts.liskmstopprogram msgid "Stop program" msgstr "" #: lazarusidestrconsts.liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle marker 0" msgstr "" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle marker 1" msgstr "" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle marker 2" msgstr "" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle marker 3" msgstr "" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle marker 4" msgstr "" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle marker 5" msgstr "" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle marker 6" msgstr "" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle marker 7" msgstr "" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle marker 8" msgstr "" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle marker 9" msgstr "" #: lazarusidestrconsts.liskmtoggleviewassembler msgid "Toggle view Assembler" msgstr "" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcallstack msgid "Toggle view Call Stack" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle view component palette" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdebuggeroutput msgid "Toggle view Debugger Output" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" msgstr "" #: lazarusidestrconsts.liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "" #: lazarusidestrconsts.liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "" #: lazarusidestrconsts.liskmtoggleviewregisters msgid "Toggle view Registers" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewwatches msgid "Toggle view Watches" msgstr "" #: lazarusidestrconsts.liskmviewjumphistory msgid "View jump history" msgstr "" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" msgstr "" #: lazarusidestrconsts.liskmviewprojectsource msgid "View project source" msgstr "" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" msgstr "" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "L'execució de l'aplicació no és vàlida" #: lazarusidestrconsts.lislaunchingcmdline msgid "Launching target command line" msgstr "Executant línia d'ordres de destinació" #: lazarusidestrconsts.lislazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "" #: lazarusidestrconsts.lislazarusdirectory msgid "Lazarus directory" msgstr "Directori del Lazarus" #: lazarusidestrconsts.lislazarusdirectorynotfound msgid "Lazarus directory not found" msgstr "No s'ha trobat el directori del Lazarus" #: lazarusidestrconsts.lislazarusdiroverride msgid "directory, to be used as a basedirectory" msgstr "" #: lazarusidestrconsts.lislazaruseditorv msgid "Lazarus IDE v%s" msgstr "" #: lazarusidestrconsts.lislazarusfile msgid "Lazarus File" msgstr "Arxiu Lazarus" #: lazarusidestrconsts.lislazarusform msgid "Lazarus form" msgstr "Forma Lazarus" #: lazarusidestrconsts.lislazaruside msgid "Lazarus IDE" msgstr "" #: lazarusidestrconsts.lislazarusinclude msgid "Lazarus include file" msgstr "" #: lazarusidestrconsts.lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "" #: lazarusidestrconsts.lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "" #: lazarusidestrconsts.lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [opcions] " #: lazarusidestrconsts.lislazaruspackage msgid "Lazarus package" msgstr "Paquet Lazarus" #: lazarusidestrconsts.lislazarusproject msgid "Lazarus project" msgstr "Projecte Lazarus" #: lazarusidestrconsts.lislazarusprojectinfofile msgid "Lazarus Project Info file" msgstr "" #: lazarusidestrconsts.lislazarusprojectsource msgid "Lazarus project source" msgstr "Font de projecte Lazarus" #: lazarusidestrconsts.lislazarusunit msgid "Lazarus unit" msgstr "Unitat Lazarus" #: lazarusidestrconsts.lislazbuildaboaction msgctxt "lazarusidestrconsts.lislazbuildaboaction" msgid "Action" msgstr "" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "" #: lazarusidestrconsts.lislazbuildabopart msgid "Part" msgstr "" #: lazarusidestrconsts.lislazbuildadvancedbuildoptions msgid "Advanced Build Options" msgstr "" #: lazarusidestrconsts.lislazbuildbuild msgctxt "lazarusidestrconsts.lislazbuildbuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lislazbuildbuildcodetools msgid "Build CodeTools" msgstr "Munta les eines del codi" #: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools msgid "Build components (SynEdit, CodeTools)" msgstr "" #: lazarusidestrconsts.lislazbuildbuildexamples msgid "Build examples" msgstr "" #: lazarusidestrconsts.lislazbuildbuildide msgid "Build IDE" msgstr "Munta l'IDE" #: lazarusidestrconsts.lislazbuildbuildjitform msgid "Build JITForm" msgstr "Munta la forma JIT" #: lazarusidestrconsts.lislazbuildbuildoptions msgid "Build Options" msgstr "" #: lazarusidestrconsts.lislazbuildbuildsynedit msgid "Build SynEdit" msgstr "Munta el SynEdit" #: lazarusidestrconsts.lislazbuildcancel msgctxt "lazarusidestrconsts.lislazbuildcancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.lislazbuildcleanall msgid "Clean all" msgstr "Neteja-ho tot" #: lazarusidestrconsts.lislazbuildcleanbuild msgid "Clean+Build" msgstr "Neteja i munta" #: lazarusidestrconsts.lislazbuildconfirmbuild msgid "Confirm before rebuilding Lazarus" msgstr "" #: lazarusidestrconsts.lislazbuilderrorwritingfile msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" msgid "Error writing file" msgstr "S'ha produït un error mentre s'escrivia el fitxer" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow msgid "%s%s%s%slazbuild is non interactive, aborting now." msgstr "" #: lazarusidestrconsts.lislazbuildlclinterface msgid "LCL interface" msgstr "Interfície LCL" #: lazarusidestrconsts.lislazbuildnone msgctxt "lazarusidestrconsts.lislazbuildnone" msgid "None" msgstr "Cap" #: lazarusidestrconsts.lislazbuildok msgctxt "lazarusidestrconsts.lislazbuildok" msgid "Ok" msgstr "D'acord" #: lazarusidestrconsts.lislazbuildoptions msgid "Options:" msgstr "Opcions:" #: lazarusidestrconsts.lislazbuildqboapplcltarget msgid "Target" msgstr "" #: lazarusidestrconsts.lislazbuildqbobuildall msgid "Build All" msgstr "" #: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages msgid "Build IDE without Packages" msgstr "" #: lazarusidestrconsts.lislazbuildqbobuildidewpackages msgid "Build IDE with Packages" msgstr "" #: lazarusidestrconsts.lislazbuildqbobuildlcl msgid "Build LCL" msgstr "" #: lazarusidestrconsts.lislazbuildqbobuildother msgctxt "lazarusidestrconsts.lislazbuildqbobuildother" msgid "Other" msgstr "Altres" #: lazarusidestrconsts.lislazbuildqbocleanupbuildall msgid "Clean Up + Build all" msgstr "" #: lazarusidestrconsts.lislazbuildquickbuildoptions msgid "Quick Build Options" msgstr "" #: lazarusidestrconsts.lislazbuildrestartafterbuild msgid "Restart after successful Build" msgstr "" #: lazarusidestrconsts.lislazbuildsavesettings msgid "Save settings" msgstr "" #: lazarusidestrconsts.lislazbuildtargetcpu msgid "Target CPU:" msgstr "" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" msgstr "" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" msgstr "SO dest:" #: lazarusidestrconsts.lislazbuildunabletowritefile msgid "Unable to write file \"%s\":%s" msgstr "" #: lazarusidestrconsts.lislazbuildwithstaticpackages msgid "With packages" msgstr "" #: lazarusidestrconsts.lislcl msgid "LCL" msgstr "" #: lazarusidestrconsts.lislclunitpathmissing msgid "LCL unit path missing" msgstr "Falta la trajectòria a la unitat LCL" #: lazarusidestrconsts.lislclwidgettype msgid "LCL Widget Type" msgstr "Tipus de giny LCL" #: lazarusidestrconsts.lisldaddlinktoinherited msgid "Add link to inherited" msgstr "" #: lazarusidestrconsts.lisldcopyfrominherited msgid "Copy from inherited" msgstr "" #: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s" msgstr "" #: lazarusidestrconsts.lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "" #: lazarusidestrconsts.lisldnovalidlazdocpath msgid "No valid LazDoc path" msgstr "" #: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "" #: lazarusidestrconsts.lisleaveemptyfo msgid "Leave empty for default .po file" msgstr "Deixa buit per omissió el fitxer .po" #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" msgid "Left" msgstr "Esquerra" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "" #: lazarusidestrconsts.lisleftgroupboxcaption msgid "Left anchoring" msgstr "" #: lazarusidestrconsts.lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisleftsides msgid "Left sides" msgstr "Costats esquerres" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" msgstr "Iguala l'espai esquerra" #: lazarusidestrconsts.lislevels msgid "Levels" msgstr "" #: lazarusidestrconsts.lislfmfile msgid "LFM file" msgstr "Fitxer LFM" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" msgstr "El fitxer LFM està corromput" #: lazarusidestrconsts.lislfmisok msgid "LFM is ok" msgstr "" #: lazarusidestrconsts.lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." msgstr "Llibreria%sUna llibreria freepascal (.dll en windoze, .so en linux, .dylib en macosx). El font de la llibreria es mantingut automàticament per Lazarus." #: lazarusidestrconsts.lislibrarypath msgid "library path" msgstr "trajectòria de les biblioteques" #: lazarusidestrconsts.lisline msgid "Line:" msgstr "" #: lazarusidestrconsts.lislinelength msgid "Line/Length" msgstr "" #: lazarusidestrconsts.lislink msgid "Link:" msgstr "" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" msgstr "opcions de l'enllaçador" #: lazarusidestrconsts.lislinktarget msgid "Link target" msgstr "" #: lazarusidestrconsts.lislistofallcasevalues msgid "list of all case values" msgstr "" #: lazarusidestrconsts.lisloadingfailed msgid "Loading %s failed." msgstr "" #: lazarusidestrconsts.lislocals msgid "Locals" msgstr "" #: lazarusidestrconsts.lislocalsdlgname msgctxt "lazarusidestrconsts.lislocalsdlgname" msgid "Name" msgstr "Nom" #: lazarusidestrconsts.lislocalsdlgvalue msgctxt "lazarusidestrconsts.lislocalsdlgvalue" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.lislogmessage msgid "Log message" msgstr "" #: lazarusidestrconsts.lislogo msgid "Logo" msgstr "" #: lazarusidestrconsts.lislowercasestring msgid "lowercase string" msgstr "" #: lazarusidestrconsts.lislowercasestringgivenasparameter msgid "Lowercase string given as parameter" msgstr "" #: lazarusidestrconsts.lislrsincludefiles msgid "lrs include files" msgstr "" #: lazarusidestrconsts.lismacpascal msgid "Mac Pascal" msgstr "" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" msgstr "Entra les dades" #: lazarusidestrconsts.lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Entra els paràmetres d'execució" #: lazarusidestrconsts.lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" msgstr "La unitat principal té declaracions Application.CreateForm" #: lazarusidestrconsts.lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" msgstr "La unitat principal té declaracions Application.Title" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" msgstr "La unitat principal té secció USES amb totes les unitats del projecte" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main Unit is Pascal Source" msgstr "" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" msgstr "Fes executable" #: lazarusidestrconsts.lismakenotfound msgid "Make not found" msgstr "No s'ha trobat Make" #: lazarusidestrconsts.lismakeresourcestring msgid "Make ResourceString" msgstr "Fes cadena del recurs" #: lazarusidestrconsts.lismakeresstrappendtosection msgid "Append to section" msgstr "Afegeix a la secció" #: lazarusidestrconsts.lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escolliu-ne un altre nom. %s Escolliu - Ignora - per afegir-la de tota manera" #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" msgstr "Opcions de conversió" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "Identificador personalitzat" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" msgid "Identifier" msgstr "Identificador" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" msgstr "Longitud de l'identificador" #: lazarusidestrconsts.lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "Prefix de l'identificador" #: lazarusidestrconsts.lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "Insereix alfabèticament" #: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "Insereix sensitivament al context" #: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "La secció de la cadena del recurs no és vàlida" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "Ja existeix la cadena del recurs" #: lazarusidestrconsts.lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "Secció de cadena del recurs" #: lazarusidestrconsts.lismakeresstrsourcepreview msgid "Source preview" msgstr "Visualització prèvia del codi font" #: lazarusidestrconsts.lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "Constant de cadena en el codi font" #: lazarusidestrconsts.lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Cadenes amb el mateix valor:" #: lazarusidestrconsts.lismaxs msgid "Max %d" msgstr "" #: lazarusidestrconsts.lismemorydump msgid "Memory Dump" msgstr "" #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" msgstr "Avorta el muntatge" #: lazarusidestrconsts.lismenuaddbpsource msgid "Source breakpoint" msgstr "Punt de ruptura de les fonts" #: lazarusidestrconsts.lismenuaddbreakpoint msgid "Add breakpoint" msgstr "Afegeix un punt de ruptura" #: lazarusidestrconsts.lismenuaddcurunittopkg msgid "Add active unit to a package" msgstr "Afegeix la unitat activa a un paquet" #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add jump point to history" msgstr "Afegeix un punt de salt a la història" #: lazarusidestrconsts.lismenuaddtoproject msgid "Add editor file to Project" msgstr "Afegeix el fitxer de l'editor al Projecte" #: lazarusidestrconsts.lismenuaddwatch msgid "Add watch ..." msgstr "Afegeix control ..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in selection" msgstr "" #: lazarusidestrconsts.lismenubuild msgctxt "lazarusidestrconsts.lismenubuild" msgid "Build" msgstr "Munta" #: lazarusidestrconsts.lismenubuildall msgid "Build all" msgstr "Munta-ho Tot" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" msgstr "Munta el fitxer" #: lazarusidestrconsts.lismenubuildlazarus msgid "Build Lazarus" msgstr "Munta el Lazarus" #: lazarusidestrconsts.lismenuchecklfm msgid "Check LFM file in editor" msgstr "Comprova el fitxer LFM en l'editor" #: lazarusidestrconsts.lismenucleandirectory msgid "Clean directory ..." msgstr "Neteja el directori ..." #: lazarusidestrconsts.lismenuclose msgctxt "lazarusidestrconsts.lismenuclose" msgid "Close" msgstr "Tanca" #: lazarusidestrconsts.lismenucloseall #, fuzzy #| msgid "Close all editor files" msgid "Close a&ll editor files" msgstr "Tanca tots els fitxers de l'editor" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" msgstr "" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." msgstr "Editor de definició de les eines del codi ..." #: lazarusidestrconsts.lismenucollectpofil msgid "Collect .po files" msgstr "Recull els fitxers .po" #: lazarusidestrconsts.lismenucommentselection msgid "Comment selection" msgstr "Comenta la selecció" #: lazarusidestrconsts.lismenucompileroptions msgid "Compiler Options ..." msgstr "Opcions del compilador ..." #: lazarusidestrconsts.lismenucompletecode msgctxt "lazarusidestrconsts.lismenucompletecode" msgid "Complete Code" msgstr "Completa el codi" #: lazarusidestrconsts.lismenuconditionalselection msgid "Insert $IFDEF..." msgstr "Insereix $IFDEF..." #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Configura Arxiu Build+Run ..." #: lazarusidestrconsts.lismenuconfigcustomcomps msgid "Configure custom components ..." msgstr "Configura els components personalitzats ..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." msgstr "" #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Configura \"Build Lazarus\" ..." #: lazarusidestrconsts.lismenuconfigurehelp msgid "Configure Help ..." msgstr "Configura l'ajuda ..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" msgstr "Ajuda sensitiva al context" #: lazarusidestrconsts.lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." msgstr "Converteix paquet Delphi a paquet Lazarus ..." #: lazarusidestrconsts.lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." msgstr "Converteix projecte Delphi a projecte Lazarus ..." #: lazarusidestrconsts.lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Converteix la unitat Delphi a unitat Lazarus ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm #, fuzzy #| msgid "Convert DFM file to LFM ..." msgid "Convert binary DFM file to text LFM and check syntax ..." msgstr "Converteix el fitxer DFM a LFM ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." msgstr "" #: lazarusidestrconsts.lismenucopy msgctxt "lazarusidestrconsts.lismenucopy" msgid "Copy" msgstr "Copia" #: lazarusidestrconsts.lismenucreatefpdocfiles msgid "Create FPDoc files" msgstr "" #: lazarusidestrconsts.lismenucreatepofile msgid "Create .po files" msgstr "Crea els fitxers .po" #: lazarusidestrconsts.lismenucut msgctxt "lazarusidestrconsts.lismenucut" msgid "Cut" msgstr "Talla" #: lazarusidestrconsts.lismenudebugwindows msgid "Debug windows" msgstr "Finestres de depuració" #: lazarusidestrconsts.lismenudiff msgctxt "lazarusidestrconsts.lismenudiff" msgid "Diff" msgstr "Mostra les diferències" #: lazarusidestrconsts.lismenuedit msgid "&Edit" msgstr "&Edita" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." msgstr "Plantilles de codi ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "" #: lazarusidestrconsts.lismenueditinstallpkgs msgid "Configure installed packages ..." msgstr "Configura els paquets intal·lats ..." #: lazarusidestrconsts.lismenueditor msgid "Menu Editor..." msgstr "" #: lazarusidestrconsts.lismenueditorcancel msgctxt "lazarusidestrconsts.lismenueditorcancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "Crea submenú" #: lazarusidestrconsts.lismenueditordeletefromtemplate msgid "Delete From Template..." msgstr "Elimina desde la plantilla..." #: lazarusidestrconsts.lismenueditordeleteitem msgid "Delete Item" msgstr "Elimina l'element" #: lazarusidestrconsts.lismenueditorhandleonclickevent msgid "Handle OnClick Event" msgstr "" #: lazarusidestrconsts.lismenueditorinsertfromtemplate msgid "Insert From Template..." msgstr "Insereix desde la plantilla..." #: lazarusidestrconsts.lismenueditorinsertnewitemafter msgid "Insert New Item (after)" msgstr "Insereix nou element (després)" #: lazarusidestrconsts.lismenueditorinsertnewitembefore msgid "Insert New Item (before)" msgstr "Insereix nou element (abans)" #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" msgstr "Editor del menú" #: lazarusidestrconsts.lismenueditormovedown msgid "Move Down (or right)" msgstr "Mou avall (o a la dreta)" #: lazarusidestrconsts.lismenueditormoveup msgid "Move Up (or left)" msgstr "Mou Dalt (o a l'esquerra)" #: lazarusidestrconsts.lismenueditornewtemplatedescription msgid "New Template Description..." msgstr "Nova descripció de plantilla ..." #: lazarusidestrconsts.lismenueditorsaveastemplate msgid "Save As Template..." msgstr "Desa com a plantilla..." #: lazarusidestrconsts.lismenueditorselectmenu msgid "Select Menu:" msgstr "Selecciona menú:" #: lazarusidestrconsts.lismenueditorselecttemplate msgid "Select Template:" msgstr "Selecciona la plantilla:" #: lazarusidestrconsts.lismenueditortemplatepreview msgid "Template Preview" msgstr "Vista preliminar de la plantilla" #: lazarusidestrconsts.lismenuencloseselection msgid "Enclose selection ..." msgstr "Tanca la selecció ..." #: lazarusidestrconsts.lismenuenvironent msgid "E&nvironment" msgstr "E&ntorn" #: lazarusidestrconsts.lismenuevaluate msgid "Evaluate/Modify ..." msgstr "Avalua/Modifica ..." #: lazarusidestrconsts.lismenuextractproc msgid "Extract procedure ..." msgstr "Extrau el procediment ..." #: lazarusidestrconsts.lismenufile msgid "&File" msgstr "&Fitxer" #: lazarusidestrconsts.lismenufind msgctxt "lazarusidestrconsts.lismenufind" msgid "Find" msgstr "Cerca" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." msgstr "" #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find other end of code block" msgstr "Cerca l'altre cap del bloc del codi" #: lazarusidestrconsts.lismenufindcodeblockstart msgid "Find code block start" msgstr "Cerca l'inici del bloc del codi" #: lazarusidestrconsts.lismenufinddeclarationatcursor msgid "Find Declaration at cursor" msgstr "Cerca la declaració al cursor" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Cerca les referències de l'identificador ..." #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in files ..." msgstr "Cerca &en els Fitxers ..