msgid "" msgstr "" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts.dlfmousepredefinedscheme msgid "Use predefined scheme" msgstr "Käytä valmista ehdotelmaa" #: lazarusidestrconsts.dlfmouseresetall msgid "Reset all settings" msgstr "Nollaa kaikki asetukset" #: lazarusidestrconsts.dlfmouseresetgutter msgid "Reset all gutter settings" msgstr "Nollaa kaikki reunapalkin asetukset" #: lazarusidestrconsts.dlfmouseresettext msgid "Reset all text settings" msgstr "Nollaa kaikki tekstin asetukset" #: lazarusidestrconsts.dlfmousesimplediff msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" msgstr "" #: lazarusidestrconsts.dlfmousesimplegenericsect msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" msgid "General" msgstr "Yleistä" #: lazarusidestrconsts.dlfmousesimplegutterleftdown msgid "Standard, All actions (breakpoint, fold) on Mouse down" msgstr "Standardi, toiminnot (keskeytyskohta, laskostus) kun hiiren nappi painetaan alas" #: lazarusidestrconsts.dlfmousesimplegutterleftup msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move" msgstr "Standardi, toiminnot (keskeytyskohta, laskostus) kun hiiren nappi vapautuu. Valinta: hiiren nappi alas + liike" #: lazarusidestrconsts.dlfmousesimpleguttersect msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" msgid "Gutter" msgstr "Reunapalkki" #: lazarusidestrconsts.dlfmousesimplerightmovecaret msgid "Right mouse includes caret move" msgstr "Oikea hiiren nappi siirtää tekstikursoria" #: lazarusidestrconsts.dlfmousesimpletextsect msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" msgid "Text" msgstr "Teksti" #: lazarusidestrconsts.dlfmousesimpletextsectalt msgid "Alt-Key sets column mode" msgstr "Alt-näppäin asettaa sarake-moodin" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel msgid "Ctrl Left Button" msgstr "Ctrl Left näppäin" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump" msgid "jumps to implementation" msgstr "hyppää toteutukseen" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock msgid "jumps to implementation/other block end" msgstr "hyppää toteutukseen/lohkon toiseen päähän" #: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone" msgid "nothing" msgstr "ei mitään" #: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline msgid "Double Click selects line" msgstr "Kaksoisklikkaus valitsee rivin" #: lazarusidestrconsts.dlfmousesimpletextsectdrag msgid "Drag Selection (copy/paste)" msgstr "Vedä valittua lohkoa (kopioi/liitä)" #: lazarusidestrconsts.dlfmousesimpletextsectmidgoto msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto" msgid "jumps to implementation" msgstr "hyppää toteutukseen" #: lazarusidestrconsts.dlfmousesimpletextsectmidlabel msgid "Middle Button" msgstr "Keski-näppäin" #: lazarusidestrconsts.dlfmousesimpletextsectmidnone msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone" msgid "nothing" msgstr "ei mitään" #: lazarusidestrconsts.dlfmousesimpletextsectmidpaste msgid "paste selection" msgstr "liitä valittu lohko" #: lazarusidestrconsts.dlfmousesimplewarning msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" msgstr "" #: lazarusidestrconsts.dlfnopredefinedscheme msgid "< None >" msgstr "< Ei mikään >" #: lazarusidestrconsts.dlfreadonlycolor msgctxt "lazarusidestrconsts.dlfreadonlycolor" msgid "Read Only" msgstr "Vain luettavissa" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" msgstr "Ensimmäinen kirjain iso muut pieniä" #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "Lisää := operaattori (saa arvokseen) " #: lazarusidestrconsts.dlgaddhiattrbracketmatch msgid "Brackets highlight" msgstr "Sulkeiden korostus" #: lazarusidestrconsts.dlgaddhiattrcodefoldingtree msgid "Code folding tree" msgstr "Koodin laskostus puu" #: lazarusidestrconsts.dlgaddhiattrdefault msgid "Default Text" msgstr "Oletus teksti" #: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint msgid "Disabled breakpoint" msgstr "Estetty keskeytyskohta" #: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint msgid "Enabled breakpoint" msgstr "Sallittu keskeytyskohta" #: lazarusidestrconsts.dlgaddhiattrerrorline msgid "Error line" msgstr "Virheen rivi" #: lazarusidestrconsts.dlgaddhiattrexecutionpoint msgid "Execution point" msgstr "Suorituspiste" #: lazarusidestrconsts.dlgaddhiattrfoldedcode msgid "Folded code marker" msgstr "Laskostetun koodin merkki" #: lazarusidestrconsts.dlgaddhiattrgroupdefault msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" msgid "Global" msgstr "Kaiken kattava" #: lazarusidestrconsts.dlgaddhiattrgroupgutter msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" msgid "Gutter" msgstr "Reunapalkki" #: lazarusidestrconsts.dlgaddhiattrgroupline msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" msgid "Line" msgstr "Rivi" #: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit msgid "Syncron Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit msgid "Template Edit" msgstr "" #: lazarusidestrconsts.dlgaddhiattrgrouptext msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" msgid "Text" msgstr "Teksti" #: lazarusidestrconsts.dlgaddhiattrgutterseparator msgid "Gutter Separator" msgstr "Reunapalkin erotin" #: lazarusidestrconsts.dlgaddhiattrhighlightall msgid "Incremental others" msgstr "" #: lazarusidestrconsts.dlgaddhiattrhighlightword msgid "Highlight current word" msgstr "Korosta aktiivinen sana" #: lazarusidestrconsts.dlgaddhiattrincrementalsearch msgid "Incremental search" msgstr "Kirjain kerrallaan haku" #: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint msgid "Invalid breakpoint" msgstr "Kelvoton keskeytyskohta" #: lazarusidestrconsts.dlgaddhiattrlinehighlight msgid "Current line highlight" msgstr "Aktiivisen rivin korostus" #: lazarusidestrconsts.dlgaddhiattrlinenumber msgid "Line number" msgstr "Rivinumero" #: lazarusidestrconsts.dlgaddhiattrmodifiedline msgid "Modified line" msgstr "Muutettu rivi" #: lazarusidestrconsts.dlgaddhiattrmouselink msgid "Mouse link" msgstr "Hiiren linkki" #: lazarusidestrconsts.dlgaddhiattrsyncroeditarea msgid "Selected Area" msgstr "Valittu alue" #: lazarusidestrconsts.dlgaddhiattrsyncroeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" msgid "Active Cell" msgstr "Aktiivinen solu" #: lazarusidestrconsts.dlgaddhiattrsyncroeditother msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" msgid "Other Cells" msgstr "Muut solut" #: lazarusidestrconsts.dlgaddhiattrsyncroeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" msgid "Syncronized Cells" msgstr "Synkronoidut solut" #: lazarusidestrconsts.dlgaddhiattrtemplateeditcur msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" msgid "Active Cell" msgstr "Aktiivinen solu" #: lazarusidestrconsts.dlgaddhiattrtemplateeditother msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" msgid "Other Cells" msgstr "Muut solut" #: lazarusidestrconsts.dlgaddhiattrtemplateeditsync msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" msgid "Syncronized Cells" msgstr "Synkronoidut solut" #: lazarusidestrconsts.dlgaddhiattrtextblock msgid "Text block" msgstr "Tekstilohko" #: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint msgid "Unknown breakpoint" msgstr "Tuntematon keskeytyskohta" #: lazarusidestrconsts.dlgaddhiattrwordgroup msgid "Word-Brackets" msgstr "" #: lazarusidestrconsts.dlgaddhispecialvisiblechars