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" msgstr "Cerca el següe&nt" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" msgstr "Cerca l'an&terior" #: lazarusidestrconsts.lismenufpdoceditor msgctxt "lazarusidestrconsts.lismenufpdoceditor" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." msgstr "" #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" msgstr "Vés a la directiva Include" #: lazarusidestrconsts.lismenugotoline msgid "Goto line ..." msgstr "Vés a la línia ..." #: lazarusidestrconsts.lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" msgstr "Suposa IFDEF/ENDIF omès" #: lazarusidestrconsts.lismenuguessunclosedblock msgid "Guess unclosed block" msgstr "Suposa bloc no tancat" #: lazarusidestrconsts.lismenuhelp msgid "&Help" msgstr "A&juda" #: lazarusidestrconsts.lismenuideinternals msgid "IDE internals" msgstr "" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" msgstr "Recerca incremental" #: lazarusidestrconsts.lismenuindentselection msgid "Indent selection" msgstr "Sagna la selecció" #: lazarusidestrconsts.lismenuinsertchangelogentry msgid "ChangeLog entry" msgstr "Entrada de registre de canvis" #: lazarusidestrconsts.lismenuinsertcharacter msgid "Insert from Character Map" msgstr "Insereix desde el mapa de caràcters" #: lazarusidestrconsts.lismenuinsertcvskeyword msgid "CVS keyword" msgstr "Paraula clau del CVS" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current date and time" msgstr "Data i hora actuals" #: lazarusidestrconsts.lismenuinsertgeneral msgctxt "lazarusidestrconsts.lismenuinsertgeneral" msgid "General" msgstr "General" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL notice" msgstr "Comentari GPL" #: lazarusidestrconsts.lismenuinsertlgplnotice msgid "LGPL notice" msgstr "Comentari LGPL" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" msgstr "" #: lazarusidestrconsts.lismenuinserttext msgid "Insert text" msgstr "Insereix el text" #: lazarusidestrconsts.lismenuinsertusername msgid "Current username" msgstr "Nom d'usuari actual" #: lazarusidestrconsts.lismenuinspect msgid "Inspect ..." msgstr "Inspecciona ..." #: lazarusidestrconsts.lismenujumpback msgid "Jump back" msgstr "Salta enrera" #: lazarusidestrconsts.lismenujumpforward msgid "Jump forward" msgstr "Salta endavant" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" msgstr "Ves a" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to next bookmark" msgstr "Ves al següent marcador" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to next error" msgstr "Salta al següent error" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to previous bookmark" msgstr "Ves al marcador anterior" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to previous error" msgstr "Salta a l'error previ" #: lazarusidestrconsts.lismenulowercaseselection msgid "Lowercase selection" msgstr "Fica a minúscules la selecció" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." msgstr "Fes cadena del recurs ..." #: lazarusidestrconsts.lismenunewform msgid "New Form" msgstr "Nova forma" #: lazarusidestrconsts.lismenunewother msgid "New ..." msgstr "Nou ..." #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." msgstr "" #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." msgstr "Nou projecte ..." #: lazarusidestrconsts.lismenunewprojectfromfile msgid "New Project from file ..." msgstr "Nou projecte des del fitxer ..." #: lazarusidestrconsts.lismenunewunit msgctxt "lazarusidestrconsts.lismenunewunit" msgid "New Unit" msgstr "Nova unitat" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "Ajuda en línia" #: lazarusidestrconsts.lismenuopen #, fuzzy #| msgid "Open ..." msgid "&Open ..." msgstr "Obre ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open filename at cursor" msgstr "Obre nom del fitxer al cursor" #: lazarusidestrconsts.lismenuopenpackage msgid "Open loaded package ..." msgstr "Obre el paquet carregat ..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open package file (.lpk) ..." msgstr "Obre arxiu de paquet (.lpk)" #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open package of current unit" msgstr "Obre el paquet de la unitat actual" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." msgstr "Obre el projecte ..." #: lazarusidestrconsts.lismenuopenrecent #, fuzzy #| msgid "Open Recent ..." msgid "Open &Recent ..." msgstr "Obre recent ..." #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open recent package ..." msgstr "Obre el paquet recent ..." #: lazarusidestrconsts.lismenuopenrecentproject msgid "Open Recent Project ..." msgstr "Obre el projecte recent ..." #: lazarusidestrconsts.lismenupackage msgid "&Package" msgstr "" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph ..." msgstr "Gràfica dels paquets ..." #: lazarusidestrconsts.lismenupackagelinks msgid "Package links ..." msgstr "" #: lazarusidestrconsts.lismenupaste msgctxt "lazarusidestrconsts.lismenupaste" msgid "Paste" msgstr "Enganxa" #: lazarusidestrconsts.lismenupause msgctxt "lazarusidestrconsts.lismenupause" msgid "Pause" msgstr "Pausa" #: lazarusidestrconsts.lismenuproject msgid "&Project" msgstr "&Projecte" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" msgstr "Inspector del projecte" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." msgstr "Opcions del projecte ..." #: lazarusidestrconsts.lismenuprojectrun msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "Run" msgstr "Executa" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." msgstr "Publica el projecte ..." #: lazarusidestrconsts.lismenuquickcompile msgid "Quick compile" msgstr "Compilació ràpida" #: lazarusidestrconsts.lismenuquicksyntaxcheck msgid "Quick syntax check" msgstr "Comprova la sintaxi ràpidament" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "" #: lazarusidestrconsts.lismenuquit #, fuzzy #| msgid "Quit" msgid "&Quit" msgstr "Surt" #: lazarusidestrconsts.lismenuredo msgctxt "lazarusidestrconsts.lismenuredo" msgid "Redo" msgstr "Torna a fer" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." msgstr "Elimina del projecte ..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Canvia el nom de l'identificador ..." #: lazarusidestrconsts.lismenureplace msgctxt "lazarusidestrconsts.lismenureplace" msgid "Replace" msgstr "Substitueix" #: lazarusidestrconsts.lismenureplace2 msgid "&Replace ..." msgstr "" #: lazarusidestrconsts.lismenureportingbug msgid "Reporting a bug..." msgstr "" #: lazarusidestrconsts.lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" msgstr "Torna a escanejar el directori del codi font del FPC" #: lazarusidestrconsts.lismenuresetdebugger msgid "Reset debugger" msgstr "Reinicia el depurador" #: lazarusidestrconsts.lismenurestart msgid "Restart" msgstr "Reinicia" #: lazarusidestrconsts.lismenurevert msgid "Revert" msgstr "Reverteix" #: lazarusidestrconsts.lismenurun msgid "&Run" msgstr "E&xecuta" #: lazarusidestrconsts.lismenurunfile msgid "Run File" msgstr "Executa el fitxer" #: lazarusidestrconsts.lismenurunparameters msgid "Run Parameters ..." msgstr "Paràmetres de l'execució ..." #: lazarusidestrconsts.lismenuruntocursor msgid "Run to cursor" msgstr "Executa al cursor" #: lazarusidestrconsts.lismenusave #, fuzzy #| msgid "Save" msgctxt "lazarusidestrconsts.lismenusave" msgid "&Save" msgstr "Desa" #: lazarusidestrconsts.lismenusaveall msgid "Save All" msgstr "Desa-ho Tot" #: lazarusidestrconsts.lismenusaveas #, fuzzy #| msgid "Save As ..." msgid "Save &As ..." msgstr "Anomena i desa ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" msgstr "Desa el projecte" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." msgstr "Anomena i desa el projecte ..." #: lazarusidestrconsts.lismenusearch msgid "&Search" msgstr "&Cerca" #: lazarusidestrconsts.lismenuselect msgid "Select" msgstr "Selecciona" #: lazarusidestrconsts.lismenuselectall msgid "Select all" msgstr "Selecciona-ho Tot" #: lazarusidestrconsts.lismenuselectcodeblock msgid "Select code block" msgstr "Selecciona el bloc del codi" #: lazarusidestrconsts.lismenuselectline msgid "Select line" msgstr "Selecciona la línia" #: lazarusidestrconsts.lismenuselectparagraph msgid "Select paragraph" msgstr "Selecciona el paràgraf" #: lazarusidestrconsts.lismenuselecttobrace msgid "Select to brace" msgstr "Selecciona la tira" #: lazarusidestrconsts.lismenuselectword msgid "Select word" msgstr "Sel·lecciona paraula" #: lazarusidestrconsts.lismenusetfreebookmark msgid "Set a free bookmark" msgstr "Estableix un marcador lliure" #: lazarusidestrconsts.lismenushowexecutionpoint msgid "Show execution point" msgstr "" #: lazarusidestrconsts.lismenusortselection msgid "Sort selection ..." msgstr "Ordena la selecció ..." #: lazarusidestrconsts.lismenustepinto msgid "Step into" msgstr "Pas a pas per instruccions" #: lazarusidestrconsts.lismenustepout msgid "Step out" msgstr "" #: lazarusidestrconsts.lismenustepover msgid "Step over" msgstr "Pas a pas per funcions" #: lazarusidestrconsts.lismenustop msgctxt "lazarusidestrconsts.lismenustop" msgid "Stop" msgstr "Atura" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to spaces in selection" msgstr "Tabuladors a espais en la selecció" #: lazarusidestrconsts.lismenutemplateabout msgid "About" msgstr "Quant a" #: lazarusidestrconsts.lismenutemplateclose msgctxt "lazarusidestrconsts.lismenutemplateclose" msgid "Close" msgstr "Tanca" #: lazarusidestrconsts.lismenutemplatecontents msgid "Contents" msgstr "Contingut" #: lazarusidestrconsts.lismenutemplatecopy msgctxt "lazarusidestrconsts.lismenutemplatecopy" msgid "Copy" msgstr "Copia" #: lazarusidestrconsts.lismenutemplatecut msgctxt "lazarusidestrconsts.lismenutemplatecut" msgid "Cut" msgstr "Talla" #: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" msgstr "Menú d'edició normalitzat" #: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" msgstr "Menú del fitxer normalitzat" #: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" msgstr "Menú d'ajuda normalitzat" #: lazarusidestrconsts.lismenutemplateedit msgctxt "lazarusidestrconsts.lismenutemplateedit" msgid "Edit" msgstr "Edita" #: lazarusidestrconsts.lismenutemplateexit msgctxt "lazarusidestrconsts.lismenutemplateexit" msgid "Exit" msgstr "Surt" #: lazarusidestrconsts.lismenutemplatefile msgid "File" msgstr "Fitxer" #: lazarusidestrconsts.lismenutemplatefind msgctxt "lazarusidestrconsts.lismenutemplatefind" msgid "Find" msgstr "Cerca" #: lazarusidestrconsts.lismenutemplatefindnext msgid "Find Next" msgstr "Cerca el següent" #: lazarusidestrconsts.lismenutemplatehelp msgctxt "lazarusidestrconsts.lismenutemplatehelp" msgid "Help" msgstr "Ajuda" #: lazarusidestrconsts.lismenutemplatenew msgid "New" msgstr "Nou" #: lazarusidestrconsts.lismenutemplateopen msgctxt "lazarusidestrconsts.lismenutemplateopen" msgid "Open" msgstr "Obre" #: lazarusidestrconsts.lismenutemplateopenrecent msgctxt "lazarusidestrconsts.lismenutemplateopenrecent" msgid "Open Recent" msgstr "Obre recent" #: lazarusidestrconsts.lismenutemplatepaste msgctxt "lazarusidestrconsts.lismenutemplatepaste" msgid "Paste" msgstr "Enganxa" #: lazarusidestrconsts.lismenutemplateredo msgctxt "lazarusidestrconsts.lismenutemplateredo" msgid "Redo" msgstr "Torna a fer" #: lazarusidestrconsts.lismenutemplatesave msgctxt "lazarusidestrconsts.lismenutemplatesave" msgid "Save" msgstr "Desa" #: lazarusidestrconsts.lismenutemplatesaveas msgid "Save As" msgstr "Anomena i desa" #: lazarusidestrconsts.lismenutemplatetutorial msgid "Tutorial" msgstr "Programa d'aprenentatge" #: lazarusidestrconsts.lismenutemplateundo msgctxt "lazarusidestrconsts.lismenutemplateundo" msgid "Undo" msgstr "" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle comment" msgstr "" #: lazarusidestrconsts.lismenutools msgid "&Tools" msgstr "Eine&s" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment selection" msgstr "Treu comentari de la selecció" #: lazarusidestrconsts.lismenuundo msgctxt "lazarusidestrconsts.lismenuundo" msgid "Undo" msgstr "Desfés" #: lazarusidestrconsts.lismenuunindentselection msgid "Unindent selection" msgstr "Dessagna la selecció" #: lazarusidestrconsts.lismenuuppercaseselection msgid "Uppercase selection" msgstr "Fica a majúscules la selecció" #: lazarusidestrconsts.lismenuview msgid "&View" msgstr "&Visualitza" #: lazarusidestrconsts.lismenuviewanchoreditor #, fuzzy #| msgid "View Anchor Editor" msgid "Anchor Editor" msgstr "Mostra l'editor de les àncores" #: lazarusidestrconsts.lismenuviewassembler msgid "Assembler" msgstr "" #: lazarusidestrconsts.lismenuviewbreakpoints msgid "BreakPoints" msgstr "Punts de ruptura" #: lazarusidestrconsts.lismenuviewcallstack msgid "Call Stack" msgstr "Pila de les Crides" #: lazarusidestrconsts.lismenuviewcodebrowser msgid "Code Browser" msgstr "" #: lazarusidestrconsts.lismenuviewcodeexplorer msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" msgid "Code Explorer" msgstr "Explorador del codi" #: lazarusidestrconsts.lismenuviewcomponentpalette #, fuzzy #| msgid "View Component Palette" msgid "Component Palette" msgstr "Vore Paleta de Components" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" msgstr "C&omponents" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug output" msgstr "Sortida de depuració" #: lazarusidestrconsts.lismenuviewforms msgid "Forms..." msgstr "Formes..." #: lazarusidestrconsts.lismenuviewidespeedbuttons msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons" msgid "IDE speed buttons" msgstr "" #: lazarusidestrconsts.lismenuviewjumphistory #, fuzzy #| msgid "View Jump-History ..." msgid "Jump-History ..." msgstr "Mostra la història dels salts ..." #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" msgstr "Variables Locals" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" msgstr "Missatges" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" msgid "Object Inspector" msgstr "Inspector dels objectes" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" msgid "Registers" msgstr "" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" msgstr "Cerca els resultats" #: lazarusidestrconsts.lismenuviewsource msgid "&View Source" msgstr "" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" msgid "Source Editor" msgstr "Editor del codi font" #: lazarusidestrconsts.lismenuviewtodolist msgctxt "lazarusidestrconsts.lismenuviewtodolist" msgid "ToDo List" msgstr "Llista ToDo" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Canvia visió forma/unitat" #: lazarusidestrconsts.lismenuviewunitdependencies #, fuzzy #| msgid "View Unit Dependencies" msgid "Unit Dependencies" msgstr "Mostra les dependències de les unitats" #: lazarusidestrconsts.lismenuviewunitinfo #, fuzzy #| msgid "View Unit Information" msgid "Unit Information" msgstr "Mostra la informació de les unitats" #: lazarusidestrconsts.lismenuviewunits msgid "Units..." msgstr "Unitats..." #: lazarusidestrconsts.lismenuviewwatches msgid "Watches" msgstr "Controls" #: lazarusidestrconsts.lismenuwindow msgid "&Window" msgstr "" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" msgstr "" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" msgstr "" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" msgstr "" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" msgstr "" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" msgstr "Paquets que falten" #: lazarusidestrconsts.lismissingunitschoices msgid "Your choices are:" msgstr "" #: lazarusidestrconsts.lismissingunitscomment msgid "Comment Out" msgstr "" #: lazarusidestrconsts.lismissingunitsfordelphi msgid "For Delphi only" msgstr "" #: lazarusidestrconsts.lismissingunitsinfo1 msgid "1) Comment out the selected units." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo1b msgid "1) Use the units only for Delphi." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo2 msgid "2) Search for units. Found paths are added to project settings." msgstr "" #: lazarusidestrconsts.lismissingunitsinfo3 msgid "3) Abort now, install packages or fix paths and try again." msgstr "" #: lazarusidestrconsts.lismissingunitssearch msgid "Search Unit Path" msgstr "" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lismodify msgid "&Modify" msgstr "" #: lazarusidestrconsts.lismore msgid "More" msgstr "" #: lazarusidestrconsts.lismovepage msgid "Move Page ..." msgstr "" #: lazarusidestrconsts.lisms msgid "(ms)" msgstr "" #: lazarusidestrconsts.lismvdocking msgid "Docking" msgstr "" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Desa missatges a arxiu (*.txt)" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" msgstr "" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" msgstr "Nom del nou procediment" #: lazarusidestrconsts.lisnever msgid "Never" msgstr "" #: lazarusidestrconsts.lisnew msgid "new" msgstr "" #: lazarusidestrconsts.lisnewancestors msgid "New Ancestors" msgstr "" #: lazarusidestrconsts.lisnewbuildmode msgid "New build mode" msgstr "" #: lazarusidestrconsts.lisnewclass msgid "New Class" msgstr "Nova Classe" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" msgstr "" #: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram msgid "Create a new program." msgstr "Crea un nou programa." #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." msgstr "Crea un nou fitxer d'editor.%sEscolliu-ne un tipus" #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Crea un nou fitxer de text buit." #: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." msgstr "Crea una nova aplicació gràfica.%sEl Lazarus manté el fitxer del programa" #: lazarusidestrconsts.lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Crea una nova unitat Pascal." #: lazarusidestrconsts.lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." msgstr "Crea un nou programa.%sEl Lazarus manté el fitxer del programa." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." msgstr "Crea un nou projecte.%sEscolliu-ne un tipus." #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "Crea un nou paquet normalitzat.%sUn paquet és una col·lecció d'unitats i components." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "Crea una nova unitat amb un mòdul de dades." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame" msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "Crea una nova unitat amb una forma LCL." #: lazarusidestrconsts.lisnewdlginheritanexistingcomponent msgid "Inherit from an existing component." msgstr "" #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" msgstr "No hi ha cap element seleccionat" #: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "Si us plau, primer seleccioneu un element." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" msgstr "" #: lazarusidestrconsts.lisnewgroupasetofmodes msgid "New group - a set of modes" msgstr "" #: lazarusidestrconsts.lisnewproject msgid "%s - (new project)" msgstr "%s - (nou projecte)" #: lazarusidestrconsts.lisnewsetting msgid "New setting" msgstr "" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections:" msgstr "" #: lazarusidestrconsts.lisno msgid "No" msgstr "" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" msgstr "" #: lazarusidestrconsts.lisnochange msgid "No change" msgstr "Cap canvi" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" msgstr "No hi ha codi seleccionat" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "No s'han heretat les opcions del compilador" #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" msgstr "" #: lazarusidestrconsts.lisnolfmfile msgid "No LFM file" msgstr "" #: lazarusidestrconsts.lisnoname msgid "noname" msgstr "sense nom" #: lazarusidestrconsts.lisnone msgid "%snone" msgstr "" #: lazarusidestrconsts.lisnone2 msgid "none" msgstr "" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" msgstr "" #: lazarusidestrconsts.lisnopascalfile msgid "No pascal file" msgstr "" #: lazarusidestrconsts.lisnoprogramfilesfound msgid "No program file %s%s%s found." msgstr "" #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "No s'ha trobat la secció de la cadena del recurs" #: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "" #: lazarusidestrconsts.lisnostringconstantfound msgid "No string constant found" msgstr "No s'ha trobat la constant de cadena" #: lazarusidestrconsts.lisnotadelphiproject msgid "Not a Delphi project" msgstr "No un projecte Delphi" #: lazarusidestrconsts.lisnotadelphiunit msgid "Not a Delphi unit" msgstr "No una unitat Delphi" #: lazarusidestrconsts.lisnotavalidpascalidentifier msgid "Not a valid pascal identifier" msgstr "" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Free Pascal" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Lazarus" #: lazarusidestrconsts.lisnotimplemented msgid "Not implemented" msgstr "" #: lazarusidestrconsts.lisnotimplementedyet msgid "Not implemented yet:%s%s" msgstr "" #: lazarusidestrconsts.lisnotimplementedyet2 msgid "Not implemented yet." msgstr "" #: lazarusidestrconsts.lisnotnow msgid "Not now" msgstr "Ara no" #: lazarusidestrconsts.lisnpcreate msgid "Create" msgstr "Crea" #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" msgstr "Crea un nou projecte" #: lazarusidestrconsts.lisnpselectaprojecttype msgid "Select a project type" msgstr "Selecciona un tipus de projecte" #: lazarusidestrconsts.lisnumberoffilestoconvert msgid "Number of files to convert: %s" msgstr "" #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" msgstr "" #: lazarusidestrconsts.lisobjectpath msgid "object path" msgstr "trajectòria dels objectes" #: lazarusidestrconsts.lisoff msgid "? (Off)" msgstr "" #: lazarusidestrconsts.lisoifaddtofavouriteproperties msgid "Add to favourite properties" msgstr "Afegeix a les propietats favorites" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "" #: lazarusidestrconsts.lisoifclassnotfound msgid "Class %s%s%s not found." msgstr "No s'ha trobat la Classe %s%s%S" #: lazarusidestrconsts.lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" msgstr "" #: lazarusidestrconsts.lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "auto intal·la dinàmicament" #: lazarusidestrconsts.lisoipautoinstallstatic msgid "auto install static" msgstr "auto intal·la estàticament" #: lazarusidestrconsts.lisoipdescription msgid "Description: " msgstr "Descripció: " #: lazarusidestrconsts.lisoipdescriptiondescription msgid "%sDescription: %s" msgstr "%sDescripció: %s" #: lazarusidestrconsts.lisoipfilename msgid "Filename: %s" msgstr "Nom del fitxer: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" msgstr "instal·lat dinàmicament" #: lazarusidestrconsts.lisoipinstalledstatic msgid "installed static" msgstr "instal·lat estàticament" #: lazarusidestrconsts.lisoipmissing msgid "missing" msgstr "falta" #: lazarusidestrconsts.lisoipmodified msgid "modified" msgstr "modificat" #: lazarusidestrconsts.lisoipnopackageselected msgid "No package selected" msgstr "No hi ha cap paquet seleccionat" #: lazarusidestrconsts.lisoipopenloadedpackage msgid "Open loaded package" msgstr "Obre el paquet carregat" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" msgstr "Nom del paquet" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" msgstr "Si us plau, seleccioneu un paquet" #: lazarusidestrconsts.lisoippleaseselectapackagetoopen msgid "Please select a package to open" msgstr "Si us plau, seleccioneu un paquet per obrir" #: lazarusidestrconsts.lisoipreadonly msgid "readonly" msgstr "només de lectura" #: lazarusidestrconsts.lisoipstate msgid "State" msgstr "Estat" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" msgstr "%sAquest paquet està intal·lat, però no s'ha trobat el fitxer lpk" #: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" msgstr "%sAquest paquet s'ha creat automàticament" #: lazarusidestrconsts.lisok #, fuzzy #| msgid "&Ok" msgid "&OK" msgstr "D'Ac&ord" #: lazarusidestrconsts.lisold msgid "old" msgstr "" #: lazarusidestrconsts.lisoldancestors msgid "Old Ancestors" msgstr "" #: lazarusidestrconsts.lisoldclass msgid "Old Class" msgstr "" #: lazarusidestrconsts.lison msgid "? (On)" msgstr "" #: lazarusidestrconsts.lisonbreaklineiereturnorenterkey msgid "On break line (i.e. return or enter key)" msgstr "" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" msgstr "Cerca només paraules senceres" #: lazarusidestrconsts.lisonpastefromclipboard msgid "On paste from clipboard" msgstr "" #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" msgstr "Obre com arxiu XML" #: lazarusidestrconsts.lisopendesigneronopenunit msgid "Open designer on open unit" msgstr "" #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" msgstr "" #: lazarusidestrconsts.lisopenfile msgid "Open file" msgstr "Obre el fitxer" #: lazarusidestrconsts.lisopenfile2 msgid "Open File ..." msgstr "" #: lazarusidestrconsts.lisopenlfm msgid "Open %s" msgstr "Obre %s" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" msgstr "Voleu obrir el paquet?" #: lazarusidestrconsts.lisopenpackage2 msgid "Open package %s" msgstr "" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" msgstr "Obre fitxer del paquet" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" msgstr "Voleu obrir el projecte?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" msgstr "Obre projecte" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" msgstr "Opre projecte de nou" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" msgstr "Obre el fitxer de projecte" #: lazarusidestrconsts.lisopensymlink msgid "Open symlink" msgstr "" #: lazarusidestrconsts.lisopentarget msgid "Open target" msgstr "" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "" #: lazarusidestrconsts.lisopenthepackage msgid "Open the package %s?" msgstr "Obrir el paquet %s?" #: lazarusidestrconsts.lisopentheproject msgid "Open the project %s?" msgstr "Obrir el projecte %s?" #: lazarusidestrconsts.lisor msgid "or" msgstr "" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." msgstr "" #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau msgid "%soverride the project operating system. e.g. win32 linux. default: %s" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" msgstr "" #: lazarusidestrconsts.lisoverwritefile msgid "Overwrite file?" msgstr "Voleu sobrescriure el fitxer?" #: lazarusidestrconsts.lisoverwritefileondisk msgid "Overwrite file on disk" msgstr "Sobreescriu arxiu al disc" #: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot msgid "'Owner' is already used by TReader/TWriter. Please choose another name." msgstr "" #: lazarusidestrconsts.lispackage msgid "Package" msgstr "Paquet" #: lazarusidestrconsts.lispackage2 msgid "package %s" msgstr "" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" msgstr "Informació del Paquet" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." msgstr "" #: lazarusidestrconsts.lispackagenamecontains msgid "Package name contains ..." msgstr "" #: lazarusidestrconsts.lispackageneedsinstallation msgid "Package needs installation" msgstr "S'ha d'instal·lar el paquet" #: lazarusidestrconsts.lispackagestoinstallintheide msgid "Packages to install in the IDE" msgstr "Paquets per instal·lar a l'IDE" #: lazarusidestrconsts.lispackageunit msgid "package unit" msgstr "" #: lazarusidestrconsts.lispascalsourcefile msgid "Pascal source file" msgstr "Arxiu font Pascal" #: lazarusidestrconsts.lispascalunit msgid "Pascal unit" msgstr "Unitat Pascal" #: lazarusidestrconsts.lispasscount msgid "Pass Count" msgstr "" #: lazarusidestrconsts.lispasteclipboard msgid "paste clipboard" msgstr "" #: lazarusidestrconsts.lispastetextfromclipboard msgid "Paste text from clipboard" msgstr "" #: lazarusidestrconsts.lispath msgid "Path" msgstr "" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" msgid "Browse" msgstr "Navega" #: lazarusidestrconsts.lispatheditmovepathdown msgid "Move path down" msgstr "Mou la trajectòria avall" #: lazarusidestrconsts.lispatheditmovepathup msgid "Move path up" msgstr "Mou la trajectòria amunt" #: lazarusidestrconsts.lispatheditpathtemplates msgid "Path templates" msgstr "Plantilles de la trajectòria" #: lazarusidestrconsts.lispatheditsearchpaths msgid "Search paths:" msgstr "Trajectòries de recerca:" #: lazarusidestrconsts.lispatheditselectdirectory msgid "Select directory" msgstr "Selecciona el directori" #: lazarusidestrconsts.lispathofthemakeutility msgid "Path of the make utility" msgstr "" #: lazarusidestrconsts.lispathtoinstance msgid "Path to failed Instance:" msgstr "" #: lazarusidestrconsts.lispckeditaddanitem msgid "Add an item" msgstr "Afegeix un element" #: lazarusidestrconsts.lispckeditaddtoproject msgctxt "lazarusidestrconsts.lispckeditaddtoproject" msgid "Add to project" msgstr "" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" msgstr "Aplica els canvis" #: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Crida %sRegistre%s procediment de l'unitat seleccionada" #: lazarusidestrconsts.lispckeditcleardependencydefaultfilename msgid "Clear dependency filename" msgstr "" #: lazarusidestrconsts.lispckeditcompile msgctxt "lazarusidestrconsts.lispckeditcompile" msgid "Compile" msgstr "Compila" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" msgstr "Voleu compilar-ho tot?" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" msgstr "Compila el paquet" #: lazarusidestrconsts.lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" msgstr "Opcions del compilador pel paquet %s" #: lazarusidestrconsts.lispckeditcompopts msgctxt "lazarusidestrconsts.lispckeditcompopts" msgid "Compiler Options" msgstr "Opcions del compilador" #: lazarusidestrconsts.lispckeditcreatemakefile msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" msgid "Create Makefile" msgstr "Crea Makefile" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" msgstr "" #: lazarusidestrconsts.lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Edita les opcions generals" #: lazarusidestrconsts.lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Edita les opcions per a compilar el paquet" #: lazarusidestrconsts.lispckeditfileproperties msgid "File Properties" msgstr "Propietats del fitxer" #: lazarusidestrconsts.lispckeditgeneraloptions msgid "General Options" msgstr "Opcions generals" #: lazarusidestrconsts.lispckedithelp msgctxt "lazarusidestrconsts.lispckedithelp" msgid "Help" msgstr "Ajuda" #: lazarusidestrconsts.lispckeditinstall msgid "Install" msgstr "Instal·la" #: lazarusidestrconsts.lispckeditinstallpackageintheide msgid "Install package in the IDE" msgstr "Instal·la el paquet a l'IDE" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "la versió màxima no és vàlida" #: lazarusidestrconsts.lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "La versió mínima no és vàlida" #: lazarusidestrconsts.lispckeditmaximumversion msgid "Maximum Version:" msgstr "Número màxim de versió:" #: lazarusidestrconsts.lispckeditminimumversion msgid "Minimum Version:" msgstr "Número mínim de la versió:" #: lazarusidestrconsts.lispckeditmodified msgid "Modified: %s" msgstr "Modificat: %s" #: lazarusidestrconsts.lispckeditmore msgid "More ..." msgstr "Més ..." #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" msgstr "Mou la dependènncia avall" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" msgstr "Mou la dependència amunt" #: lazarusidestrconsts.lispckeditpackage msgid "Package %s" msgstr "Paquet %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" msgstr "El paquet %s%s%s ha canviat.%sEl voleu desar?" #: lazarusidestrconsts.lispckeditpackagenotsaved msgid "package %s not saved" msgstr "no s'ha desat el paquet %s" #: lazarusidestrconsts.lispckeditpage msgid "%s, Page: %s" msgstr "%s, Pàgina: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" msgstr "Torna a afegir la dependència" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" msgstr "Torna a afegir el fitxer" #: lazarusidestrconsts.lispckeditreadonly msgid "Read Only: %s" msgstr "Només de lectura: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired msgid "Recompile all required" msgstr "S'ha de tornar a compilar tot" #: lazarusidestrconsts.lispckeditrecompileclean msgid "Recompile clean" msgstr "Torna a compilar en net" #: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "Voleu tornar a compilar aquest i tots el paquets requerits?" #: lazarusidestrconsts.lispckeditregisteredplugins msgid "Registered plugins" msgstr "Connectors registrats" #: lazarusidestrconsts.lispckeditregisterunit msgid "Register unit" msgstr "Registra la unitat" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" msgstr "Elimina la dependència" #: lazarusidestrconsts.lispckeditremovedependency2 msgid "Remove Dependency?" msgstr "Voleu eliminar la dependència?" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "Voleu eliminar la dependència %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" msgstr "Fitxers eliminats (aquestes entrades no estan desades en el fitxer lpk)" #: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" msgstr "S'han eliminat els paquets requerits (aquestes entrades no estan desades en el fitxer lpk" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" msgstr "Elimina el fitxer" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" msgstr "Voleu eliminar el fitxer?" #: lazarusidestrconsts.lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgstr "Voleu eliminar el fitxer %s%s%s%s del paquet %s%s%s?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" msgstr "Elimina l'element seleccionat" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" msgstr "Paquets requerits" #: lazarusidestrconsts.lispckeditsavechanges msgid "Save Changes?" msgstr "Voleu desar els canvis?" #: lazarusidestrconsts.lispckeditsavepackage msgid "Save package" msgstr "Desa el paquet" #: lazarusidestrconsts.lispckeditsetdependencydefaultfilename msgid "Store dependency filename" msgstr "" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "La versió màxima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "La versió mínima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" msgstr "Desinstal·la" #: lazarusidestrconsts.lispckeditviewpackgesource msgid "View Package Source" msgstr "Mostra les fonts dels paquets" #: lazarusidestrconsts.lispckexplautocreated msgid "AutoCreated" msgstr "Creat automàticament" #: lazarusidestrconsts.lispckexplinstalled msgid "Installed" msgstr "Instal·lat" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" msgstr "Instal·la en el proper inici" #: lazarusidestrconsts.lispckexplisrequiredby msgid "Selected package is required by:" msgstr "El paquet seleccionat el requereix:" #: lazarusidestrconsts.lispckexplloadedpackages msgid "Loaded Packages:" msgstr "Paquets carregats:" #: lazarusidestrconsts.lispckexplpackagenotfound msgid "Package %s not found" msgstr "No s'ha trobat el paquet %s" #: lazarusidestrconsts.lispckexplstate msgid "%sState: " msgstr "%sEstat: " #: lazarusidestrconsts.lispckexpluninstallonnextstart msgid "Uninstall on next start" msgstr "Desinstal·la en el proper inici" #: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Afegeix les opcions en els paquets i projectes dependents" #: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Afegeix les trajectòries en els paquets/projectes dependents" #: lazarusidestrconsts.lispckoptsauthor msgid "Author:" msgstr "Autor" #: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" msgstr "En muntar, incrementa la versió automàticament" #: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Munta de nou automàticament quan es necessiti" #: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Munta de nou automàticament quan es munti tot" #: lazarusidestrconsts.lispckoptscustom msgid "Custom" msgstr "Personalitzat" #: lazarusidestrconsts.lispckoptsdescriptionabstract msgid "Description/Abstract" msgstr "Descripció/Abstracte" #: lazarusidestrconsts.lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" msgstr "Temps de disseny i temp d'execució" #: lazarusidestrconsts.lispckoptsdesigntimeonly msgid "Designtime only" msgstr "Només temps de disseny" #: lazarusidestrconsts.lispckoptsideintegration msgid "IDE Integration" msgstr "Integració IDE" #: lazarusidestrconsts.lispckoptsinclude msgid "Include" msgstr "Inclou" #: lazarusidestrconsts.lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "El tipus del paquet no és vàlid" #: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation" msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" msgstr "Biblioteca" #: lazarusidestrconsts.lispckoptslicense msgid "License:" msgstr "llicència:" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" msgstr "Enllaçador" #: lazarusidestrconsts.lispckoptsmajor msgid "Major" msgstr "Major" #: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "Compilació manual (mai automàticament)" #: lazarusidestrconsts.lispckoptsminor msgid "Minor" msgstr "Menor" #: lazarusidestrconsts.lispckoptsobject msgid "Object" msgstr "Objecte" #: lazarusidestrconsts.lispckoptspackageoptions msgid "Package Options" msgstr "Opcions del paquet" #: lazarusidestrconsts.lispckoptspackagetype msgid "PackageType" msgstr "Tipus de paquet" #: lazarusidestrconsts.lispckoptsprovides msgid "Provides" msgstr "" #: lazarusidestrconsts.lispckoptsrelease msgid "Release" msgstr "Llença" #: lazarusidestrconsts.lispckoptsruntimeonly msgid "Runtime only" msgstr "Només en temps d'execució" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgstr "El paquet %s%s%s té el senyalador d'auto-intal·lar.%sAixò vol dir que s'instal·larà a l'IDE. Els paquets d'intal·lació%shan de ser paquets de temps de disseny." #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "" #: lazarusidestrconsts.lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "Actualitza/Munta de nou" #: lazarusidestrconsts.lispckoptsusage msgid "Usage" msgstr "Utilització" #: lazarusidestrconsts.lispdabort msgctxt "lazarusidestrconsts.lispdabort" msgid "Abort" msgstr "Avortar" #: lazarusidestrconsts.lispdprogress msgid "Progress" msgstr "Progrés" #: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" msgstr "" #: lazarusidestrconsts.lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "" #: lazarusidestrconsts.lispefilename msgid "Filename:" msgstr "Nom d'arxiu:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" msgstr "" #: lazarusidestrconsts.lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Nom d'arxiu per l'unitat no vàlid" #: lazarusidestrconsts.lispeinvalidunitname msgid "Invalid unitname" msgstr "Nom d'unitat no vàlida" #: lazarusidestrconsts.lispemovefiledown msgid "Move file down" msgstr "" #: lazarusidestrconsts.lispemovefileup msgid "Move file up" msgstr "" #: lazarusidestrconsts.lispesortfiles msgid "Sort files" msgstr "" #: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses" msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts.lispeunitname msgid "Unitname:" msgstr "Nom d'unitat:" #: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "" #: lazarusidestrconsts.lispeviewtodolist msgid "View ToDo list" msgstr "" #: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" msgstr "Afegeix CompiledSrcPath" #: lazarusidestrconsts.lispkgdefsoutputdirectory msgid "Output directory" msgstr "Directori de la sortida" #: lazarusidestrconsts.lispkgdefssrcdirmark msgid "Package Source Directory Mark" msgstr "Marca del directori font del paquet" #: lazarusidestrconsts.lispkgdefsunitpath msgid "Unit Path" msgstr "Trajectòria de la unitat" #: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Voleu obviar tots els canvis del paquet %s i recarregar-lo del fitxer?" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "La nova unitat no és a la trajectòria de les unitats" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" msgstr "Publica el paquet" #: lazarusidestrconsts.lispkgeditrevertpackage msgid "Revert package?" msgstr "Voleu revertir el paquet?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" msgstr "El fitxer %s%s%s%sja no és a la trajectòria d'unitats del paquet.%s%sVoleu afegir %s%s%s a la trajectòria de les unitats? " #: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" msgstr "L'ajuda en línia encara no està implementada" #: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "Feu un clic amb el botó dret a l'arbre d'elements per obtenir el menú emergent amb totes les funcions disponibles del paquet." #: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" msgstr "Hi ha més funcions en el menú emergent" #: lazarusidestrconsts.lispkgfiletypebinary msgid "Binary" msgstr "Binari" #: lazarusidestrconsts.lispkgfiletypeinclude msgid "Include file" msgstr "Inclou el fitxer" #: lazarusidestrconsts.lispkgfiletypeissues msgid "Issues xml file" msgstr "" #: lazarusidestrconsts.lispkgfiletypelfm msgid "LFM - Lazarus form text" msgstr "LFM - Lazarus Form Text" #: lazarusidestrconsts.lispkgfiletypelrs msgid "LRS - Lazarus resource" msgstr "LRS - Lazarus Resource" #: lazarusidestrconsts.lispkgfiletypemainunit msgid "Main Unit" msgstr "" #: lazarusidestrconsts.lispkgfiletypetext msgctxt "lazarusidestrconsts.lispkgfiletypetext" msgid "Text" msgstr "Text" #: lazarusidestrconsts.lispkgfiletypeunit msgctxt "lazarusidestrconsts.lispkgfiletypeunit" msgid "Unit" msgstr "Unitat" #: lazarusidestrconsts.lispkgfiletypevirtualunit msgid "Virtual Unit" msgstr "Unitat virtual" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" msgstr "%sS'està afegint nova dependència pel paquet %s: paquet %s%s" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" msgstr "%sS'està afegint nova dependència pel projecte %s: paquet %s%s" #: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "Afegeix unitat a la clausula uses del paquet. Desactiva aquesta opció sols per unitats que no deurien ser compilades en tots els casos." #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "" #: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." msgstr "No s'ha trobat un paquet necessari. Mireu-vos la gràfica dels paquets" #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Paquets instal·lats automàticament" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sAmbdós paquets estan connectats. Això vol dir, o que un paquet utilitza l'altre o que un tercer els utilitza tots dos." #: lazarusidestrconsts.lispkgmangbrokendependency msgid "Broken dependency" msgstr "Dependència Interrompuda" #: lazarusidestrconsts.lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" msgstr "Cercle en les dependències del paquet" #: lazarusidestrconsts.lispkgmangdeletefailed msgid "Delete failed" msgstr "Ha fallat l'eliminació" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Voleu eliminar el fitxer de paquet antic?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" msgstr "Voleu eliminar el fitxer de paquet antic %s%s%s?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Dependència sense propietari: %s" #: lazarusidestrconsts.lispkgmangerrorreadingfile msgid "Error reading file" msgstr "S'ha produït un error mentre es llegia el fitxer" #: lazarusidestrconsts.lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "S'ha produït un error mentre es llegia el paquet" #: lazarusidestrconsts.lispkgmangerrorwritingfile msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" msgid "Error writing file" msgstr "S'ha produït un error mentre s'escrivia el fitxer" #: lazarusidestrconsts.lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "S'ha produït un error mentre s'escrivia el paquet" #: lazarusidestrconsts.lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "El fitxer ja és al paquet" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" msgstr "El fitxer forma part del projecte" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "El nom del fitxer és diferent del nom del paquet" #: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "El nom del fitxer està essent utilitzat per un altre paquet" #: lazarusidestrconsts.lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "El nom del fitxer està essent utilitzat pel projecte" #: lazarusidestrconsts.lispkgmangfilenotfound msgid "File %s%s%s not found." msgstr "No s'ha trobat el fitxer %s%s%s." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" msgstr "No s'ha desat el fitxer" #: lazarusidestrconsts.lispkgmangignoreandsavepackagenow msgid "Ignore and save package now" msgstr "Ingnora i desa el paquet ara" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" msgstr "L'instal·lació del paquet %s instal·larà automàticament el paquet:" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" msgstr "L'instal·lació del paquet %s instal·larà automàticament els paquets:" #: lazarusidestrconsts.lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" msgstr "el nom del fitxer del compilador no és vàlid" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "L'extensió del fitxer no és vàlida" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "L'extensió del paquet no és vàlida" #: lazarusidestrconsts.lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "El nom del fitxer del paquet no és vàlid" #: lazarusidestrconsts.lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "El nom del paquet no és vàlid" #: lazarusidestrconsts.lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "El nom del paquet no és vàlid" #: lazarusidestrconsts.lispkgmanglazarus msgid "Lazarus" msgstr "Lazarus" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgstr "Carrega el paquet %s reemplaçarà el paquet %s%sdel fitxer %s.%sEl paquet antic està modificat.%s%sVoleu desar el paquet antic %s?" #: lazarusidestrconsts.lispkgmangnewpackage msgid "NewPackage" msgstr "Nou paquet" #: lazarusidestrconsts.lispkgmangpackage msgid "Package: %s" msgstr "Paquet: %s" #: lazarusidestrconsts.lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "El paquet %s%s%s ha canviat. El voleu desar?" #: lazarusidestrconsts.lispkgmangpackageconflicts msgid "Package conflicts" msgstr "Conflicte de paquets" #: lazarusidestrconsts.lispkgmangpackagefilemissing msgid "Package file missing" msgstr "" #: lazarusidestrconsts.lispkgmangpackagefilenotsaved msgid "Package file not saved" msgstr "" #: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" msgstr "El paquet %s%s%s no té un directori de sortida vàlid:%s%s%s%s" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "El paquet no és un paquet de temps de disseny" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" msgstr "Es requereix el paquet" #: lazarusidestrconsts.lispkgmangpackagemainsourcefile msgid "package main source file" msgstr "fitxer del codi font principal del paquet" #: lazarusidestrconsts.lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "Ja existeix el nom del paquet" #: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "Els paquets han de tenir l'extensió .lpk" #: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "Si us plau, deseu el fitxer abans d'afegir-lo a un paquet." #: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst msgid "Please save the package first." msgstr "Per favor, desa el paquet primer." #: lazarusidestrconsts.lispkgmangproject msgid "Project: %s" msgstr "Projecte: %s" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Voleu tornar a muntar el Lazarus?" #: lazarusidestrconsts.lispkgmangrenamefileinpackage msgid "Rename file in package?" msgstr "Voleu canviar el nom del fitxer en el paquet?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts.lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "Voleu substituir el fitxer existent %s%s%s?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" msgstr "Substitueix el fitxer" #: lazarusidestrconsts.lispkgmangsavepackage msgid "Save Package?" msgstr "Voleu desar el paquet?" #: lazarusidestrconsts.lispkgmangsavepackage2 msgid "Save package?" msgstr "Voleu desar el paquet?" #: lazarusidestrconsts.lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" msgstr "Desa el paquet %s (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "Voleu canviar a minúscules el nom del fitxer a%s%s%s%s?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" msgstr "" #: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "fitxer de configuració de paquets estàtics" #: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "El fitxer de compilador pel paquet %s no és un executable vàlid:%s%s" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" msgid "The file %s%s%s%sis already in the package %s." msgstr "El fitxer %s%s%s%sja és al paquet %s." #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." msgstr "El fitxer %s%s%s no és un paquet Lazarus." #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgstr "El nom de fitxer %s%s%s no correspon al nom del paquet %s%s%s en el fitxer. %sVoleu canviar nom del paquet a %s%s%s?" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no han de compartir fitxers." #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgstr "El nom de fitxer %s%s%s està essent utilitzat pel%s paquet %s%s%s%s en el fitxer %s%s%s." #: lazarusidestrconsts.lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." msgstr "" #: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "Ha fallat la carrega del següent paquet:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "Ha fallat la carrega dels següents paquets:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgstr "%sLes següents unitats s'afegiran a la secció USES de%s%s:%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." msgstr "El nom de fitxer de paquet %s%s%s en %s%s%s no és un nom de paquet Lazarus vàlid." #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgstr "El paquet %s és només un paquet de temps d'execució.%sAquests tipus de paquets no poden ser instal·lats a l'IDE." #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" msgstr "No s'ha pogut trobar el paquet marcat per instal·lar %s%s%s.%sVoleu eliminar la dependència de la llista de paquets de la instal·lació?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgstr "El paquet %s el requereix %s, el qual està marcat per instal·lar.%sMireu la gràfica del paquet." #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "El nom de paquet %s%s%s no és un nom de paquet vàlid%sSi us plau, escolliu-ne un altre (p.ex. paquet1.lpk)" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgstr "El nom del paquet %s%s%s del%sfitxer %s%s%s no és vàlid." #: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" msgstr "El paquet %s és propietari del fitxer%s%s%s%s.%sVoleu canviar el nom del fitxer en el paquet també?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "S'ha marcat el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La des-instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "S'ha marcat per instal·lar el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgstr "El projecte requereix el paquet %s%s%s.%sPerò no s'ha trobat. Mireu Projecte -> Inspector del Projecte." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "Hi ha dues unitats amb el mateix nom:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s" #: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "Hi ha un cercle en els paquets requerits. Mireu la gràfica de paquets." #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgstr "Hi ha una unitat FPC amb el mateix nom que un paquet:%s%s%s%s%s%s" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgstr "Hi ha una unitat FPC amb el mateix nom que:%s%s%s%s%s de %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgstr "Ja hi ha un altre paquet amb el nom %s%s%s.%sPaquet amb conficte: %s%s%s%sFitxer: %s%s%s" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMireu Components -> Gràfica dels paquets.%sNo es pot reemplaçar." #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "Hi ha un paquet no desat en els paquets requerits. Mireu la gràfica dels paquets." #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgstr "Hi ha una unitat amb el mateix nom que un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s" #: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" msgstr "Aquest fitxer l'ha creat automàticament el Lazarus. No l'editeu!" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" #: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." msgstr "Aquesta font només s'utilitza per compilar i instal·lar el paquet." #: lazarusidestrconsts.lispkgmangunabletocreatedirectory msgid "Unable to create directory" msgstr "No es pot crear el directori" #: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." msgstr "No es pot crear el directori de sortida %s%s%s%spel paquet %s." #: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." msgstr "No es pot crear el directori sortida font %s%s%s%s pel paquet %s." #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." msgstr "No es pot crear el directori destinació del Lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els vostres paquets personalitzats." #: lazarusidestrconsts.lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." msgstr "No es pot eliminar el fitxer %s%s%s." #: lazarusidestrconsts.lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "No es pot eliminar el fitxer" #: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." msgstr "No es pot eliminar el fitxer antic %s%s%s%spel paquet %s." #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgstr "" #: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgstr "No es pot llegir fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgstr "No es pot escriure el paquet %s%s%s%sal fitxer %s%s%s.%sError: %s" #: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgstr "No es pot escriure el fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Voleu desinstal·lar el paquet?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 msgid "Uninstall package %s?" msgstr "Voleu desinstal·lar el paquet %s?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" msgstr "No s'ha desat el paquet" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" msgstr "Utilitza Unitat" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Avís: El fitxer %s%s%s%spertany al projecte actual." #: lazarusidestrconsts.lispkgreg msgid "Package Registration" msgstr "" #: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" msgstr "No es poden registrar els components sense unitat" #: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" msgstr "" #: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" msgstr "La classe del component %s%s%s ja està definida" #: lazarusidestrconsts.lispkgsysfilename msgid "%s%sFile Name: %s%s%s" msgstr "%s%sNom del fitxer: %s%s%s" #: lazarusidestrconsts.lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "La classe del component no és vàlida" #: lazarusidestrconsts.lispkgsysinvalidunitname msgid "Invalid Unitname: %s" msgstr "El nom de la unitat no és vàlid: %s" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" msgstr "No s'ha trobat el fitxer del paquet" #: lazarusidestrconsts.lispkgsysregisterprocedureisnil msgid "Register procedure is nil" msgstr "El procediment del registre és NIL" #: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." msgstr "S'ha cridat RegisterUnit, però no hi ha cap paquet registrant." #: lazarusidestrconsts.lispkgsysregistrationerror msgid "Registration Error" msgstr "S'ha produït un error de registre" #: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" msgstr "SynEdit - el component editor utilitzat pel Lazarus. http://sourceforge.net/projects/synedit/" #: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." msgstr "La FCL - FreePascal Component Library, proveeix les classes base per l'object pascal" #: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." msgstr "La LCL - Lazarus Component Library conté tots els components base per editar formes." #: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgstr "" #: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." msgstr "" #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." msgstr "Aquest és el paquet predeterminat. S'utilitza només per components sense paquet. Aquests components estan desfasats." #: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." msgstr "" #: lazarusidestrconsts.lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sNom de la unitat: %s%s%s" #: lazarusidestrconsts.lispkgsysunitnotfound msgid "Unit not found: %s%s%s" msgstr "No s'ha trobat la unitat: %s%s%s" #: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" msgstr "S'ha eliminat la unitat %s%s%s del paquet" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "Aquest fitxer no és cap paquet carregat." #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispldexists msgid "Exists" msgstr "" #: lazarusidestrconsts.lispldglobal msgid "Global" msgstr "" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" msgstr "" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" msgstr "" #: lazarusidestrconsts.lispldshowgloballinks msgid "Show global links" msgstr "" #: lazarusidestrconsts.lispldshowuserlinks msgid "Show user links" msgstr "" #: lazarusidestrconsts.lisplduser msgid "User" msgstr "" #: lazarusidestrconsts.lispleasecheckthecompilername msgid "Please check the compiler name" msgstr "Si us plau, comproveu el nom del compilador" #: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory msgid "Please check the freepascal source directory" msgstr "Si us plau, comproveu el directori del codi font de FreePascal" #: lazarusidestrconsts.lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "Si us plau, obriu una unitat abans d'executar." #: lazarusidestrconsts.lispleaseselectabuildmodefirst msgid "Please select a build mode first." msgstr "" #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "Si us plau, seleccioneu el codi per extraure'n un nou procediment/mètode." #: lazarusidestrconsts.lisplistall msgid "" msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" msgstr "Canvia Font" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" msgstr "Flitra fent coincidir qualsevol part del mètode" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" msgstr "Filtra fent coincidir el principi del mètode" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" msgstr "Ves a la sel·lecció" #: lazarusidestrconsts.lisplistnone msgid "" msgstr "" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" msgstr "&Objectes" #: lazarusidestrconsts.lisplistprocedurelist msgid "Procedure List" msgstr "" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" msgid "Type" msgstr "Tipus" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "No desis cap informació de la sessió" #: lazarusidestrconsts.lispointer msgid "Pointer" msgstr "" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" msgstr "" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" msgstr "Desa en arxiu .lpi" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" msgstr "" #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" msgstr "" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " msgstr "" #: lazarusidestrconsts.lisprint msgid "Print" msgstr "Imprimeix" #: lazarusidestrconsts.lisprivate msgid "Private" msgstr "" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" msgstr "Mètode privat" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" msgstr "" #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" msgid "Procedure" msgstr "Procediment" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" msgstr "Procediment amb interfície" #: lazarusidestrconsts.lisprogram msgctxt "lazarusidestrconsts.lisprogram" msgid "Program" msgstr "programa" #: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgstr "Programa%sUn programa FreePascal. El Lazarus manté automàticament el fitxer del programa." #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" msgstr "S'ha detectat el programa" #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "El codi font del programa ha de tenir una extensió pascal com .pas, .pp o .lpr" #: lazarusidestrconsts.lisprojaddaddfilestoproject msgid "Add files to project" msgstr "" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" msgstr "Afegeix el fitxer al projecte" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Ja existeix la dependència" #: lazarusidestrconsts.lisprojaddeditorfile msgid "Add editor files" msgstr "Afegeix els fitxers de l'editor" #: lazarusidestrconsts.lisprojaddfiles msgid "Add files" msgstr "Afegeix els fitxers" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "La versió min/max no és vàlida" #: lazarusidestrconsts.lisprojaddinvalidpackagename msgid "Invalid packagename" msgstr "El nom del paquet no és vàlid" #: lazarusidestrconsts.lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" msgstr "El nom de la unitat pascal no és vàlid" #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" msgstr "la versió no és vàlida" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "Número de versió màxim (opcional):" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Número mínim de la versió (opcional):" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" msgstr "Nou requeriment" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" msgstr "Nom del paquet:" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" msgstr "No s'ha trobat el paquet" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgstr "No s'ha trobat la dependència %s%s%s.%sSi us plau, escolliu un paquet que existeixi" #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "La versió màxima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "La versió màxima és menor que la versió mínima" #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "La versió mínima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" #: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgstr "El nom de paquet %s%s%s no és vàlid.%sSi us plau, escolliu un paquet que existeixi." #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." msgstr "El projecte ja té una dependència pel paquet %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgstr "El nom d'unitat %s%s%s ja existeix en el projecte%sen el fitxer: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "El nom d'unitat %s%s%s ja existeix en la selecció%s en el fitxer: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." msgstr "El nom d'unitat %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.lisprojaddtoproject msgctxt "lazarusidestrconsts.lisprojaddtoproject" msgid "Add to project" msgstr "Afegeix al projecte" #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Ja existeix el nom de la unitat" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" msgstr "El projecte ha canviat" #: lazarusidestrconsts.lisprojectchangedondisk msgid "Project changed on disk" msgstr "" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" msgid "Project directory" msgstr "Directori del projecte" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" msgstr "Nom del fitxer del projecte" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" msgstr "Trajectòria dels inclosos del projecte" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" msgstr "S'ha detectat fitxer d'informacó del projecte" #: lazarusidestrconsts.lisprojectinformation msgid "Project Information" msgstr "Informació del projecte" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" msgstr "El projecte és executable" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" msgstr "" #: lazarusidestrconsts.lisprojectmacrounitpath msgid "macro ProjectUnitPath" msgstr "" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" msgstr "" #: lazarusidestrconsts.lisprojectpath msgid "Project Path:" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss msgid "Project %s raised exception class '%s'." msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess msgid "Project %s raised exception class '%s' with message:%s%s" msgstr "" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Trajectòria del codi font del projecte" #: lazarusidestrconsts.lisprojectsuccessfullybuilt #, fuzzy #| msgid "Project %s%s%s successfully built. :)" msgid "Project %s%s%s successfully built" msgstr "S'ha muntat amb èxit el projecte %s%s%s. :)" #: lazarusidestrconsts.lisprojectunit msgid "project unit" msgstr "" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" msgstr "Trajectòria de les unitats del projecte" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" msgstr "" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "Confirma l'eliminació de les dependències" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" msgstr "Voleu eliminar la dependència per %s?" #: lazarusidestrconsts.lisprojinspprojectinspector msgid "Project Inspector - %s" msgstr "Inspector del projecte - %s" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgid "Removed required packages" msgstr "S'han eliminat els paquets requerits" #: lazarusidestrconsts.lisprojinspremovefilefromproject msgid "Remove file %s from project?" msgstr "Voleu eliminar el fitxer %s del projecte?" #: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Construeix sempre (inclús si res ha canviat)" #: lazarusidestrconsts.lisprojoptserror msgctxt "lazarusidestrconsts.lisprojoptserror" msgid "Error" msgstr "S'ha produït un error" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "No es pot canviar la llista de les formes creades automàticament en el codi font del programa. %s Si us plau, corregiu primer els errors." #: lazarusidestrconsts.lisprojprojectsourcedirectorymark msgid "Project Source Directory Mark" msgstr "" #: lazarusidestrconsts.lispromptforvalue msgid "Prompt for value" msgstr "Demana el valor" #: lazarusidestrconsts.lispropertiesofconditionalcompileroption msgid "Properties of conditional compiler option" msgstr "" #: lazarusidestrconsts.lisprotected msgid "Protected" msgstr "" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" msgstr "Mètode protegit" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" msgstr "Mètode públic" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" msgstr "Mètode publicat" #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" msgstr "Publica el directori del projecte" #: lazarusidestrconsts.lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" msgstr "El filtre Exclude no és vàlid" #: lazarusidestrconsts.lispublprojinvalidincludefilter msgid "Invalid Include filter" msgstr "El filtre Include no és vàlid" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" msgstr "" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "Una unitat Pascal ha de tenir l'extensió .pp o .pas" #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" msgstr "" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" msgstr "Ja existeix una unitat amb aquest nom.%sArxiu: %s" #: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses" msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "" #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" msgstr "" #: lazarusidestrconsts.lispwnewproject msgid "New Project" msgstr "" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" msgstr "" #: lazarusidestrconsts.lispwopenrecentproject #, fuzzy #| msgid "Open Recent" msgctxt "lazarusidestrconsts.lispwopenrecentproject" msgid "Open Recent Project" msgstr "Obre recent" #: lazarusidestrconsts.lisquickfixes msgid "Quick fixes" msgstr "" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" msgstr "" #: lazarusidestrconsts.lisreaderror msgid "Read Error" msgstr "S'ha produït un error de lectura" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" msgstr "" #: lazarusidestrconsts.lisregisters msgctxt "lazarusidestrconsts.lisregisters" msgid "Registers" msgstr "" #: lazarusidestrconsts.lisregistersdlgname msgctxt "lazarusidestrconsts.lisregistersdlgname" msgid "Name" msgstr "Nom" #: lazarusidestrconsts.lisregistersdlgvalue msgctxt "lazarusidestrconsts.lisregistersdlgvalue" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" msgstr "" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" msgstr "" #: lazarusidestrconsts.lisremove msgid "remove" msgstr "" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Elimina totes les propietats no vàlides" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" msgstr "" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" msgstr "Elimina del projecte" #: lazarusidestrconsts.lisremovefromsearchpath msgid "Remove from search path" msgstr "" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" msgstr "" #: lazarusidestrconsts.lisremovethem msgid "Remove them" msgstr "" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" msgstr "Voleu canviar el nom del fitxer?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" msgstr "Ha fallat el canvi de nom del fitxer" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" msgstr "" #: lazarusidestrconsts.lisreopenproject msgid "Reopen project" msgstr "" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" msgstr "" #: lazarusidestrconsts.lisreplacementproptypes msgid "Replacement Properties and Types" msgstr "" #: lazarusidestrconsts.lisreplaceremoveunknown msgid "Replace unknown types and properties" msgstr "" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "" #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources msgid "Requires FPC 2.4 or above. Like Delphi resources" msgstr "" #: lazarusidestrconsts.lisrescan msgid "Rescan" msgstr "" #: lazarusidestrconsts.lisresourceloaderror msgid "Resource load error" msgstr "S'ha produït un error mentre es carregava el recurs" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" msgstr "S'ha produït un error mentre es desava el recurs" #: lazarusidestrconsts.lisresourcetypeofnewfiles msgid "Resource type of project:" msgstr "" #: lazarusidestrconsts.lisresult msgid "Result :=" msgstr "" #: lazarusidestrconsts.lisresult2 msgid "Result:" msgstr "" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "returns list of all values of case variable in front of variable" msgstr "" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" msgstr "Ha fallat la reversió" #: lazarusidestrconsts.lisright msgctxt "lazarusidestrconsts.lisright" msgid "Right" msgstr "Dreta" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" msgstr "" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "" #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisrightsides msgid "Right sides" msgstr "Costats drets" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" msgstr "Iguala l'espai dret" #: lazarusidestrconsts.lisroot msgid "Root" msgstr "" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" msgstr "El fitxer no és executable" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "L'aplicació amfitriona %s%s%s no és executable" #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" msgstr "Ha fallat executar a" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract methods - not yet overridden" msgstr "" #: lazarusidestrconsts.lissamabstractmethodsof msgid "Abstract methods of %s" msgstr "" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" msgstr "" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods msgid "%s is an abstract class, it has %s abstract methods." msgstr "" #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" msgstr "" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" msgstr "" #: lazarusidestrconsts.lissamselectnone msgid "Select none" msgstr "" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "" #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "" #: lazarusidestrconsts.lissave msgid "Save ..." msgstr "" #: lazarusidestrconsts.lissaveallmessagestofile msgid "Save all messages to file" msgstr "Desa tots els missatges al fitxer" #: lazarusidestrconsts.lissaveallmodified msgid "save all modified files" msgstr "desa tots els fitxers modificats" #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" msgstr "Diàleg desa i surt" #: lazarusidestrconsts.lissaveandrebuildide msgid "Save and rebuild IDE" msgstr "Desa i remunta l'IDE" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" msgstr "Voleu desar els canvis?" #: lazarusidestrconsts.lissavechangestoproject msgid "Save changes to project %s?" msgstr "Voleu desar els canvis del projecte %s?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "save current editor file" msgstr "desa el fitxer editor actual" #: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" msgstr "" #: lazarusidestrconsts.lissavefileas msgid "Save file as" msgstr "" #: lazarusidestrconsts.lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgstr "Voleu desar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" msgstr "" #: lazarusidestrconsts.lissaveproject msgid "Save project %s (*%s)" msgstr "" #: lazarusidestrconsts.lissavesettings msgid "Save Settings" msgstr "" #: lazarusidestrconsts.lissavespace msgid "Save " msgstr "Desa " #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" msgstr "Factor d'escalat:" #: lazarusidestrconsts.lissearchfor msgid "Search For " msgstr "Cerca" #: lazarusidestrconsts.lissearchunit msgid "Search unit" msgstr "" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " msgstr "" #: lazarusidestrconsts.lisseemessages msgid "See messages." msgstr "Visualitza els missatges." #: lazarusidestrconsts.lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" msgstr "%sMireu Projecte -> Inspector del Projecte" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" msgstr "Selecciona un element de l'ajuda:" #: lazarusidestrconsts.lisselectanode msgid "Select a node" msgstr "Selecciona un node" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Selecciona els fitxers de formes Delphi (*.dfm)" #: lazarusidestrconsts.lisselected msgid "Selected" msgstr "" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" msgstr "" #: lazarusidestrconsts.lisselectfile msgid "Select the file" msgstr "" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "La selecció excedeix la constant de la cadena" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" msgstr "Eina de selecció" #: lazarusidestrconsts.lisselecttheactivebuildmode msgid "Select the active build mode" msgstr "" #: lazarusidestrconsts.lissetdefault msgid "Set default" msgstr "" #: lazarusidestrconsts.lissetvalue msgid "Set value" msgstr "" #: lazarusidestrconsts.lisshort msgid "Short:" msgstr "" #: lazarusidestrconsts.lisshow msgid "Show" msgstr "" #: lazarusidestrconsts.lisshowemptyunitspackages msgid "Show empty units/packages" msgstr "" #: lazarusidestrconsts.lisshowglyphsfor msgid "Show Glyphs for:" msgstr "" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" msgstr "Mostra sugerències a l'inspector d'Objectes" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" msgstr "" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" msgstr "" #: lazarusidestrconsts.lisshowoldtaborder msgid "Show old tab order" msgstr "" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" msgstr "" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" msgstr "" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" msgstr "" #: lazarusidestrconsts.lisshowunits msgid "Show units" msgstr "" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" msgstr "" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" msgstr "" #: lazarusidestrconsts.lissibling msgid "Sibling" msgstr "" #: lazarusidestrconsts.lissimplesyntax msgid "Simple Syntax" msgstr "Sintaxi SImple" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project" msgstr "" #: lazarusidestrconsts.lissmallerratherthanfaster msgid "smaller rather than faster" msgstr "" #: lazarusidestrconsts.lissmatches msgid "Matches" msgstr "" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" msgstr "" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "Ho sento, aquest tipus encara no està implementat" #: lazarusidestrconsts.lissortselascending msgid "Ascending" msgstr "Ascendent" #: lazarusidestrconsts.lissortselcancel msgctxt "lazarusidestrconsts.lissortselcancel" msgid "Cancel" msgstr "Cancel·la" #: lazarusidestrconsts.lissortselcasesensitive msgctxt "lazarusidestrconsts.lissortselcasesensitive" msgid "&Case Sensitive" msgstr "" #: lazarusidestrconsts.lissortseldescending msgid "Descending" msgstr "Descendent" #: lazarusidestrconsts.lissortseldomain msgid "Domain" msgstr "Domini" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" msgstr "Ignora l'espai" #: lazarusidestrconsts.lissortsellines msgid "Lines" msgstr "Línies" #: lazarusidestrconsts.lissortseloptions msgctxt "lazarusidestrconsts.lissortseloptions" msgid "Options" msgstr "Opcions" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" msgstr "Paràgrafs" #: lazarusidestrconsts.lissortselpreview msgctxt "lazarusidestrconsts.lissortselpreview" msgid "Preview" msgstr "Visualització prèvia" #: lazarusidestrconsts.lissortselsort msgid "Accept" msgstr "Accepta" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" msgstr "Ordena la selecció" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" msgid "Words" msgstr "Paraules" #: lazarusidestrconsts.lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "Font i destinació son el mateix:%s%s" #: lazarusidestrconsts.lissourcebreakpoint msgid "&Source breakpoint" msgstr "" #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." msgstr "" #: lazarusidestrconsts.lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." msgstr "El directori font %s%s%s no existeix." #: lazarusidestrconsts.lissourcemodified msgid "Source modified" msgstr "S'ha modificat el codi font" #: lazarusidestrconsts.lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "El codi font de la pàgina %s%s%s ha canviat. Voleu desar-lo?" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" msgstr "" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" msgstr "Iguala els espais" #: lazarusidestrconsts.lissrcos msgid "Src OS" msgstr "" #: lazarusidestrconsts.lisssearching msgid "Searching" msgstr "Cercant" #: lazarusidestrconsts.lisssearchtext msgid "Search text" msgstr "Cerca text" #: lazarusidestrconsts.lisstartconversion msgid "Start Conversion" msgstr "" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" msgstr "Inicia amb un nou projecte" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Detindre la sessió de depuració i reconstruïr el projecte?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" msgstr "Voleu aturar la depuració?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" msgstr "Dentindre la sessió de depuració?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" msgstr "" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" msgstr "Voleu aturar la depuració?" #: lazarusidestrconsts.lisstrangelpifile msgid "Strange lpi file" msgstr "" #: lazarusidestrconsts.lisstreamerror msgid "Stream Error" msgstr "" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" msgstr "S'ha produït un error d'afluent" #: lazarusidestrconsts.lisstring msgid "String" msgstr "" #: lazarusidestrconsts.lisstyle msgctxt "lazarusidestrconsts.lisstyle" msgid "Style" msgstr "" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" msgstr "Subprocediment" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "Subprocediment en el mateix nivell" #: lazarusidestrconsts.lissuccess msgid "Success" msgstr "Correcte!" #: lazarusidestrconsts.lissvnrevision msgid "SVN Revision: " msgstr "Revisió SVN:" #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "El nom de la variable no és vàlid" #: lazarusidestrconsts.lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." msgstr "%s%s%s no és un identificador vàlid" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" msgstr "Substitueix la variable del sistema" #: lazarusidestrconsts.lissynedit msgid "SynEdit" msgstr "" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" msgstr "" #: lazarusidestrconsts.listab msgid "Tab" msgstr "Tabulador" #: lazarusidestrconsts.listaborderof msgid "Tab Order of" msgstr "" #: lazarusidestrconsts.listargetcpu msgid "Target CPU" msgstr "CPU destinació" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" msgstr "Nom del fitxer destinació del projecte" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" msgstr "" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" msgid "Target OS" msgstr "SO de destinació" #: lazarusidestrconsts.listcompilerinternalerror msgid "Internal compiler error! (%d)" msgstr "" #: lazarusidestrconsts.listddinserttodo msgid "Insert ToDo" msgstr "" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" msgstr "" #: lazarusidestrconsts.listemplateeditparamcellhelp msgid "" "Inserts an editable Cell, with a default value\n" "\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n" "\"default\",Sync, to Sync with a previous cell of equal default\n" msgstr "" #: lazarusidestrconsts.listestdirectory msgid "Test directory" msgstr "Directori de proves" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." msgstr "La classe %s%s%s és un TControl i no pot ser enganxat dins un no-control%sNo s'ha pogut enganxar." #: lazarusidestrconsts.listhecodetoolsfoundanerror msgid "The codetools found an error:%s%s%s" msgstr "" #: lazarusidestrconsts.listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." msgstr "L'ordre de després de %s%s%s no és executable." #: lazarusidestrconsts.listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" msgstr "L'ordre després de publicar no és vàlida:%s%s%s%s" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgstr "L'editor de component de classe %s%s%s%sinvocat amb el verb #%s %s%s%s%s ha generat l'error:%s%s%s%s" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "" #: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." msgstr "" #: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier." msgstr "" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "El nom del compilador actual %s%s%s%s no és un executable vàlid.%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" msgstr "El nom del compilador actual %s%s%s%sno és un executable vàlid.%s Si us plau, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgstr "El directori actual del codi font del Free Pascal %s%s%s%sno sembla correcte.%sComproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podreu crear aplicacions LCL.%sEscolliu D'ACORD per seleccionar el predeterminat %s%s%s.%sSi no, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" msgstr "El directori actual del Lazarus %s%s%s%sno sembla correcte.%sSense ell, no podreu crear aplicacions LCL.%s Comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." msgstr "La trajectòria de la unitat actual pel fitxer%s%s%s%s és %s%s%s%s.%s%sFalta la trajectòria a les unitats LCL %s%s%s.%s%sSuggeriment per aprenents:%sCreeu una aplicació Lazarus i poseu el fitxer dins del directori del projecte." #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" msgstr "El depurador %s%s%s%sno existeix o no es executable. %s%s%sMira Entorn -> Opcions del Depurador" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." msgstr "No existeix el directori de destinació%s%s%s%s." #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." msgstr "" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgstr "" #: lazarusidestrconsts.listhedirectoryisnotwritable msgid "The directory %s%s%s is not writable." msgstr "" #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgstr "" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." msgstr "" #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" msgstr "El fitxer %s%s%s" #: lazarusidestrconsts.listhefiledoesnotlooklikealpifile msgid "The file %s does not look like a lpi file." msgstr "" #: lazarusidestrconsts.listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" msgstr "" #: lazarusidestrconsts.listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" msgstr "El fitxer %s%s%s no és un projecte Delphi (.dpr)" #: lazarusidestrconsts.listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." msgstr "El fitxer %s%s%s no és una unitat Delphi." #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?" msgstr "" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "El fitxer %s%s%s%ssembla ser un programa. voleu tancar el projecte actual i crear un nou projecte Lazarus per aquest programa?%s\"No\" carregarà el fitxer com un codi font normal." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." msgstr "" #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgstr "No s'ha trobat el fitxer %s%s%s%s.%sEl voleu localitzar manualment ?%s" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "No s'ha trobat el fitxer %s%s%s%s.Ignora, carregarà el projecte.%sAvorta n'aturarà la càrrega." #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgstr "" #: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." msgstr "No s'ha trobat el compilador Free Pascal (nom de fitxer: %s).%sUs recomano que instal·leu el fpc." #: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgstr "No s'ha trobat el directori del codi font del Free Pascal.%sAlgunes funcions codificades no funcionaran.%sUs recomano que les instal·leu i poseu la trajectòria%SEntorn -> Opcions de l'entorn -> Fitxers" #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "" #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files" msgstr "No s'ha trobat el directori Lazarus.%sNo prodreu crear aplicacions LCL.%sSi us plau, comproveu Entorn -> Opcions de l'Entorn -> Fitxers" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgstr "El fitxer LFM (Lazarus Form) conté propietats no vàlides. Això vol dir, per exemple, que conté algunes propietats/classes les quals no existeixen en la LCL actual. La manera normal de corregir això és eliminar aquestes propietats de la LFM i corregir manualment el codi pascal." #: lazarusidestrconsts.listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." msgstr "El nom %s%s%s no és un identificador pascal vàlid." #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts.listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr "" #: lazarusidestrconsts.listheownerclasshasthisname msgid "The owner class has this name" msgstr "" #: lazarusidestrconsts.listheownerhasthisname msgid "The owner has this name" msgstr "" #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "" #: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth msgid "The package %s can not be uninstalled, because it is needed by the IDE itself." msgstr "" #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" msgstr "No s'ha trobat el programa %sMake%s.%sEs necessita aquesta eina per muntar el Lazarus.%s" #: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces." msgstr "" #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" msgstr "El fitxer d'informació del projecte %s%s%s%sés igual al fitxer principal del codi font del projecte!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk msgid "The project information file %s%s%s%shas changed on disk." msgstr "" #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgstr "S'ha de desar el projecte abans de muntar de nou%sSi fiqueu el directori de les proves en les opcions de l'entorn,%spodeu crear projectes nous i muntar-los al mateix temps.%sVoleu desar el projecte?" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgstr "" #: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea msgid "The project uses the new FPC resources, which requires at least FPC 2.4" msgstr "" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no més son diferents en la capitalització:%s%s%sVoleu eliminar-los?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhereisalreadyabuildvarwiththename msgid "There is already a build variable with the name %s%s%s." msgstr "" #: lazarusidestrconsts.listhereisalreadyacomponentwiththisname msgid "There is already a component with this name" msgstr "" #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" msgstr "Ja hi ha una forma amb el nom %s%s%s" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgstr "Ja hi ha una unitat amb el nom %s%s%s. Els identificadors pascal han de ser únics." #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgstr "En el projecte hi ha una unitat amb el nom %s%s%s.%sSi us plau, escolliu un nom diferent." #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "S'ha produït un error mentre s'escrivia el component seleccionat %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "S'ha produït un error mentre es convertia l'afluent binari del component seleccionat %s:%s:%s%s" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "S'ha produït un error mentre es copiava l'afluent del component al porta-retalls:%s%s" #: lazarusidestrconsts.listherootcomponentcannotbedeleted msgid "The root component can not be deleted." msgstr "No es pot eliminar el component arrel." #: lazarusidestrconsts.listhesesettingsarestoredwiththeproject msgid "These settings are stored with the project." msgstr "" #: lazarusidestrconsts.listheseunitswerenotfound msgid "These units were not found:" msgstr "" #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" msgstr "" #: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "Ja existeix la unitat %s%s%s.%sIgnora forçarà el canvi de nom,%sCancel·la no desarà el codi font i%sAvorta no desarà cap cànvi." #: lazarusidestrconsts.listheunitbelongstopackage msgid "The unit belongs to package %s." msgstr "" #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" msgstr "" #: lazarusidestrconsts.listheunithasthisname msgid "The unit has this name" msgstr "" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" msgstr "" #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgstr "La unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser únics." #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" msgstr "" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "" #: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor msgid "This function needs an open .lfm file in the source editor." msgstr "" #: lazarusidestrconsts.listhishelpmessage msgid "this help message" msgstr "aquest missatge d'ajuda" #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "Sembla un arxiu pascal.%sS'hi recomana utilitzar minúscules per evitar problemes diversos amb alguns sistemes d'arxius i diferents compiladors.%sCanviar-li el nom a minúscules?" #: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus." msgstr "" #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "No s'ha pogut extraure aquesta declaració.%sSi us plau, seleccioneu codi per extreure'n un nou procediment/mètode." #: lazarusidestrconsts.listitle msgid "&Title" msgstr "" #: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus msgid "Title in taskbar shows for example: project1.lpi - Lazarus" msgstr "" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "" #: lazarusidestrconsts.listmfunctionappendpathdelimiter msgid "Function: append path delimiter" msgstr "Funció: afegir el delimitador de la trajectòria" #: lazarusidestrconsts.listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" msgstr "Funció: eliminar el delimitador de la trajectòria" #: lazarusidestrconsts.listmfunctionextractfileextension msgid "Function: extract file extension" msgstr "Funció: extreure l'extensió del fitxer" #: lazarusidestrconsts.listmfunctionextractfilenameextension msgid "Function: extract file name+extension" msgstr "Funció: extreure nom i extensió del fitxer" #: lazarusidestrconsts.listmfunctionextractfilenameonly msgid "Function: extract file name only" msgstr "Funció: extreure només el nom del fitxer" #: lazarusidestrconsts.listmfunctionextractfilepath msgid "Function: extract file path" msgstr "Funció: extreure la trajectòria del fitxer" #: lazarusidestrconsts.listmunknownmacro msgid "(unknown macro: %s)" msgstr "(macroinstrucció desconeguda: %s)" #: lazarusidestrconsts.listodoexport msgctxt "lazarusidestrconsts.listodoexport" msgid "Export" msgstr "" #: lazarusidestrconsts.listodogoto msgid "Goto" msgstr "" #: lazarusidestrconsts.listodoldescription msgctxt "lazarusidestrconsts.listodoldescription" msgid "Description" msgstr "Descripció" #: lazarusidestrconsts.listodoldone msgid "Done" msgstr "" #: lazarusidestrconsts.listodolfile msgctxt "lazarusidestrconsts.listodolfile" msgid "Module" msgstr "Mòdul" #: lazarusidestrconsts.listodolistcaption msgctxt "lazarusidestrconsts.listodolistcaption" msgid "ToDo List" msgstr "Llista ToDo" #: lazarusidestrconsts.listodolistgotoline msgid "Goto selected source line" msgstr "Vés a la línia del codi seleccionada" #: lazarusidestrconsts.listodolistoptions msgid "ToDo options..." msgstr "Opcions ToDo" #: lazarusidestrconsts.listodolistprintlist msgid "Print todo items" msgstr "Imprimeix elements ToDo" #: lazarusidestrconsts.listodolistrefresh msgid "Refresh todo items" msgstr "Refresca els elements ToDo" #: lazarusidestrconsts.listodolline msgctxt "lazarusidestrconsts.listodolline" msgid "Line" msgstr "Línia" #: lazarusidestrconsts.listodolowner msgid "Owner" msgstr "" #: lazarusidestrconsts.listodolpriority msgctxt "lazarusidestrconsts.listodolpriority" msgid "Priority" msgstr "" #: lazarusidestrconsts.listofpcpath msgid "Path:" msgstr "Trajectòria:" #: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" msgstr "" #: lazarusidestrconsts.listop msgctxt "lazarusidestrconsts.listop" msgid "Top" msgstr "" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" msgstr "" #: lazarusidestrconsts.listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "" #: lazarusidestrconsts.listops msgid "Tops" msgstr "Límits superiors" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.listopspaceequally msgid "Top space equally" msgstr "Iguala l'espai superior" #: lazarusidestrconsts.listreeneedsrefresh msgid "Tree needs refresh" msgstr "" #: lazarusidestrconsts.listtodolcategory msgctxt "lazarusidestrconsts.listtodolcategory" msgid "Category" msgstr "" #: lazarusidestrconsts.listurbopascal msgid "Turbo Pascal" msgstr "" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." msgstr "No mostres mes aquest missatge." #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Hi ha un error a l'expressió regular" #: lazarusidestrconsts.lisuefontwith msgid "Font without UTF-8" msgstr "Font sense UTF-8" #: lazarusidestrconsts.lisuegotoline msgid "Goto line :" msgstr "Vés a la línia:" #: lazarusidestrconsts.lisuenotfound msgid "Not found" msgstr "No s'ha trobat" #: lazarusidestrconsts.lisuereadonly msgid "%s/ReadOnly" msgstr "%s/Només de lectura" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgstr "Voleu substituir aquesta ocurrència de %s%s%s%s amb %s%s%s?" #: lazarusidestrconsts.lisuesearching msgid "Searching: %s" msgstr "Cercant: %s" #: lazarusidestrconsts.lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "No s'ha trobat la cadena '%s'" #: lazarusidestrconsts.lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgstr "La font de l'editor actual no soport UTF-8, però pareix que el teu sistema està utilitzant-la.%sAçò implica que els caràcters no ASCII probablement no s'hi voran corrèctament.%sPodries sel·leccionar un altra font a les opcions de l'editor." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" msgstr "" #: lazarusidestrconsts.lisuidbytes msgid "%s bytes" msgstr "%s octets" #: lazarusidestrconsts.lisuidclear msgid "Clear" msgstr "Neteja" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" msgstr "Inclòs per:" #: lazarusidestrconsts.lisuidinproject msgid "in Project:" msgstr "en el projecte:" #: lazarusidestrconsts.lisuidlines msgctxt "lazarusidestrconsts.lisuidlines" msgid "Lines:" msgstr "Línies:" #: lazarusidestrconsts.lisuidname msgctxt "lazarusidestrconsts.lisuidname" msgid "Name:" msgstr "Nom:" #: lazarusidestrconsts.lisuidno msgid "no" msgstr "no" #: lazarusidestrconsts.lisuidok msgctxt "lazarusidestrconsts.lisuidok" msgid "Ok" msgstr "D'acord" #: lazarusidestrconsts.lisuidpathsreadonly msgid "Paths (Read Only)" msgstr "Trajectòries (només de lectura)" #: lazarusidestrconsts.lisuidsize msgid "Size:" msgstr "Tamany:" #: lazarusidestrconsts.lisuidsrc msgid "Src" msgstr "Src" #: lazarusidestrconsts.lisuidtype msgid "Type:" msgstr "Tipus:" #: lazarusidestrconsts.lisuidunit msgctxt "lazarusidestrconsts.lisuidunit" msgid "Unit" msgstr "Unitat" #: lazarusidestrconsts.lisuidyes msgid "yes" msgstr "sí" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "Mostra els valors" #: lazarusidestrconsts.lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "No es pot convertir afluent binari a text" #: lazarusidestrconsts.lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "No es pot copiar els components al porta-retalls" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "No es pot afegir el comentari de capçalera del recurs al fitxer del recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgstr "No es pot afegir el recurs T%s:FORMDATA al fitxer de recurs %s%s%s%s.%sProbable error de sintaxi." #: lazarusidestrconsts.lisunabletoaddsetting msgid "Unable to add setting" msgstr "" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "No es pot afegir %s al projecte, ja hi ha una unitat amb el mateix nom al projecte." #: lazarusidestrconsts.lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "No es pot fer copia de seguretat del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts.lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" msgstr "%s%sIncapaç canviar la classe de %s a %s" #: lazarusidestrconsts.lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "No es pot netejar el directori destinació" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgstr "No es pot netejar %s%s%s.%sSi us plau, comproveu els permisos." #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "No es pot convertir el component de text a format binari:%s%s" #: lazarusidestrconsts.lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" msgstr "No es pot convetir el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." msgstr "No es pot convertir lfm a lrs i escriure fitxer lrs." #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgstr "No es poden convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" #: lazarusidestrconsts.lisunabletocopyfile msgid "Unable to copy file" msgstr "No es pot copiar el fitxer" #: lazarusidestrconsts.lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" msgstr "No es pot copiar el fitxer %s%s%s%sa %s%s%s" #: lazarusidestrconsts.lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." msgstr "No es pot copiar el fitxer %s%s%s%sa %s%s%s." #: lazarusidestrconsts.lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." msgstr "No es pot crear el directori de resguard %s%s%s." #: lazarusidestrconsts.lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." msgstr "No es pot crear el directori %s%s%s" #: lazarusidestrconsts.lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" msgstr "No es pot crear el directori %s%s%s" #: lazarusidestrconsts.lisunabletocreatefile msgid "Unable to create file" msgstr "No es pot crear el fitxer" #: lazarusidestrconsts.lisunabletocreatefile2 msgid "Unable to create file %s%s%s" msgstr "No es pot crear el fitxer %s%s%s" #: lazarusidestrconsts.lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocreatefilename msgid "Unable to create file %s%s%s." msgstr "No es pot crear el fitxer %s%s%s." #: lazarusidestrconsts.lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin msgid "Unable to create new method. Please fix the error shown in the message window." msgstr "No es pot crear el nou mètode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "" #: lazarusidestrconsts.lisunabletodelete msgid "Unable to delete" msgstr "" #: lazarusidestrconsts.lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts.lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" msgstr "No es pot trobar un nom de classe vàlid a %s%s%s" #: lazarusidestrconsts.lisunabletofindfile msgid "Unable to find file %s%s%s." msgstr "No es pot trobar el fitxer %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test" msgstr "" #: lazarusidestrconsts.lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." msgstr "" #: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage msgid "Unable to find method. Please fix the error shown in the message window." msgstr "No es pot trobar el mètode. Si us plau, comproveu l'error mostrat a la finestra de missatges." #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "" #: lazarusidestrconsts.lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "" #: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." msgstr "No es pot carregar fitxer del recurs antic.%sEl fitxer del recurs és el primer fitxer inclòs en la%ssecció d'inicialització.%sPer exemple {$I %s.lrs}.%sProblable error de sintaxi. " #: lazarusidestrconsts.lisunabletoloadpackage msgid "Unable to load package %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." msgstr "" #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "" #: lazarusidestrconsts.lisunabletoread msgid "Unable to read %s" msgstr "" #: lazarusidestrconsts.lisunabletoreadfile msgid "Unable to read file" msgstr "No es pot llegir el fitxer" #: lazarusidestrconsts.lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" msgstr "No es pot llegir el fitxer %s%s%s!" #: lazarusidestrconsts.lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" msgstr "No es pot llegir el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts.lisunabletoreadfilename msgid "Unable to read file %s%s%s." msgstr "No es pot llegir el fitxer %s%s%s." #: lazarusidestrconsts.lisunabletoreadtheprojectinfofile msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile" msgid "Unable to read the project info file%s%s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2 msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2" msgid "Unable to read the project info file%s%s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" msgstr "No es pot eliminar el fitxer de resguard antic %s%s%s!" #: lazarusidestrconsts.lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletorenamefile msgid "Unable to rename file" msgstr "No es pot canviar el nom del fitxer" #: lazarusidestrconsts.lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" msgstr "No es pot canviar el nom del fitxer %s%s%s a %s%s%s!" #: lazarusidestrconsts.lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." msgstr "No es pot canviar el nom del fitxer %s%s%s%sa %s%s%s." #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "No es pot canviar el nom de la forma en el codi font" #: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "No es pot canviar el nom del mètode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "No es pot canviar el nom de la variable en el codi font." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" msgstr "" #: lazarusidestrconsts.lisunabletosavefile msgid "Unable to save file %s%s%s" msgstr "No es pot desar el fitxer %s%s%s" #: lazarusidestrconsts.lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "" #: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage msgid "Unable to show method. Please fix the error shown in the message window." msgstr "No es pot mostrar el mètode. Si us plau, corregiu l'error de la finestra de missatges." #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "No es poden afluir els components seleccionats" #: lazarusidestrconsts.lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "" #: lazarusidestrconsts.lisunabletostreamt msgid "Unable to stream %s:T%s." msgstr "No es pot afluir %s:T%s." #: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "No es pot transformar afluent de component binari de %s:T%s a text." #: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "No es pot actualitzar la declaració CreateForm en el codi font del projecte" #: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt." msgstr "" #: lazarusidestrconsts.lisunabletowrite msgid "Unable to write %s%s%s%s%s." msgstr "No es pot escriure %s%s%s%s%s." #: lazarusidestrconsts.lisunabletowrite2 msgid "Unable to write %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletowritefile msgid "Unable to write file" msgstr "No es pot escriure el fitxer" #: lazarusidestrconsts.lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" msgstr "No es pot escriure el fitxer %s%s%s%sError: %s" #: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror msgid "Unable to write the project info file%s%s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lisunabletowritetofile #, fuzzy #| msgid "Unable to write to file %s%s%s!" msgid "Unable to write to file %s%s%s." msgstr "No es pot escriure en el fitxer %s%s%s!" #: lazarusidestrconsts.lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisuninstallimpossible msgid "Uninstall impossible" msgstr "" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" msgstr "Desinstal·la la selecció" #: lazarusidestrconsts.lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "Ja existeix l'identificador de la unitat" #: lazarusidestrconsts.lisunitinpackage msgid "%s unit %s in package %s%s" msgstr "" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "El nom de la unitat ja és al projecte" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "" #: lazarusidestrconsts.lisunitnamecontains msgid "Unit name contains ..." msgstr "" #: lazarusidestrconsts.lisunitnotfound #, fuzzy #| msgid "Unit not found" msgid "A unit not found in" msgstr "Unitat no trobada" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" msgstr "Directori sortida de la unitat" #: lazarusidestrconsts.lisunitpath msgid "unit path" msgstr "trajectòria de les unitats" #: lazarusidestrconsts.lisunitpaths msgid "Unit paths" msgstr "" #: lazarusidestrconsts.lisunitsnotfound2 msgid "Units not found in" msgstr "" #: lazarusidestrconsts.lisunusedunits msgid "Unused units" msgstr "" #: lazarusidestrconsts.lisupdatepreview msgid "Update preview" msgstr "" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" msgstr "" #: lazarusidestrconsts.lisuppercasestring msgid "uppercase string" msgstr "" #: lazarusidestrconsts.lisuppercasestringgivenasparameter msgid "Uppercase string given as parameter" msgstr "" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" msgstr "" #: lazarusidestrconsts.lisuseexcludefilter msgid "Use Exclude Filter" msgstr "" #: lazarusidestrconsts.lisuseidentifier msgid "Use identifier" msgstr "" #: lazarusidestrconsts.lisuseidentifierinat msgid "Use identifier %s in %s at %s" msgstr "" #: lazarusidestrconsts.lisuseincludefilter msgid "Use Include Filter" msgstr "" #: lazarusidestrconsts.lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "" #: lazarusidestrconsts.lisusepackageinpackage msgid "Use package %s in package %s" msgstr "" #: lazarusidestrconsts.lisusepackageinpackage2 msgid "Use package in package" msgstr "" #: lazarusidestrconsts.lisusepackageinproject msgid "Use package %s in project" msgstr "" #: lazarusidestrconsts.lisusepackageinproject2 msgid "Use package in project" msgstr "" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" msgstr "" #: lazarusidestrconsts.lisuseunitinunit msgid "Use unit %s in unit %s" msgstr "" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" msgstr "" #: lazarusidestrconsts.lisvalue msgid "Value:" msgstr "" #: lazarusidestrconsts.lisvalue2 msgid "Value%s" msgstr "" #: lazarusidestrconsts.lisvalues msgid "Values" msgstr "" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" msgstr "" #: lazarusidestrconsts.lisversion msgid "Version" msgstr "Versió" #: lazarusidestrconsts.lisvertical msgid "Vertical" msgstr "Vertical" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" msgstr "" #: lazarusidestrconsts.lisviewbreakpointproperties msgid "View Breakpoint Properties" msgstr "" #: lazarusidestrconsts.lisviewprojectunits msgid "View Project Units" msgstr "Mostra les unitats del projecte" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Vore font (.lfm)" #: lazarusidestrconsts.lisvsrforwardsearch msgid "Forward Search" msgstr "" #: lazarusidestrconsts.lisvsrresetresultlist msgid "Reset Result List" msgstr "" #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgstr "" #: lazarusidestrconsts.liswatch msgid "&Watch" msgstr "" #: lazarusidestrconsts.liswatchpropert msgid "Watch Properties" msgstr "" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references ..." msgstr "" #: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew msgid "When enabled the current options are saved to the template, which is used when creating new projects" msgstr "" #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" msgstr "" #: lazarusidestrconsts.liswladd msgid "&Add" msgstr "&Afegeix" #: lazarusidestrconsts.liswldelete msgid "&Delete" msgstr "" #: lazarusidestrconsts.liswldeleteall msgid "De&lete All" msgstr "Esborra-ho tot" #: lazarusidestrconsts.liswldisableall msgid "D&isable All" msgstr "" #: lazarusidestrconsts.liswlenableall msgid "E&nable All" msgstr "" #: lazarusidestrconsts.liswlenabled msgid "&Enabled" msgstr "" #: lazarusidestrconsts.liswlexpression msgid "Expression" msgstr "Expresió" #: lazarusidestrconsts.liswlproperties msgid "&Properties" msgstr "&Propietats" #: lazarusidestrconsts.liswlwatchlist msgid "Watch list" msgstr "" #: lazarusidestrconsts.liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Paraula del cursor en l'editor actual" #: lazarusidestrconsts.lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "" #: lazarusidestrconsts.lisworkingdirectoryforrun msgid "Working directory for run" msgstr "" #: lazarusidestrconsts.liswriteerror msgid "Write Error" msgstr "S'ha produït un error d'escriptura" #: lazarusidestrconsts.liswriteerrorfile msgid "Write error: %s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts.lisxmlerror msgid "XML Error" msgstr "" #: lazarusidestrconsts.lisxmlfiles msgid "XML files" msgstr "Arxius XML" #: lazarusidestrconsts.lisxmlparsererrorinfileerror msgid "XML parser error in file %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." msgstr "No podeu muntar el lazarus mentre s'està depurant o compilant." #: lazarusidestrconsts.locwndsrceditor msgctxt "lazarusidestrconsts.locwndsrceditor" msgid "Source Editor" msgstr "Editor del codi font" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" msgstr "" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "" #: lazarusidestrconsts.rsavailablescanners msgid "Available scanners" msgstr "" #: lazarusidestrconsts.rsbuild msgid "&Build:" msgstr "" #: lazarusidestrconsts.rscharacterset msgid "Character set:" msgstr "" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page" msgstr "" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" msgstr "" #: lazarusidestrconsts.rscreatenewdefine msgid "Create new define" msgstr "" #: lazarusidestrconsts.rscreatingdirfailed msgid "Creating directory \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinkfailed msgid "Creating symbolic link \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinknotsupported msgid "Creating symbolic link is not supported on this platform!" msgstr "" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" msgstr "" #: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma" msgstr "" #: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression msgid "Filter the list with the current filter expression" msgstr "" #: lazarusidestrconsts.rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" msgstr "Arxiu de dades de Forma (*.dfm)|*.dfm" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found, but not listed here: " msgstr "" #: lazarusidestrconsts.rsgotothenextiteminthesearchlist msgid "Go to the next item in the search list" msgstr "" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" msgstr "" #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include Version Info in executable" msgstr "" #: lazarusidestrconsts.rsiwpcustomposition msgid "Custom position" msgstr "Posició personalitzada" #: lazarusidestrconsts.rsiwpdefault msgctxt "lazarusidestrconsts.rsiwpdefault" msgid "Default" msgstr "Predeterminat" #: lazarusidestrconsts.rsiwpdocked msgid "Docked" msgstr "Amarrat" #: lazarusidestrconsts.rsiwprestorewindowgeometry msgid "Restore window geometry" msgstr "Restaura la geometria de la finestra" #: lazarusidestrconsts.rsiwprestorewindowsize msgid "Restore window size" msgstr "Restaura el tamany de la finestra" #: lazarusidestrconsts.rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Utilitza els paràmetres del gestor de finestres" #: lazarusidestrconsts.rskey msgctxt "lazarusidestrconsts.rskey" msgid "Key" msgstr "Tecla" #: lazarusidestrconsts.rslanguageafrikaans msgid "Afrikaans" msgstr "" #: lazarusidestrconsts.rslanguagearabic msgid "Arabic" msgstr "Aràbic" #: lazarusidestrconsts.rslanguageautomatic msgid "Automatic (or english)" msgstr "Automàtic (o Anglès)" #: lazarusidestrconsts.rslanguagecatalan msgid "Catalan" msgstr "Català" #: lazarusidestrconsts.rslanguagechinese msgid "Chinese" msgstr "Chinés" #: lazarusidestrconsts.rslanguagedutch msgid "Dutch" msgstr "Holandés" #: lazarusidestrconsts.rslanguageenglish msgid "English" msgstr "Anglès" #: lazarusidestrconsts.rslanguagefinnish msgid "Finnish" msgstr "Finlandès" #: lazarusidestrconsts.rslanguagefrench msgid "French" msgstr "Francès" #: lazarusidestrconsts.rslanguagegerman msgid "German" msgstr "Alemany" #: lazarusidestrconsts.rslanguagehebrew msgid "Hebrew" msgstr "Hebreu" #: lazarusidestrconsts.rslanguageindonesian msgid "Indonesian" msgstr "Indonés" #: lazarusidestrconsts.rslanguageitalian msgid "Italian" msgstr "Italià" #: lazarusidestrconsts.rslanguagejapanese msgid "Japanese" msgstr "Japonés" #: lazarusidestrconsts.rslanguagelithuanian msgid "Lithuanian" msgstr "" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" msgstr "" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" msgstr "Polonès" #: lazarusidestrconsts.rslanguageportugues msgid "Portuguese" msgstr "Portugués" #: lazarusidestrconsts.rslanguagerussian msgid "Russian" msgstr "Rus" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" msgstr "" #: lazarusidestrconsts.rslanguageslovak msgid "Slovak" msgstr "" #: lazarusidestrconsts.rslanguagespanish msgid "Spanish" msgstr "Espanyol" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" msgstr "" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" msgstr "Ucrainés" #: lazarusidestrconsts.rsmajorversion msgid "&Major version:" msgstr "" #: lazarusidestrconsts.rsminorversion msgid "Mi&nor version:" msgstr "" #: lazarusidestrconsts.rsok msgid "ok" msgstr "" #: lazarusidestrconsts.rsotherinfo msgid "Other info" msgstr "" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" msgstr "" #: lazarusidestrconsts.rsremove msgid "&Remove" msgstr "" #: lazarusidestrconsts.rsresetfilter msgid "Reset filter" msgstr "" #: lazarusidestrconsts.rsrevision msgid "&Revision:" msgstr "" #: lazarusidestrconsts.rsscanners msgid "Scanners" msgstr "" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" msgstr "" #: lazarusidestrconsts.rsstartanewsearch msgid "Start a new search" msgstr "" #: lazarusidestrconsts.rsvalue msgctxt "lazarusidestrconsts.rsvalue" msgid "Value" msgstr "Valor" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" msgstr "" #: lazarusidestrconsts.srkmalreadyconnected msgid " The key \"%s\" is already connected to \"%s\"." msgstr "La tecla \"%s\" ja està connectada a \"%s\"." #: lazarusidestrconsts.srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" msgstr "Ordres del menú de l'ajuda" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" msgstr "Ordres de les instruccions" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" msgstr "Ordres de les eines del codi" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" msgstr "" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" msgstr "Ordres de moviment del cursor" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" msgstr "Ordres d'edició del text" #: lazarusidestrconsts.srkmcatenvmenu msgid "Environment menu commands" msgstr "Ordres del menú de l'entorn" #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" msgstr "Ordres de menús dels fitxers" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" msgstr "" #: lazarusidestrconsts.srkmcatmarker msgid "Text marker commands" msgstr "Ordres de marcadors del text" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" msgstr "" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" msgstr "Ordres del menú del projecte" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" msgstr "Ordres del menú d'execució" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Ordres de recerca i reemplaçament del text" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" msgstr "Ordres de selecció del text" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "Ordres del llibre del codi font" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditoff msgid "Syncron Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditsel msgid "Syncron Editing (while selecting)" msgstr "" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" msgstr "" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" msgstr "Ordres del menú de les eines" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" msgstr "Mostra les ordres del menú" #: lazarusidestrconsts.srkmcommand msgctxt "lazarusidestrconsts.srkmcommand" msgid "Command:" msgstr "Ordre:" #: lazarusidestrconsts.srkmcommand1 msgid " command1 \"" msgstr " ordre1 \"" #: lazarusidestrconsts.srkmcommand2 msgid " command2 \"" msgstr " ordre2 \"" #: lazarusidestrconsts.srkmconflic msgid "Conflict " msgstr "Conflicte" #: lazarusidestrconsts.srkmconflicw msgid " conflicts with " msgstr "conflicte amb" #: lazarusidestrconsts.srkmecabortbuild msgid "abort build" msgstr "avorta el muntatje" #: lazarusidestrconsts.srkmecaddjumppoint msgid "Add jump point" msgstr "Afegeix un punt de salt" #: lazarusidestrconsts.srkmecaddwatch msgid "add watch" msgstr "afegeix un control" #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" msgstr "Completa la plantilla del codi" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" msgstr "" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" msgstr "" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" msgstr "" #: lazarusidestrconsts.srkmecblockgotoend msgid "Goto Block end" msgstr "" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" msgstr "" #: lazarusidestrconsts.srkmecblockindent msgid "Indent block" msgstr "Sagna el bloc" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" msgstr "" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" msgstr "" #: lazarusidestrconsts.srkmecblocksetend msgid "Set block end" msgstr "" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" msgstr "" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" msgstr "" #: lazarusidestrconsts.srkmecblockunindent msgid "Unindent block" msgstr "Dessagna el bloc" #: lazarusidestrconsts.srkmecbuild msgid "build program/project" msgstr "munta el programa/projecte" #: lazarusidestrconsts.srkmecbuildall msgid "build all files of program/project" msgstr "munta tots els fitxers del programa/projecte" #: lazarusidestrconsts.srkmecbuildfile msgid "build file" msgstr "munta el fitxer" #: lazarusidestrconsts.srkmecbuildlazarus msgid "Build lazarus" msgstr "Munta el Lazarus" #: lazarusidestrconsts.srkmecchar msgid "Char" msgstr "Caràcter" #: lazarusidestrconsts.srkmecclearall msgid "Delete whole text" msgstr "Elimina tot el text" #: lazarusidestrconsts.srkmeccodetoolsdefinesed msgid "Codetools defines editor" msgstr "Editor de les definicions de les eines del codi" #: lazarusidestrconsts.srkmeccodetoolsoptions msgid "Codetools options" msgstr "Opcions de les eines del codi" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" msgstr "" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" msgstr "" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" msgstr "" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" msgstr "" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" msgstr "" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" msgstr "" #: lazarusidestrconsts.srkmeccolsellinetextstart msgid "Column Select to text start in line" msgstr "" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" msgstr "" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" msgstr "" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" msgstr "" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" msgstr "" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" msgstr "" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" msgstr "" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" msgstr "" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" msgstr "" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" msgstr "Mode de selecció de columna" #: lazarusidestrconsts.srkmeccompileroptions msgid "compiler options" msgstr "opcions del compilador" #: lazarusidestrconsts.srkmeccompletecode msgid "Complete code" msgstr "Completa el codi" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" msgstr "fitxer de configuració del muntatje" #: lazarusidestrconsts.srkmeccopy msgid "Copy selection to clipboard" msgstr "Copia la selecció al porta-retalls" #: lazarusidestrconsts.srkmeccustomtool msgid "Custom tool %d" msgstr "Eina personalitzada %d" #: lazarusidestrconsts.srkmeccut msgid "Cut selection to clipboard" msgstr "Retalla la selecció al porta-retalls" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" msgstr "Elimina fins al començament de la línia" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" msgstr "Elimina el caràcter al cursor" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" msgstr "Elimina fins al final de la línia" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" msgstr "Elimina l'últim caràcter" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" msgstr "Elimina fins el principi de la paraula" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" msgstr "Elimina la línia actual" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" msgstr "Elimina fins al final de la paraula" #: lazarusidestrconsts.srkmecdiff msgctxt "lazarusidestrconsts.srkmecdiff" msgid "Diff" msgstr "Mostra les diferències" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "Mou el cursor al final de tot" #: lazarusidestrconsts.srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "Mou el cursor al principi de tot" #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" msgstr "" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" msgstr "avalua/modifica" #: lazarusidestrconsts.srkmecextractproc msgid "Extract procedure" msgstr "Extrau el procediment" #: lazarusidestrconsts.srkmecexttool msgid "External tool %d" msgstr "Eina externa %d" #: lazarusidestrconsts.srkmecexttoolsettings msgid "External tools settings" msgstr "Paràmetres de les eines externes" #: lazarusidestrconsts.srkmecfind msgid "Find text" msgstr "Cerca el text" #: lazarusidestrconsts.srkmecfindblockotherend msgid "Find block other end" msgstr "Cerca l'altre cap del bloc" #: lazarusidestrconsts.srkmecfindblockstart msgid "Find block start" msgstr "Cerca l'inici del bloc" #: lazarusidestrconsts.srkmecfinddeclaration msgid "Find declaration" msgstr "Cerca la declaració" #: lazarusidestrconsts.srkmecfindidentifierrefs msgid "Find identifier references" msgstr "Cerca les referències de l'identificador" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in files" msgstr "Cerca en els fitxers" #: lazarusidestrconsts.srkmecfindnext msgid "Find next" msgstr "Cerca el següent" #: lazarusidestrconsts.srkmecfindnextwordoccurrence msgid "Find next word occurrence" msgstr "Cerca següent ocurrència de la paraula" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find overloads" msgstr "" #: lazarusidestrconsts.srkmecfindprevious msgid "Find previous" msgstr "Cerca l'anterior" #: lazarusidestrconsts.srkmecfindprevwordoccurrence msgid "Find previous word occurrence" msgstr "Cerca ocurrència prèvia de la paraula" #: lazarusidestrconsts.srkmecfindproceduredefinition msgid "Find procedure definiton" msgstr "Cerca la definició del procediment" #: lazarusidestrconsts.srkmecfindproceduremethod msgid "Find procedure method" msgstr "Cerca el mètode del procediment" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecfoldlevel msgid "Fold to Level %d" msgstr "" #: lazarusidestrconsts.srkmecgotoeditor msgid "Go to editor %d" msgstr "Vés a l'editor %d" #: lazarusidestrconsts.srkmecgotoincludedirective msgid "Go to to include directive of current include file" msgstr "Vés a la directiva include del fitxer inclòs actual" #: lazarusidestrconsts.srkmecgotolinenumber msgid "Go to line number" msgstr "Vés a la línia número" #: lazarusidestrconsts.srkmecgotomarker msgid "Go to Marker %d" msgstr "Vés al marcador %d" #: lazarusidestrconsts.srkmecgotoxy msgid "Goto XY" msgstr "Vés a XY" #: lazarusidestrconsts.srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" msgstr "Suposa $IFDEF inexistent" #: lazarusidestrconsts.srkmecimestr msgid "Ime Str" msgstr "Ime Str" #: lazarusidestrconsts.srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "Insereix entrada de registres de canvis" #: lazarusidestrconsts.srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "Insereix desde el mapa de caràcters" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "Insereix paraula clau CVS Author" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "Insereix paraula clau CVS Date" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "Insereix paraula clau CVS Header" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "Insereix paraula clau CVS ID" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "Insereix paraula clau CVS Log" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "Insereix paraula clau CVS Name" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "Insereix paraula clau CVS Revision" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "Insereix paraula clau CVS Source" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" msgstr "Insereix data i hora actuals" #: lazarusidestrconsts.srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "Insereix comentari GPL" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" msgstr "" #: lazarusidestrconsts.srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "Insereix comentari LGPL" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" msgstr "Interromp la línia, deixa el cursor" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" msgstr "Mode inserir" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" msgstr "Insereix nom d'usuari actual" #: lazarusidestrconsts.srkmecinspect msgid "inspect" msgstr "inspeccionar" #: lazarusidestrconsts.srkmecinvertassignment msgid "Invert assignment" msgstr "Inverteix l'assignació" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" msgstr "Interromp la línia i mou el cursor" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" msgstr "Mou el cursor al final de la línia" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" msgstr "Mode de selecció de línia" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" msgstr "Mou el cursor al principi de la línia" #: lazarusidestrconsts.srkmeclinetextstart msgid "Move cursor to text start in line" msgstr "" #: lazarusidestrconsts.srkmecmakeresourcestring msgid "Make resource string" msgstr "Fes cadena del recurs" #: lazarusidestrconsts.srkmecmatchbracket msgid "Go to matching bracket" msgstr "Vés al claudàtor coincident" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" msgstr "Mou l'editor a l'esquerra" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" msgstr "Mou l'editor a la dreta" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" msgstr "Següent Marcador" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" msgstr "Vés al següent editor" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" msgstr "Mode de selecció normal" #: lazarusidestrconsts.srkmecopenfileatcursor msgid "Open file at cursor" msgstr "Obre el fitxer al cursor" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" msgstr "Mode substituir" #: lazarusidestrconsts.srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "Mou el cursor al final de la pàgina" #: lazarusidestrconsts.srkmecpagedown msgid "Move cursor down one page" msgstr "Mou el cursor una pàgina avall" #: lazarusidestrconsts.srkmecpageleft msgid "Move cursor left one page" msgstr "Mou el cursor una pàgina a l'esquerra" #: lazarusidestrconsts.srkmecpageright msgid "Move cursor right one page" msgstr "Mou el cursor una pàgina a la dreta" #: lazarusidestrconsts.srkmecpagetop msgid "Move cursor to top of page" msgstr "Mou el cursor a l'inici de la pàgina" #: lazarusidestrconsts.srkmecpageup msgid "Move cursor up one page" msgstr "Mou el cursor una pàgina amunt" #: lazarusidestrconsts.srkmecpaste msgid "Paste clipboard to current position" msgstr "Enganxa el porta-retalls a la posició actual" #: lazarusidestrconsts.srkmecpause msgid "pause program" msgstr "pausa el programa" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" msgstr "Marcador Previ" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" msgstr "Vés a l'editor anterior" #: lazarusidestrconsts.srkmecprocedurelist msgid "Procedure List ..." msgstr "Llista de Procediments ..." #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" msgstr "Compila ràpidament, no enllaçes" #: lazarusidestrconsts.srkmecremovebreakpoint msgid "remove break point" msgstr "elimina el punt de ruptura" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove empty methods" msgstr "" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove unused units" msgstr "" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename identifier" msgstr "Canvia el nom de l'identificador" #: lazarusidestrconsts.srkmecreplace msgid "Replace text" msgstr "Substitueix el text" #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" msgstr "reinicia el depurador" #: lazarusidestrconsts.srkmecrun msgid "run program" msgstr "executa el programa" #: lazarusidestrconsts.srkmecrunfile msgid "run file" msgstr "executa el fitxer" #: lazarusidestrconsts.srkmecrunparameters msgid "run parameters" msgstr "executa els paràmetres" #: lazarusidestrconsts.srkmecscrolldown msgid "Scroll down one line" msgstr "Desplaça una línia avall" #: lazarusidestrconsts.srkmecscrollleft msgid "Scroll left one char" msgstr "Desplaça un caràcter a l'esquerra" #: lazarusidestrconsts.srkmecscrollright msgid "Scroll right one char" msgstr "Desplaça un caràcter a la dreta" #: lazarusidestrconsts.srkmecscrollup msgid "Scroll up one line" msgstr "Desplaça una línia amunt" #: lazarusidestrconsts.srkmecseldown msgid "Select Down" msgstr "Selecciona avall" #: lazarusidestrconsts.srkmecselectall msgctxt "lazarusidestrconsts.srkmecselectall" msgid "Select All" msgstr "Selecciona-ho tot" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Converteix els tabuladors en espais en la selecció" #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" msgstr "Selecciona fins al final" #: lazarusidestrconsts.srkmecseleditortop msgid "Select to absolute beginning" msgstr "Selecciona fins al començament" #: lazarusidestrconsts.srkmecselgotoxy msgid "Select Goto XY" msgstr "Selecciona anar a XY" #: lazarusidestrconsts.srkmecselleft msgid "SelLeft" msgstr "Alinea a l'esquerra" #: lazarusidestrconsts.srkmecsellineend msgid "Select Line End" msgstr "Selecciona al final de la línia" #: lazarusidestrconsts.srkmecsellinestart msgid "Select Line Start" msgstr "Selecciona al començament de la línia" #: lazarusidestrconsts.srkmecsellinetextstart msgid "Select to text start in line" msgstr "" #: lazarusidestrconsts.srkmecselpagebottom msgid "Select Page Bottom" msgstr "Selecciona la pàgina inferior" #: lazarusidestrconsts.srkmecselpagedown msgid "Select Page Down" msgstr "Selecciona la pàgina de sota" #: lazarusidestrconsts.srkmecselpageleft msgid "Select Page Left" msgstr "Selecciona la pàgina de l'esquerra" #: lazarusidestrconsts.srkmecselpageright msgid "Select Page Right" msgstr "Selecciona la pàgina de la dreta" #: lazarusidestrconsts.srkmecselpagetop msgid "Select Page Top" msgstr "Selecciona la pàgina superior" #: lazarusidestrconsts.srkmecselpageup msgid "Select Page Up" msgstr "Selecciona la pàgina d'amunt" #: lazarusidestrconsts.srkmecselright msgid "SelRight" msgstr "Alinea a la dreta" #: lazarusidestrconsts.srkmecselup msgid "Select Up" msgstr "Selecciona amunt" #: lazarusidestrconsts.srkmecselwordleft msgid "Select Word Left" msgstr "Selecciona una paraula a l'esquerra" #: lazarusidestrconsts.srkmecselwordright msgid "Select Word Right" msgstr "Selecciona una paraula a la dreta" #: lazarusidestrconsts.srkmecsetfreebookmark msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts.srkmecsetmarker msgid "Set Marker %d" msgstr "Posiciona el marcador %d" #: lazarusidestrconsts.srkmecshifttab msgid "Shift Tab" msgstr "Shift Tab" #: lazarusidestrconsts.srkmecshowabstractmethods msgid "Show abstract methods" msgstr "" #: lazarusidestrconsts.srkmecshowcodecontext msgid "Show code context" msgstr "" #: lazarusidestrconsts.srkmecshowexecutionpoint msgid "show execution point" msgstr "" #: lazarusidestrconsts.srkmecstopprogram msgid "stop program" msgstr "atura el programa" #: lazarusidestrconsts.srkmecsynpsyncroedcellend msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" msgid "Goto last pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedcellhome msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" msgid "Goto first pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedcellselect msgid "Select Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedescape msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" msgid "Next Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" msgid "Next Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" msgid "Previous Cell" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" msgid "Previous Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroedstart msgid "Start Syncro edit" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellend msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" msgid "Goto last pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellhome msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" msgid "Goto first pos in cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledcellselect msgid "Select cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledescape msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledfinish msgid "Finish" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" msgid "Next Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynptmplednextcellselrotate msgid "Next Cell (rotate / all selected)" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" msgid "Previous Cell (all selected)" msgstr "" #: lazarusidestrconsts.srkmecsyntaxcheck msgid "Syntax check" msgstr "Comprova la sintaxi" #: lazarusidestrconsts.srkmectoggleassembler msgid "View assembler" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle break point" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" msgstr "Mostra els punts de ruptura" #: lazarusidestrconsts.srkmectogglecallstack msgid "View call stack" msgstr "Mostra la pila de les crides" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" msgstr "" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Mostra l'explorador del codi" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" msgstr "Vore paleta de components" #: lazarusidestrconsts.srkmectoggledebuggerout msgid "View debugger output" msgstr "Mostra la sortida del depurador" #: lazarusidestrconsts.srkmectoggleformunit msgid "Switch between form and unit" msgstr "Commutar entre forma i unitat" #: lazarusidestrconsts.srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" msgid "View IDE speed buttons" msgstr "" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" msgstr "Mostra les variables locals" #: lazarusidestrconsts.srkmectogglemarker msgid "Toggle Marker %d" msgstr "" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" msgstr "" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" msgstr "Mostra els missatges" #: lazarusidestrconsts.srkmectogglemode msgid "Toggle Mode" msgstr "Canvia el mode" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Mostra l'inspector dels objectes" #: lazarusidestrconsts.srkmectoggleregisters msgid "View registers" msgstr "" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" msgstr "Mostra els resultats de recerca" #: lazarusidestrconsts.srkmectogglesourceeditor msgid "View Source Editor" msgstr "Mostra l'editor del codi font" #: lazarusidestrconsts.srkmectogglewatches msgid "View watches" msgstr "Mostra els controls" #: lazarusidestrconsts.srkmecunfoldall msgid "Unfold all" msgstr "" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" msgstr "ordre de l'editor desconeguda" #: lazarusidestrconsts.srkmecuserfirst msgid "User First" msgstr "Primer usuari" #: lazarusidestrconsts.srkmecviewanchoreditor msgid "View anchor editor" msgstr "Mostra l'editor de les àncores" #: lazarusidestrconsts.srkmecviewcomponents msgid "View components" msgstr "" #: lazarusidestrconsts.srkmecviewforms msgid "View forms" msgstr "Mostra les formes" #: lazarusidestrconsts.srkmecviewtodolist msgid "View todo list" msgstr "" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Mostra les dependències de les unitats" #: lazarusidestrconsts.srkmecviewunitinfo msgid "View unit information" msgstr "Mostra l'informació de la unitat" #: lazarusidestrconsts.srkmecviewunits msgid "View units" msgstr "Mostra les unitats" #: lazarusidestrconsts.srkmecwordcompletion msgid "Word completion" msgstr "Completa la paraula" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" msgstr "Mou el cursor una paraula a l'esquerra" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" msgstr "Mou el cursor una paraula a la dreta" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" msgstr "" #: lazarusidestrconsts.srkmeditkeys msgid "Edit Keys" msgstr "Edita les tecles" #: lazarusidestrconsts.srkmgrabkey msgid "Grab key" msgstr "" #: lazarusidestrconsts.srkmgrabsecondkey msgid "Grab second key" msgstr "" #: lazarusidestrconsts.srkmkey msgid "Key (or 2 keys combination)" msgstr "" #: lazarusidestrconsts.srkmpresskey msgid "Please press a key ..." msgstr "Premeu una tecla ..." #: lazarusidestrconsts.uefilerocap msgid "File is readonly" msgstr "El fitxer és només de lectura" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" msgstr "El fitxer \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." msgstr "\" no es pot escriure" #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Afegeix &Control al cursor" #: lazarusidestrconsts.uembookmarkn msgid "Bookmark" msgstr "Marcador" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" msgstr "" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" msgstr "Tan&ca la pàgina" #: lazarusidestrconsts.uemcompletecode msgctxt "lazarusidestrconsts.uemcompletecode" msgid "Complete Code" msgstr "Completa el codi" #: lazarusidestrconsts.uemcopy msgctxt "lazarusidestrconsts.uemcopy" msgid "Copy" msgstr "Copia" #: lazarusidestrconsts.uemcopyfilename msgid "Copy Filename" msgstr "" #: lazarusidestrconsts.uemcopytonewwindow msgid "Copy to new Window" msgstr "" #: lazarusidestrconsts.uemcopytootherwindow msgid "Copy to other Window" msgstr "" #: lazarusidestrconsts.uemcopytootherwindownew msgctxt "lazarusidestrconsts.uemcopytootherwindownew" msgid "New Window" msgstr "" #: lazarusidestrconsts.uemcut msgctxt "lazarusidestrconsts.uemcut" msgid "Cut" msgstr "Talla" #: lazarusidestrconsts.uemdebugword msgid "Debug" msgstr "Depuració" #: lazarusidestrconsts.uemeditorproperties msgid "Editor properties" msgstr "Propietats de l'editor" #: lazarusidestrconsts.uemencloseselection msgctxt "lazarusidestrconsts.uemencloseselection" msgid "Enclose Selection" msgstr "Tanca la selecció" #: lazarusidestrconsts.uemencoding msgid "Encoding" msgstr "" #: lazarusidestrconsts.uemevaluatemodify msgid "&Evaluate/Modify..." msgstr "" #: lazarusidestrconsts.uemextractproc msgctxt "lazarusidestrconsts.uemextractproc" msgid "Extract Procedure" msgstr "Extrau el procediment" #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" msgstr "&Cerca la declaració" #: lazarusidestrconsts.uemfindidentifierreferences msgid "Find Identifier References" msgstr "Cerca les referències de l'identificador" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" msgstr "&Vés al marcador" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" msgstr "" #: lazarusidestrconsts.ueminserttodo msgid "Insert Todo" msgstr "" #: lazarusidestrconsts.ueminspect msgid "&Inspect..." msgstr "" #: lazarusidestrconsts.ueminvertassignment msgid "Invert Assignment" msgstr "Inverteix l'assignació" #: lazarusidestrconsts.uemlineending msgid "Line ending" msgstr "" #: lazarusidestrconsts.uemmovepageleft msgid "Move page left" msgstr "" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move page leftmost" msgstr "" #: lazarusidestrconsts.uemmovepageright msgid "Move page right" msgstr "" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move page rightmost" msgstr "" #: lazarusidestrconsts.uemmovetonewwindow msgid "Move to new Window" msgstr "" #: lazarusidestrconsts.uemmovetootherwindow msgid "Move to other Window" msgstr "" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" msgid "New Window" msgstr "" #: lazarusidestrconsts.uemnextbookmark msgid "Goto next Bookmark" msgstr "Ves al següent Marcador" #: lazarusidestrconsts.uemodified msgid "Modified" msgstr "Modificat" #: lazarusidestrconsts.uemopenfileatcursor msgid "&Open file at cursor" msgstr "&Obre el fitxer al cursor" #: lazarusidestrconsts.uempaste msgctxt "lazarusidestrconsts.uempaste" msgid "Paste" msgstr "Enganxa" #: lazarusidestrconsts.uemprevbookmark msgid "Goto previous Bookmark" msgstr "Ves al Marcador anterior" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" msgstr "" #: lazarusidestrconsts.uemreadonly msgctxt "lazarusidestrconsts.uemreadonly" msgid "Read Only" msgstr "Només lectura" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" msgstr "Torna a factoritzar" #: lazarusidestrconsts.uemrenameidentifier msgid "Rename Identifier" msgstr "Canvia el nom de l'identificador" #: lazarusidestrconsts.uemruntocursor msgid "&Run to Cursor" msgstr "&Executa al cursor" #: lazarusidestrconsts.uemsetbookmark msgid "&Set Bookmark" msgstr "Especifica el &marcador" #: lazarusidestrconsts.uemsetfreebookmark msgctxt "lazarusidestrconsts.uemsetfreebookmark" msgid "Set a free Bookmark" msgstr "Estableix un Marcador lliure" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" msgstr "Mostra nombre de línia" #: lazarusidestrconsts.uemshowunitinfo msgid "Unit Info" msgstr "Informació de la unitat" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" msgstr "" #: lazarusidestrconsts.uemtogglebreakpoint msgid "&Toggle Breakpoint" msgstr "" #: lazarusidestrconsts.uemviewcallstack msgid "View Call Stack" msgstr "Mostra la pila de les crides" #: lazarusidestrconsts.uenotimplcap msgid "Not implemented yet" msgstr "Encara no està implementat" #: lazarusidestrconsts.uenotimplcapagain msgid "I told You: Not implemented yet" msgstr "Us ho he dit: Encara NO està implementat" #: lazarusidestrconsts.uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" msgstr "Si ens podeu ajudar a implementar aquesta característica, escriviu a lazarus@miraclec.com" #: lazarusidestrconsts.uepins msgid "INS" msgstr "INS" #: lazarusidestrconsts.uepovr msgid "OVR" msgstr "OVR" #: lazarusidestrconsts.uepreadonly msgid "Readonly" msgstr "Només de lectura" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" msgstr "Informació de la versió"