msgid "Visualized Special Chars" msgstr "" #: lazarusidestrconsts.dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" msgstr "Lisätty lähdekoodin hakupolku kaikille projekteille (.pp;.pas)" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" msgstr "Lisää puolipiste" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "" #: lazarusidestrconsts.dlgallfiles msgid "All files" msgstr "Kaikki tiedostot" #: lazarusidestrconsts.dlgalphabetically msgid "Alphabetically" msgstr "Aakkosjärjestyksessä" #: lazarusidestrconsts.dlgalreadyusesallotherunits msgid "\"%s\" already uses all the units in this project" msgstr "\"%s\" jo käyttää kaikkia tämän projektin käännösyksiköitä" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always visible cursor" msgstr "Kursori näkyy aina" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" msgstr "Toiminta moniselitteisten tiedostojen kanssa" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" msgstr "Varoita käännettäessä" #: lazarusidestrconsts.dlgapplicationsettings msgid "Application Settings" msgstr "Sovelluksen asetukset" #: lazarusidestrconsts.dlgassemblerdefault msgctxt "lazarusidestrconsts.dlgassemblerdefault" msgid "Default" msgstr "Oletus" #: lazarusidestrconsts.dlgassertcode msgid "Include Assertion Code" msgstr "Ota mukaan Assertion-koodi" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" msgstr "Automaattisesti luotavat lomakkeet:" #: lazarusidestrconsts.dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" msgstr "Kun tehdään uusi lomake niin se laitetaan automaattisesti luotaviin lomakkeisiin" #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" msgstr "Poista tiedosto automaattisesti" #: lazarusidestrconsts.dlgautohidecursor msgid "Hide mouse when typing" msgstr "Piilota hiiri kirjoitettaessa" #: lazarusidestrconsts.dlgautoindent msgid "Auto indent" msgstr "Automaattinen sisennys" #: lazarusidestrconsts.dlgautoindentlink msgid "(Setup smart indent)" msgstr "(Aseta älykäs sisennys)" #: lazarusidestrconsts.dlgautoremoveemptymethods msgid "Auto remove empty methods" msgstr "Poista automaattisesti tyhjät metodit" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" msgstr "Muunna nimi automaattisesti pienillä kirjaimilla kirjoitetuksi" #: lazarusidestrconsts.dlgautosave msgid "Auto save" msgstr "Automaattinen tallennus" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" msgstr "Käytettävissä olevat lomakkeet:" #: lazarusidestrconsts.dlgbackcolor msgid "Background" msgstr "Taustaväri" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(ei alikansiota)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "Sama nimi (mutta alikansiossa)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" msgstr "Metodien takana" #: lazarusidestrconsts.dlgblockgroupoptions msgid "Selection:" msgstr "Valinta:" #: lazarusidestrconsts.dlgblockindent msgid "Block indent" msgstr "Lohkon sisennys" #: lazarusidestrconsts.dlgblockindenttype msgid "Indent method" msgstr "Sisennä metodia" #: lazarusidestrconsts.dlgblockindenttypecopy msgid "Space/tab as prev Line" msgstr "" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" msgstr "Vain sijainti" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" msgstr "Välilyönnit" #: lazarusidestrconsts.dlgbp7cptb msgid "TP/BP 7.0 Compatible" msgstr "Yhteensopiva TP/BP7.0:n kanssa" #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" msgstr "Sulkujen korostus" #: lazarusidestrconsts.dlgbracketmatchgroup msgid "Matching bracket pairs" msgstr "Yhteensopivat sulkuparit" #: lazarusidestrconsts.dlgbrowsemsgfilter msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*" msgstr "Free Pascal kääntäjän viestit (*.msg)|*.msg|Kaikki tiedostot (*.*)|*.*" #: lazarusidestrconsts.dlgbutapply msgid "Apply" msgstr "Toteuta" #: lazarusidestrconsts.dlgcancel msgctxt "lazarusidestrconsts.dlgcancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.dlgcasesensitive msgctxt "lazarusidestrconsts.dlgcasesensitive" msgid "&Case Sensitive" msgstr "Sama kirjainkoko" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" msgstr "Tarkistetaan kääntäjän asetukset" #: lazarusidestrconsts.dlgccoresults msgid "Results" msgstr "Tulokset" #: lazarusidestrconsts.dlgccotest msgctxt "lazarusidestrconsts.dlgccotest" msgid "Test" msgstr "Testi" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "Testi: Tarkistetaan kääntäjä ..." #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "Testi: Tarkistetaan kääntäjän asetukset ..." #: lazarusidestrconsts.dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." msgstr "Testi: Tarkistetaan FPC:n asetustiedostot ..." #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "Testi: Tarkistetaan kääntäjän päiväys ..." #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "Testi: Käännetään tyhjä tiedosto ..." #: lazarusidestrconsts.dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." msgstr "Testi: Tarkistetaan puuttuvat FPC:n ppu:t ..." #: lazarusidestrconsts.dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "Testi: Tarkistetaan lähdetiedostot FPC:n ppu-hakupoluista ..." #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "Testi: Käännetään tyhjä tiedosto" #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" msgstr "Luokkajärjestys" #: lazarusidestrconsts.dlgcdtlast msgid "Last" msgstr "Viimeinen" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" msgstr "Pienet kirjaimet" #: lazarusidestrconsts.dlgcdtpreview msgid "Preview (Max line length = 1)" msgstr "Esikatselu (kun maksimi rivinpituus = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" msgstr "'Read' pääte" #: lazarusidestrconsts.dlgcdtstoredpostfix msgid "Stored postfix" msgstr "'Stored' pääte" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" msgstr "ISOT KIRJAIMET" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" msgstr "Muuttujan etuliite" #: lazarusidestrconsts.dlgcdtwriteprefix msgid "Write prefix" msgstr "Kirjoitus-etuliite" #: lazarusidestrconsts.dlgcentercursorline msgid "Center Cursor Line" msgstr "Keskitä aktiivinen rivi" #: lazarusidestrconsts.dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" msgstr "'Tallenna nimellä'-toiminnossa, tiedoston nimen automaattinen muuntaminen pieniksi kirjaimiksi" #: lazarusidestrconsts.dlgcheckconsistency msgid "Check consistency" msgstr "Tarkista yksikäsitteisyys" #: lazarusidestrconsts.dlgcheckpackagesonformcreate msgid "Check packages on form create" msgstr "Tarkista paketit lomaketta luotaessa" #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Valitse koodilyhennetiedosto (*.dci)" #: lazarusidestrconsts.dlgclassinsertpolicy msgid "Class part insert policy" msgstr "" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "Näytä sulje-painike välilehdellä" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" msgstr "Väriehdotelma" #: lazarusidestrconsts.dlgcmacro msgid "C Style Macros (global)" msgstr "C-tyyliset makrot (kaikkialla)" #: lazarusidestrconsts.dlgcoansistr msgid "Use Ansi Strings" msgstr "Käytä Ansi-merkkijonoja" #: lazarusidestrconsts.dlgcoasis msgid "As-Is" msgstr "" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style:" msgstr "Assembler tyyli:" #: lazarusidestrconsts.dlgcocfgcmpmessages msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" msgid "Messages" msgstr "Viestit" #: lazarusidestrconsts.dlgcochecks #, fuzzy #| msgid "Checks:" msgid "Checks" msgstr "Tarkistukset:" #: lazarusidestrconsts.dlgcocompilation msgid "Compilation" msgstr "Käännös" #: lazarusidestrconsts.dlgcoconditionals msgid "Conditionals" msgstr "Ehtolauseet" #: lazarusidestrconsts.dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" msgstr "" #: lazarusidestrconsts.dlgcocreatechildnode msgid "Create child node" msgstr "" #: lazarusidestrconsts.dlgcocreatemakefile msgctxt "lazarusidestrconsts.dlgcocreatemakefile" msgid "Create Makefile" msgstr "Luo Make-tiedosto" #: lazarusidestrconsts.dlgcocreatenodeabove msgid "Create node above" msgstr "Luo solmu yläpuolelle" #: lazarusidestrconsts.dlgcocreatenodebelow msgid "Create node below" msgstr "Luo solmu alapuolelle" #: lazarusidestrconsts.dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" msgstr "Lisää virheenjäljitystieto DBX:lle (hidastaa käännöstä)" #: lazarusidestrconsts.dlgcodebugging #, fuzzy #| msgid "Debugging Info:" msgctxt "lazarusidestrconsts.dlgcodebugging" msgid "Debugging Info" msgstr "Virheenjäljitys:" #: lazarusidestrconsts.dlgcodebugging2 #, fuzzy #| msgid "Debugging:" msgctxt "lazarusidestrconsts.dlgcodebugging2" msgid "Debugging" msgstr "Virheenjäljitys:" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Virheenjäljittimen polun lisäys (ei mitään)" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" msgstr "Koodin luonti" #: lazarusidestrconsts.dlgcodefoldenableboth msgid "Both" msgstr "Molemmat" #: lazarusidestrconsts.dlgcodefoldenablefold msgid "Fold" msgstr "Laskostus" #: lazarusidestrconsts.dlgcodefoldenablehide msgid "Hide" msgstr "Piilota" #: lazarusidestrconsts.dlgcodefoldingmouse msgctxt "lazarusidestrconsts.dlgcodefoldingmouse" msgid "Mouse" msgstr "Hiiri" #: lazarusidestrconsts.dlgcodefoldpopuporder msgid "Reverse fold-order in Popup" msgstr "Käänteinen laskostusjärjestys popup-luettelossa" #: lazarusidestrconsts.dlgcodegeneration msgid "Code generation" msgstr "Koodin generointi" #: lazarusidestrconsts.dlgcodetoolsopts msgid "CodeTools Options" msgstr "CodeTools asetukset" #: lazarusidestrconsts.dlgcofast msgid "Faster Code" msgstr "Nopeampi koodi" #: lazarusidestrconsts.dlgcogdb #, fuzzy #| msgid "Generate Debugging Info For GDB (Slows Compiling)" msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)" msgstr "Lisää virheenjäljitystieto GDB:tä varten (hidastaa käännöstä)" #: lazarusidestrconsts.dlgcoheaptrc #, fuzzy #| msgid "Use Heaptrc Unit" msgid "Use Heaptrc Unit (check for mem-leaks)" msgstr "Käytä Heaptrc käännösyksikköä" #: lazarusidestrconsts.dlgcoincfiles msgid "Include Files (-Fi):" msgstr "" #: lazarusidestrconsts.dlgcoinherited msgctxt "lazarusidestrconsts.dlgcoinherited" msgid "Inherited" msgstr "Periytynyt" #: lazarusidestrconsts.dlgcokeepvarsreg msgid "Keep certain variables in registers" msgstr "Pidä jotkut muuttujat rekistereissä" #: lazarusidestrconsts.dlgcolibraries msgid "Libraries (-Fl):" msgstr "Kirjastot (-Fl):" #: lazarusidestrconsts.dlgcolinking msgid "Linking" msgstr "" #: lazarusidestrconsts.dlgcoloadsave msgid "Load/Save" msgstr "Lataa/Talleta" #: lazarusidestrconsts.dlgcolor msgid "Color" msgstr "Väri" #: lazarusidestrconsts.dlgcolorexportbutton msgctxt "lazarusidestrconsts.dlgcolorexportbutton" msgid "Export" msgstr "Vie" #: lazarusidestrconsts.dlgcolorlink msgid "(Edit Color)" msgstr "(Muokkaa väriä)" #: lazarusidestrconsts.dlgcolornotmodified msgid "Not modified" msgstr "Ei muutettu" #: lazarusidestrconsts.dlgcolors msgctxt "lazarusidestrconsts.dlgcolors" msgid "Colors" msgstr "Värit" #: lazarusidestrconsts.dlgcommandlineparameters msgid "Command line parameters" msgstr "Komentorivin parametrit" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "Komentorivin parametrit (ilman ohjelman omaa nimeä)" #: lazarusidestrconsts.dlgcomovedown msgid "Move down" msgstr "Siirry alas" #: lazarusidestrconsts.dlgcomoveleveldown msgid "Move level down" msgstr "Siirry taso alas" #: lazarusidestrconsts.dlgcomovelevelup msgid "Move level up" msgstr "Siirry taso ylös" #: lazarusidestrconsts.dlgcomoveup msgid "Move up" msgstr "Siirry ylös" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler Messages" msgstr "Kääntäjän viestit" #: lazarusidestrconsts.dlgcompilermessages msgid "Compiler messages language file" msgstr "Kääntäjän viestien kielitietosto" #: lazarusidestrconsts.dlgcompileroptions msgctxt "lazarusidestrconsts.dlgcompileroptions" msgid "Compiler Options" msgstr "Kääntäjän asetukset" #: lazarusidestrconsts.dlgcompleteproperties msgid "Complete properties" msgstr "Täydennyksen ominaisuudet" #: lazarusidestrconsts.dlgconfigfiles msgid "Config Files:" msgstr "Asetustiedostot:" #: lazarusidestrconsts.dlgconormal msgid "Normal Code" msgstr "Tavallinen koodi" #: lazarusidestrconsts.dlgcoopts msgid "Options: " msgstr "" #: lazarusidestrconsts.dlgcoother msgctxt "lazarusidestrconsts.dlgcoother" msgid "Other" msgstr "" #: lazarusidestrconsts.dlgcooverflow msgid "Overflow" msgstr "" #: lazarusidestrconsts.dlgcoparsing msgid "Parsing" msgstr "" #: lazarusidestrconsts.dlgcopypastekeepfolds msgid "Copy/Paste with fold info" msgstr "Kopioi/Liitä laskostustiedon kanssa" #: lazarusidestrconsts.dlgcopywordatcursoroncopynone msgid "Copy word on copy none" msgstr "Kopioi sana kun valittuna ei mitään" #: lazarusidestrconsts.dlgcorange msgid "Range" msgstr "Alue" #: lazarusidestrconsts.dlgcoshowerr msgid "Show Errors" msgstr "Näytä virheet" #: lazarusidestrconsts.dlgcoshowoptions msgid "&Show Options" msgstr "Näytä asetukset" #: lazarusidestrconsts.dlgcosmaller msgid "Smaller Code" msgstr "Pienempi koodi" #: lazarusidestrconsts.dlgcosmartlinkable msgid "Smart Linkable" msgstr "" #: lazarusidestrconsts.dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Muut lähdekoodit (.pp/.pas tiedostot, vain kehitysympäristö käyttää, ei kääntäjä)" #: lazarusidestrconsts.dlgcostack msgid "Stack" msgstr "Pino" #: lazarusidestrconsts.dlgcostrip msgid "Strip Symbols From Executable" msgstr "" #: lazarusidestrconsts.dlgcosymboltype msgid "Chose type of debug info" msgstr "" #: lazarusidestrconsts.dlgcosymboltypeauto msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" msgid "Automatic" msgstr "Automaattinen" #: lazarusidestrconsts.dlgcosymboltypedwarf2 msgid "Dwarf2" msgstr "" #: lazarusidestrconsts.dlgcosymboltypedwarf2set msgid "Dwarf with Sets" msgstr "" #: lazarusidestrconsts.dlgcosymboltypedwarf3 msgid "Dwarf3 (beta)" msgstr "" #: lazarusidestrconsts.dlgcosymboltypestabs msgid "Stabs" msgstr "" #: lazarusidestrconsts.dlgcounitstyle msgid "Unit Style" msgstr "" #: lazarusidestrconsts.dlgcouseasdefault msgid "Use these compiler options as default for new projects" msgstr "Käytä näitä kääntäjän asetuksia oletuksena uusissa projekteissa" #: lazarusidestrconsts.dlgcovalgrind msgid "Generate code for valgrind" msgstr "Lisää koodi valgrind:ia varten" #: lazarusidestrconsts.dlgcoverbosity msgid "Verbosity" msgstr "Tulosteen määrä" #: lazarusidestrconsts.dlgcppinline msgid "C++ Styled INLINE" msgstr "" #: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages msgid "Ctrl-middle-click on tab closes all others" msgstr "" #: lazarusidestrconsts.dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "" #: lazarusidestrconsts.dlgcursorgroupoptions msgid "Cursor:" msgstr "Kursori:" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Cursor skips selection" msgstr "Kursori ohittaa valinnan" #: lazarusidestrconsts.dlgcursorskipstab msgid "Cursor skips tabs" msgstr "Kursori ohittaa tabulaattorit" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Käyttäjän määrittämä tiedostontarkennin (.pp.xxx)" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "Polkumuokkain" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" msgstr "Virheenjäljittimen tyyppi ja polku" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" msgstr "Editorin oletuskirjasin" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" msgstr "Oletusarvo" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " msgstr "Poistetaanko koodilyhenne " #: lazarusidestrconsts.dlgdeplhicomp msgid "Delphi Compatible" msgstr "Delphi-yhteensopiva" #: lazarusidestrconsts.dlgdesktop msgid "Desktop" msgstr "Työpöytä" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " msgstr "Näppäimet - " #: lazarusidestrconsts.dlgdesktopfiles msgid "Desktop files" msgstr "Työpöytätiedostot" #: lazarusidestrconsts.dlgdesktophints msgid "Hints" msgstr "Vihjeet" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " msgstr "" #: lazarusidestrconsts.dlgdesktopmisc msgid "Misc Options" msgstr "Valikot - " #: lazarusidestrconsts.dlgdirection msgid "Direction" msgstr "Suunta" #: lazarusidestrconsts.dlgdirectorydoesnotexist msgid "Directory does not exist" msgstr "Hakemistoa ei ole" #: lazarusidestrconsts.dlgdisableantialiasing msgid "Disable anti-aliasing" msgstr "" #: lazarusidestrconsts.dlgdividercolordefault msgid "Use right margin color" msgstr "Käytä oikean marginaalin väriä" #: lazarusidestrconsts.dlgdividerdrawdepth msgid "Draw divider level" msgstr "Piirrä jakajataso" #: lazarusidestrconsts.dlgdividernestcolor msgid "Nested line color" msgstr "Sisennetyn rivin väri" #: lazarusidestrconsts.dlgdivideronoff msgid "Draw divider" msgstr "Piirrä jakaja" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" msgstr "Viivan väri" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" msgstr "" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" msgstr "" #: lazarusidestrconsts.dlgdivpasstructglobalname msgid "Class/Struct" msgstr "" #: lazarusidestrconsts.dlgdivpasstructlocalname msgid "Class/Struct (local)" msgstr "" #: lazarusidestrconsts.dlgdivpastryname msgid "Try/Except" msgstr "" #: lazarusidestrconsts.dlgdivpasunitsectionname msgid "Unit sections" msgstr "" #: lazarusidestrconsts.dlgdivpasusesname msgid "Uses clause" msgstr "" #: lazarusidestrconsts.dlgdivpasvarglobalname msgid "Var/Type" msgstr "" #: lazarusidestrconsts.dlgdivpasvarlocalname msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgdownword msgctxt "lazarusidestrconsts.dlgdownword" msgid "Down" msgstr "Alas" #: lazarusidestrconsts.dlgedadd msgid "Add ..." msgstr "Lisää ..." #: lazarusidestrconsts.dlgedback msgid "Back" msgstr "Takaisin" #: lazarusidestrconsts.dlgedbold msgid "Bold" msgstr "Lihavoitu" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" msgstr "Alikansio" #: lazarusidestrconsts.dlgedcodetempl msgid "Code templates" msgstr "Koodimallit" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Add close statement for pascal blocks" msgstr "Lisää Pascal:n lauserakenteiden lopputekstit." #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" msgstr "Käyttäjän määrittämä tiedostontarkennin" #: lazarusidestrconsts.dlgeddelay msgid "Delay" msgstr "Viive" #: lazarusidestrconsts.dlgeddelayinsec msgid "(%s sec delay)" msgstr "" #: lazarusidestrconsts.dlgeddelete msgctxt "lazarusidestrconsts.dlgeddelete" msgid "Delete" msgstr "" #: lazarusidestrconsts.dlgeddisplay msgid "Display" msgstr "Näkymä" #: lazarusidestrconsts.dlgededit msgid "Edit ..." msgstr "Muokkaa ..." #: lazarusidestrconsts.dlgedfiles msgid "Editor files" msgstr "Editorin tiedostot" #: lazarusidestrconsts.dlgedidcomlet msgctxt "lazarusidestrconsts.dlgedidcomlet" msgid "Identifier completion" msgstr "Koodin täydentäminen" #: lazarusidestrconsts.dlgedinvert msgid "Invert" msgstr "Käännä ympäri" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit msgid "Ignore Locks, use longest unused editor" msgstr "Ohita lukot, käytä pisinpään käyttämättä ollutta editoria" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit msgid "Ignore Locks, if editor is current" msgstr "Ohita lukot, jos editori on aktiivinen" #: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin msgid "Ignore Locks, if editor in current window" msgstr "Ohita lukot, jos editori on aktiivinen ikkuna" #: lazarusidestrconsts.dlgeditaccesscaptionlockedinview msgid "Locked, if text in view" msgstr "Lukittu, jos tekstiä näkyvillä" #: lazarusidestrconsts.dlgeditaccesscaptionunlocked msgid "Unlocked" msgstr "Ei lukittu" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview msgid "Unlocked, if text in centered view" msgstr "Ei lukittu, jos tekstiä keskitetyssä näkymässä" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin msgid "New tab, existing or new window" msgstr "Uusi välilehti nykyiseen tai uuteen ikkunaan" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin msgid "New tab in new window" msgstr "Uusi välilehti uuteen ikkunaan" #: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin msgid "New tab in existing window" msgstr "Uusi välilehti nykyiseen ikkunaan" #: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." msgstr "" #: lazarusidestrconsts.dlgeditaccessdesclockedinview msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlocked msgid "This option will use any not locked Editor." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." msgstr "" #: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file." msgstr "" #: lazarusidestrconsts.dlgedital msgid "Italic" msgstr "Kursivoitu" #: lazarusidestrconsts.dlgeditorfont msgid "Editor font" msgstr "Editorin käyttämä kirjasin" #: lazarusidestrconsts.dlgeditorfontsize msgid "Editor font size" msgstr "" #: lazarusidestrconsts.dlgeditoroptions msgctxt "lazarusidestrconsts.dlgeditoroptions" msgid "Editor options" msgstr "" #: lazarusidestrconsts.dlgeditschemdefaults msgid "Scheme globals" msgstr "" #: lazarusidestrconsts.dlgedmisc msgid "Misc" msgstr "Lisuke" #: lazarusidestrconsts.dlgednoerr msgid "No errors in key mapping found." msgstr "Näppäinkartasta ei löytynyt virheitä." #: lazarusidestrconsts.dlgedoff msgid "Off" msgstr "Pois" #: lazarusidestrconsts.dlgedon msgid "On" msgstr "Päällä" #: lazarusidestrconsts.dlgedunder msgid "Underline" msgstr "Alleviivaus" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" msgstr "" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" msgstr "" #: lazarusidestrconsts.dlgenvask msgid "Ask" msgstr "Kysy" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Huomaa: Projektin tiedostoja ovat kaikki tiedostot projektikansiossa" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" msgstr "Varmistus" #: lazarusidestrconsts.dlgenvfiles msgid "Files" msgstr "Tiedostot" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" msgstr "Apupisteet" #: lazarusidestrconsts.dlgenvlanguage msgctxt "lazarusidestrconsts.dlgenvlanguage" msgid "Language" msgstr "Kieli" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" msgstr "Kohdistusviivat" #: lazarusidestrconsts.dlgenvmisc msgctxt "lazarusidestrconsts.dlgenvmisc" msgid "Miscellaneous" msgstr "Muut" #: lazarusidestrconsts.dlgenvnone msgctxt "lazarusidestrconsts.dlgenvnone" msgid "None" msgstr "Ei yhtään" #: lazarusidestrconsts.dlgenvotherfiles msgid "Other files" msgstr "Muut tiedostot" #: lazarusidestrconsts.dlgenvproject msgid "Project" msgstr "Projekti" #: lazarusidestrconsts.dlgenvtype msgctxt "lazarusidestrconsts.dlgenvtype" msgid "Type" msgstr "Tyyppi" #: lazarusidestrconsts.dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" msgstr "Siirry viesteihin käännöksen jälkeen" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra char spacing" msgstr "" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" msgstr "Lisäpikselien määrä rivien välissä (tekstin erottaminen helpottuu)" #: lazarusidestrconsts.dlgextsymb msgid "Use external gdb debug symbols file" msgstr "Käytä ulkoista gdb virheenjäljitys symboli-tiedostoa" #: lazarusidestrconsts.dlgfileexts msgid "File extensions" msgstr "Tiedostopäätteet" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" msgstr "Etsi tekstiä kursorin kohdasta" #: lazarusidestrconsts.dlgfolddiffchunk msgid "Chunk" msgstr "Möhkäle" #: lazarusidestrconsts.dlgfolddiffchunksect msgid "Chunk section" msgstr "Möhkäleryhmä" #: lazarusidestrconsts.dlgfolddifffile msgctxt "lazarusidestrconsts.dlgfolddifffile" msgid "File" msgstr "Tiedosto" #: lazarusidestrconsts.dlgfoldhtmlasp msgid "ASP" msgstr "" #: lazarusidestrconsts.dlgfoldhtmlcomment msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" msgid "Comment" msgstr "Kommentti" #: lazarusidestrconsts.dlgfoldhtmlnode msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" msgid "Node" msgstr "Solmu" #: lazarusidestrconsts.dlgfoldlfmitem msgid "Item" msgstr "Osa" #: lazarusidestrconsts.dlgfoldlfmlist msgid "List <>" msgstr "Luettelo <>" #: lazarusidestrconsts.dlgfoldlfmobject msgid "Object (inherited, inline)" msgstr "Objekti (periytynyt, inline)" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgfoldpasansicomment msgid "Comment (* *)" msgstr "Kommentti (* *)" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" msgstr "" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" msgstr "Begin/End (sisäkkäinen)" #: lazarusidestrconsts.dlgfoldpasborcomment msgid "Comment { }" msgstr "" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" msgstr "" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" msgstr "" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" msgstr "" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" msgstr "" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" msgstr "" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocedure msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" msgid "Procedure" msgstr "Aliohjelma" #: lazarusidestrconsts.dlgfoldpasprogram msgctxt "lazarusidestrconsts.dlgfoldpasprogram" msgid "Program" msgstr "Ohjelma" #: lazarusidestrconsts.dlgfoldpasrecord msgid "Record" msgstr "" #: lazarusidestrconsts.dlgfoldpasrepeat msgid "Repeat" msgstr "" #: lazarusidestrconsts.dlgfoldpasslashcomment msgid "Comment //" msgstr "Kommentti //" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" msgstr "" #: lazarusidestrconsts.dlgfoldpasunit msgctxt "lazarusidestrconsts.dlgfoldpasunit" msgid "Unit" msgstr "" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" msgstr "" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" msgstr "" #: lazarusidestrconsts.dlgfoldpasuses msgctxt "lazarusidestrconsts.dlgfoldpasuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcdata msgid "CData" msgstr "" #: lazarusidestrconsts.dlgfoldxmlcomment msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" msgid "Comment" msgstr "Kommentti" #: lazarusidestrconsts.dlgfoldxmldoctype msgid "DocType" msgstr "" #: lazarusidestrconsts.dlgfoldxmlnode msgctxt "lazarusidestrconsts.dlgfoldxmlnode" msgid "Node" msgstr "Solmu" #: lazarusidestrconsts.dlgfoldxmlprocess msgid "Processing Instruction" msgstr "Toimintaohjeet" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" msgstr "Edusta" #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "Aliohjelman lisäystapa" #: lazarusidestrconsts.dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Säilytä aliohjelmien järjestys" #: lazarusidestrconsts.dlgfpcpath msgid "Compiler path (e.g. %s)" msgstr "Kääntäjän polku (esim. %s)" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" msgstr "FPC:n lähdekoodin kansio" #: lazarusidestrconsts.dlgframecolor msgid "Text-mark" msgstr "Teksti-merkki" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" msgstr "Lomake-editori" #: lazarusidestrconsts.dlgfrombeginning msgid "From B&eginning" msgstr "" #: lazarusidestrconsts.dlgfromcursor msgid "&From Cursor" msgstr "Kursorin kohdasta" #: lazarusidestrconsts.dlgfropts msgctxt "lazarusidestrconsts.dlgfropts" msgid "Options" msgstr "Optiot" #: lazarusidestrconsts.dlggetposition msgid "Get position" msgstr "Hae sijainti" #: lazarusidestrconsts.dlgglobal msgid "&Global" msgstr "Kaikki" #: lazarusidestrconsts.dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" msgstr "Yhteensopiva GPC (GNU Pascal kääntäjän) kanssa" #: lazarusidestrconsts.dlggprof msgid "Generate code for gprof" msgstr "" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" msgstr "Valitun komponentin (tai valinta-alueen) ilmaiseminen" #: lazarusidestrconsts.dlggridcolor msgid "Grid color" msgstr "Apupisteiden väri" #: lazarusidestrconsts.dlggridx msgid "Grid size X" msgstr "Apupisteiden väli X" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" msgstr "Apupisteiden välinen etäisyys vaakasuunnassa" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" msgstr "Apupisteiden väli Y" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" msgstr "Apupisteiden välinen etäisyys pystysuunnassa" #: lazarusidestrconsts.dlggroupcodeexplorer msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" msgid "Code Explorer" msgstr "Koodin tutkija" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" msgstr "" #: lazarusidestrconsts.dlggroupdebugger msgctxt "lazarusidestrconsts.dlggroupdebugger" msgid "Debugger" msgstr "Virheenjäljitin" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" msgstr "Editori" #: lazarusidestrconsts.dlggroupenvironment msgctxt "lazarusidestrconsts.dlggroupenvironment" msgid "Environment" msgstr "Käyttöympäristö" #: lazarusidestrconsts.dlggrouphelp msgctxt "lazarusidestrconsts.dlggrouphelp" msgid "Help" msgstr "Ohje" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" msgstr "Kumoa ryhmänä" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" msgstr "Näytä kohdistusviivat" #: lazarusidestrconsts.dlggutter msgctxt "lazarusidestrconsts.dlggutter" msgid "Gutter" msgstr "Reunapalkki" #: lazarusidestrconsts.dlgguttercollapsedcolor msgid "Collapsed" msgstr "Supistettu" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" msgstr "Reunapalkin väri" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" msgstr "Reunapalkin reunan väri" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" msgstr "Reunapalkin erottimen indeksi" #: lazarusidestrconsts.dlggutterwidth msgid "Gutter width" msgstr "Reunapalkin leveys" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" msgstr "Vain puolen sivun liikutus (scrollaus) (PageUp- & PageDown-näppäimillä)" #: lazarusidestrconsts.dlgheapsize msgid "Heap Size" msgstr "" #: lazarusidestrconsts.dlgheightpos msgid "Height:" msgstr "Korkeus:" #: lazarusidestrconsts.dlghideideonrun msgid "Hide IDE windows on run" msgstr "Pienennä kehitysympäristön ikkunat ohjelmaa suoritettaessa" #: lazarusidestrconsts.dlghidemessagesicons msgid "Hide Messages Icons" msgstr "Piilota viestin kuvakkeet" #: lazarusidestrconsts.dlghidesingletabinnotebook msgid "Hide tab in single page windows" msgstr "Piilota välilehti yksisivuisista ikkunoista" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" msgstr "Korostusväri" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" msgstr "Korostuksen fontin väri" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Cursor" msgstr "Vasemmalla kursorista" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Cursor" msgstr "Oikealla kursorista" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" msgstr "" #: lazarusidestrconsts.dlghintsunused msgid "Show Hints for unused units in main source" msgstr "" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "Home-näppäin siirtyy koodirivin alkuun sisennykset huomioiden" #: lazarusidestrconsts.dlghostapplication msgid "Host application" msgstr "Isäntäsovellus" #: lazarusidestrconsts.dlgidentifiercompletion msgctxt "lazarusidestrconsts.dlgidentifiercompletion" msgid "Identifier completion" msgstr "Koodin täydentäminen" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" msgstr "Tunniste-käytäntö" #: lazarusidestrconsts.dlgideoptions msgid "IDE Options" msgstr "Kehitysympäristön asetukset" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" msgstr "Ohita" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" msgstr "Ota järjestelmän muuttujat mukaan" #: lazarusidestrconsts.dlgindentcodeto msgid "Indent code to" msgstr "Sisennä koodi" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Indent and Tabs:" msgstr "Sisennys ja tabulaattorit:" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" msgstr "Metodien edellä" #: lazarusidestrconsts.dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" #: lazarusidestrconsts.dlginsertimplementation msgid "Implementation" msgstr "Toteutus" #: lazarusidestrconsts.dlginsertinterface msgid "Interface" msgstr "Rajapinta" #: lazarusidestrconsts.dlginsertsection msgid "Insert into Uses section of" msgstr "Lisää uses-lauseeseen: " #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" msgstr "Lisää välilyönti seuraavien jälkeen" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" msgstr "Lisää välilyönti ennen seuraavia (merkkejä)" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" msgstr "" #: lazarusidestrconsts.dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Hyppely (esim. metodeihin)" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep cursor X position" msgstr "Säilytä kursorin X-koordinaatti" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" msgstr "Näppäinkomennot" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" msgstr "Näppäinkartan virheet" #: lazarusidestrconsts.dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "Näppäinkartan ehdotelma" #: lazarusidestrconsts.dlgkeywordpolicy msgid "Keyword policy" msgstr "" #: lazarusidestrconsts.dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Salli LABEL ja GOTO" #: lazarusidestrconsts.dlglang msgctxt "lazarusidestrconsts.dlglang" msgid "Language" msgstr "Kieli" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" msgstr "Viimeinen (kuten lähdekoodin lopussa)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Lazarus:n kansio (oletuksena kaikissa projekteissa)" #: lazarusidestrconsts.dlgleftpos msgid "Left:" msgstr "Vasemmalta:" #: lazarusidestrconsts.dlglefttopclr msgid "Guid lines Left,Top" msgstr "Ohjausviivat vasemmalla ja ylhäällä" #: lazarusidestrconsts.dlglevel1opt msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts.dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts.dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts.dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" msgstr "Taso 0 (Ei optimointia)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" msgstr "Rivin katkaisu" #: lazarusidestrconsts.dlglinklibraries msgid "Link Style" msgstr "" #: lazarusidestrconsts.dlglinksmart msgid "Link Smart" msgstr "" #: lazarusidestrconsts.dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" msgstr "" #: lazarusidestrconsts.dlgloaddfile msgid "Load desktop settings from file" msgstr "Lue työpöytäasetukset tiedostosta" #: lazarusidestrconsts.dlgmainmenu msgid "Main Menu" msgstr "Päävalikko" #: lazarusidestrconsts.dlgmainviewforms msgid "View project forms" msgstr "Näytä projektin lomakkeet" #: lazarusidestrconsts.dlgmainviewframes msgid "View project frames" msgstr "Näytä projektin kehykset" #: lazarusidestrconsts.dlgmainviewunits msgid "View project units" msgstr "Näytä projektin käännösyksiköt" #: lazarusidestrconsts.dlgmakepath msgid "Make path" msgstr "Make -ohjelman hakupolku" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" msgstr "Marginaali ja reunapalkki" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" msgstr "Merkattu väri" #: lazarusidestrconsts.dlgmarkupgroup msgid "Word under Caret Highlight" msgstr "Tekstikursorin kohdalla olevan sanan korostus" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Match word boundaries for words up to this length:" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore Keywords" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable Timer for Markup Current Word" msgstr "" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim Spaces (when highlighting current selection)" msgstr "" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" msgstr "Suurin laskijanumero" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" msgstr "Suurin rivinpituus:" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" msgstr "Tallessa pidettävien viimeiseksi käytettyjen tiedostojen nimien lukumäärä" #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" msgstr "Tallessa pidettävien viimeiseksi käytettyjen projektien lukumäärä" #: lazarusidestrconsts.dlgmethodinspolicy msgid "Method insert policy" msgstr "Metodien lisäystapa" #: lazarusidestrconsts.dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "Sekoita metodeja ja ominaisuuksia" #: lazarusidestrconsts.dlgmousefoldbutton msgctxt "lazarusidestrconsts.dlgmousefoldbutton" msgid "Button" msgstr "Painike" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft" msgid "Left" msgstr "Vasen" #: lazarusidestrconsts.dlgmousefoldbuttonmiddle msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle" msgid "Middle" msgstr "Keskimmäinen" #: lazarusidestrconsts.dlgmousefoldbuttonright msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright" msgid "Right" msgstr "Oikea" #: lazarusidestrconsts.dlgmousefoldcolfoldall msgid "Fold All (Some Colapsed)" msgstr "Laskosta kaikki (osa taitettuna(?))" #: lazarusidestrconsts.dlgmousefoldcolfoldone msgid "Fold One (Some Colapsed)" msgstr "Laskosta yksi (osa taitettuna(?))" #: lazarusidestrconsts.dlgmousefoldcolunfoldall msgid "Unfold All (Some Colapsed)" msgstr "Poista laskostus kaikkialta (osa taitettuna(?))" #: lazarusidestrconsts.dlgmousefoldcolunfoldone msgid "Unfold One (Some Colapsed)" msgstr "Poista laskostus yhdeltä (osa taitettuna(?))" #: lazarusidestrconsts.dlgmousefoldenabled msgctxt "lazarusidestrconsts.dlgmousefoldenabled" msgid "Enabled" msgstr "Sallittu" #: lazarusidestrconsts.dlgmousefoldexpfoldall msgid "Fold All (All Expanded)" msgstr "Laskosta kaikki (kaikki laajennettuna(?))" #: lazarusidestrconsts.dlgmousefoldexpfoldone msgid "Fold One (All Expanded)" msgstr "Laskosta yksi (kaikki laajennettuna(?))" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" msgstr "Asetus 1" #: lazarusidestrconsts.dlgmousefoldgroup2 msgid "Setting 2" msgstr "Asetus 2" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt" msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifierctrl msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl" msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifiershift msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift" msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" msgstr "Hiiri:" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn2 msgid "Double" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn3 msgid "Triple" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn4 msgid "Quad" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnadd msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd" msgid "Add" msgstr "Lisää" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" msgstr "Mikä vaan" #: lazarusidestrconsts.dlgmouseoptbtncancel msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.dlgmouseoptbtndel msgctxt "lazarusidestrconsts.dlgmouseoptbtndel" msgid "Delete" msgstr "Poista" #: lazarusidestrconsts.dlgmouseoptbtndown msgctxt "lazarusidestrconsts.dlgmouseoptbtndown" msgid "Down" msgstr "Alas" #: lazarusidestrconsts.dlgmouseoptbtnexport msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport" msgid "Export" msgstr "Vie" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgid "Extra 1" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgid "Extra 2" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnimport msgctxt "lazarusidestrconsts.dlgmouseoptbtnimport" msgid "Import" msgstr "Tuo" #: lazarusidestrconsts.dlgmouseoptbtnleft msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" msgid "Left" msgstr "Vasen" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" msgid "Middle" msgstr "Keskimmäinen" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnok msgctxt "lazarusidestrconsts.dlgmouseoptbtnok" msgid "OK" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnright msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" msgid "Right" msgstr "Oikea" #: lazarusidestrconsts.dlgmouseoptbtnudp msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp" msgid "Change" msgstr "Muuta" #: lazarusidestrconsts.dlgmouseoptbtnup msgctxt "lazarusidestrconsts.dlgmouseoptbtnup" msgid "Up" msgstr "Ylös" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" msgstr "" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" msgstr "Siirrä tekstikursoria (extra)" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" msgstr "Toimi nostettaessa hiiren nappi" #: lazarusidestrconsts.dlgmouseoptdescaction msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" msgid "Action" msgstr "Toiminta" #: lazarusidestrconsts.dlgmouseoptdescbutton msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" msgstr "" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadalt msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadbtn msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" msgid "Button" msgstr "Painike" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcontext msgid "Context" msgstr "Asiayhteys" #: lazarusidestrconsts.dlgmouseoptheadcount msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadctrl msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmouseoptheaddesc msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" msgid "Action" msgstr "Toiminta" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" msgstr "Ylös/Alas" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" msgstr "Optio" #: lazarusidestrconsts.dlgmouseoptheadorder msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" msgid "Order" msgstr "Järjestys" #: lazarusidestrconsts.dlgmouseoptheadpriority msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadshift msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmouseoptions msgctxt "lazarusidestrconsts.dlgmouseoptions" msgid "Mouse" msgstr "Hiiri" #: lazarusidestrconsts.dlgmouseoptionsadv msgid "Advanced" msgstr "Edistynyt" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" msgstr "kehitysympäristön komento" #: lazarusidestrconsts.dlgmouseoptmodalt msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodctrl msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodshift msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutter msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" msgid "Gutter" msgstr "Reunapalkki" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" msgstr "Laskosta puu" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" msgstr "Supistettu [+]" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" msgstr "Laajennettu [-]" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" msgstr "Rivinumerot" #: lazarusidestrconsts.dlgmouseoptnodemain msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" msgid "Text" msgstr "Teksti" #: lazarusidestrconsts.dlgmouseoptnodeselect msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" msgid "Selection" msgstr "Valinta" #: lazarusidestrconsts.dlgmouseoptotheract msgid "Other actions using the same button" msgstr "Muut toiminnot jotka käyttävät samaa nappia" #: lazarusidestrconsts.dlgmouseoptotheracthint msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." msgstr "" #: lazarusidestrconsts.dlgmouseoptotheracttoggle msgid "Filter Mod-Keys" msgstr "" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" msgid "Priority" msgstr "Ensisijaisuus" #: lazarusidestrconsts.dlgmsgs msgctxt "lazarusidestrconsts.dlgmsgs" msgid "Messages" msgstr "Viestit" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" msgstr "Monivalinta" #: lazarusidestrconsts.dlgmultiwinaccessgroup msgid "Find editor for jump targets:" msgstr "Etsi hyppykohteen editori:" #: lazarusidestrconsts.dlgmultiwinaccessorder msgid "Order to use for editors matching the same criteria" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccessorderedit msgid "Most recent focused editor for this file" msgstr "Tämän tiedoston viimeisin aktiivinen editori" #: lazarusidestrconsts.dlgmultiwinaccessorderwin msgid "Editor (for file) in most recent focused window" msgstr "" #: lazarusidestrconsts.dlgmultiwinaccesstype msgid "Priority list of criteria to choose an editor:" msgstr "" #: lazarusidestrconsts.dlgmultiwinoptions msgid "Pages and Windows" msgstr "Välilehdet ja ikkunat" #: lazarusidestrconsts.dlgmultiwintabgroup msgid "Notebook Tabs:" msgstr "Lähdekoodieditorin välilehdet:" #: lazarusidestrconsts.dlgnaming msgid "Naming" msgstr "Nimeäminen" #: lazarusidestrconsts.dlgnoautomaticrenaming msgid "No automatic renaming" msgstr "Ei automaattista uudelleen nimeämistä" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" msgstr "Ei korostusta" #: lazarusidestrconsts.dlgnotebooktabpos msgid "Source notebook tabs position" msgstr "Lähdekoodieditorin välilehtien paikka" #: lazarusidestrconsts.dlgnotebooktabposbottom msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom" msgid "Bottom" msgstr "Alhaalla" #: lazarusidestrconsts.dlgnotebooktabposleft msgctxt "lazarusidestrconsts.dlgnotebooktabposleft" msgid "Left" msgstr "Vasemmalla" #: lazarusidestrconsts.dlgnotebooktabposright msgctxt "lazarusidestrconsts.dlgnotebooktabposright" msgid "Right" msgstr "Oikealla" #: lazarusidestrconsts.dlgnotebooktabpostop msgctxt "lazarusidestrconsts.dlgnotebooktabpostop" msgid "Top" msgstr "Ylhäällä" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" msgstr "Riviä ei katkaista kun sitä edellä oli:" #: lazarusidestrconsts.dlgnotsplitlinefront msgid "Do not split line In front of:" msgstr "Riviä ei katkaista kun sitä seuraa:" #: lazarusidestrconsts.dlgobjinsp msgctxt "lazarusidestrconsts.dlgobjinsp" msgid "Object Inspector" msgstr "" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height" msgstr "Rivin korkeus" #: lazarusidestrconsts.dlgoimiscellaneous msgctxt "lazarusidestrconsts.dlgoimiscellaneous" msgid "Miscellaneous" msgstr "Muut" #: lazarusidestrconsts.dlgoioptions msgctxt "lazarusidestrconsts.dlgoioptions" msgid "Options" msgstr "Optiot" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" msgstr "Nopeus asetukset" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" msgstr "Käytä Delphin oletusasetuksia" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" msgstr "Käytä Lazaruksen oletusasetuksia" #: lazarusidestrconsts.dlgoptimiz #, fuzzy #| msgid "Optimizations:" msgid "Optimizations" msgstr "Optimoinnit:" #: lazarusidestrconsts.dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "" #: lazarusidestrconsts.dlgoverwriteblock msgid "Overwrite Block" msgstr "" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" msgstr "Vihjetekstit komponenttipaletille" #: lazarusidestrconsts.dlgpasext msgid "Default pascal extension" msgstr "Oletuksena käytettävä Pascal-kielen tiedostopääte" #: lazarusidestrconsts.dlgpasextkeywords msgid "Highlight control statements as keywords" msgstr "Korosta ohjauskäskyt avainsanoina" #: lazarusidestrconsts.dlgpasextkeywordsgroup msgid "Extended Pascal keyword options" msgstr "" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" msgstr "" #: lazarusidestrconsts.dlgpasstringkeywords msgid "Highlight String keyword(s)" msgstr "Korosta String avainsana(t)" #: lazarusidestrconsts.dlgpasstringkeywordsoptdefault msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" msgid "Default" msgstr "Oletus" #: lazarusidestrconsts.dlgpasstringkeywordsoptnone msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" msgid "None" msgstr "Ei yhtään" #: lazarusidestrconsts.dlgpasstringkeywordsoptstring msgid "Only \"String\"" msgstr "" #: lazarusidestrconsts.dlgpersistentblock msgid "Persistent Block" msgstr "" #: lazarusidestrconsts.dlgpersistentcursor msgid "Persistent cursor" msgstr "" #: lazarusidestrconsts.dlgpldpackagegroup msgid "Package group" msgstr "" #: lazarusidestrconsts.dlgpoapplication msgid "Application" msgstr "Sovellus" #: lazarusidestrconsts.dlgpoclearicon msgid "Clear Icon" msgstr "Poista kuvake" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" msgstr "" #: lazarusidestrconsts.dlgpodpiaware msgid "Dpi Aware application (for Vista+)" msgstr "" #: lazarusidestrconsts.dlgpofroms msgid "Forms" msgstr "Lomakkeet" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" msgstr "" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" msgstr "Kuvake:" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" msgstr "" #: lazarusidestrconsts.dlgpoicondescnone msgctxt "lazarusidestrconsts.dlgpoicondescnone" msgid "(none)" msgstr "" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" msgstr "Tuo kuvake" #: lazarusidestrconsts.dlgpomisc msgctxt "lazarusidestrconsts.dlgpomisc" msgid "Miscellaneous" msgstr "Muut" #: lazarusidestrconsts.dlgpooutputsettings msgid "Output Settings" msgstr "Sovelluksen tiedostoasetukset" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" msgstr "Tallenna kuvake" #: lazarusidestrconsts.dlgposavesession msgid "Session" msgstr "" #: lazarusidestrconsts.dlgpotargetfilename msgid "Target file name:" msgstr "Tehtävän sovelluksen tiedostonimi:" #: lazarusidestrconsts.dlgpotitle msgid "Title:" msgstr "Nimi:" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" msgstr "" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest file to enable themes (Windows only)" msgstr "" #: lazarusidestrconsts.dlgprojectoptions msgid "Project Options" msgstr "Projektikohtaiset asetukset" #: lazarusidestrconsts.dlgprojectoptionsfor msgid "Options for Project: %s" msgstr "Projektin %s asetukset" #: lazarusidestrconsts.dlgprojfiles msgid "Project files" msgstr "Projektin tiedostot" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt On Replace" msgstr "Vahvista muutokset" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" msgstr "Ominaisuuksien täydennys" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" msgstr "Ominaisuuden nimi" #: lazarusidestrconsts.dlgqautoclosecompiledialog msgid "Auto close compile dialog" msgstr "Suljetaan käännösikkuna kääntämisen jälkeen" #: lazarusidestrconsts.dlgqopenlastprj msgid "Open last project at start" msgstr "Avaa viimeksi käsitelty projekti Lazaruksen käynnistyessä" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" msgstr "Näytä reuna-alue" #: lazarusidestrconsts.dlgqshowcompiledialog msgid "Show compile dialog" msgstr "Näytä käännösikkuna" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" msgstr "Näytä apupisteet" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" msgstr "Sijoitu apupisteiden avulla" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" msgstr "Viittaus" #: lazarusidestrconsts.dlgregularexpressions #, fuzzy #| msgid "&Regular Expressions" msgid "Regular E&xpressions" msgstr "Säännölliset lausekkeet" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" msgstr "Korvaa kaikki" #: lazarusidestrconsts.dlgreplacewith msgid "&Replace With" msgstr "Korvaava" #: lazarusidestrconsts.dlgreport msgid "Report" msgstr "Raportti" #: lazarusidestrconsts.dlgrightbottomclr msgid "Guide lines Right,Bottom" msgstr "Ohjausviivat oikealla ja alhaalla" #: lazarusidestrconsts.dlgrightclickselects msgid "Right Click selects" msgstr "Valinta voidaan tehdä hiiren oikean näppäimellä" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" msgstr "Oikea marginaaliviiva" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" msgstr "Työhakemisto" #: lazarusidestrconsts.dlgrubberbandselectsgrandchildren msgid "Select grandchildren" msgstr "Valitse lapsenlapset" #: lazarusidestrconsts.dlgruberbandcreationcolor msgid "Rubberband Creation" msgstr "Kuminauhojen luonti" #: lazarusidestrconsts.dlgruberbandselectioncolor msgid "Rubberband Selection" msgstr "Kuminauhojen valinta" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Näyttö (ei win32:lle, esim. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts.dlgrunoenvironment msgctxt "lazarusidestrconsts.dlgrunoenvironment" msgid "Environment" msgstr "Käyttöympäristö" #: lazarusidestrconsts.dlgrunolocal msgid "Local" msgstr "Paikalliset" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" msgstr "Järjestelmän muuttujat" #: lazarusidestrconsts.dlgrunousedisplay msgid "Use display" msgstr "Käytä näyttöä" #: lazarusidestrconsts.dlgrunouseroverrides msgid "User overrides" msgstr "Käyttäjän määrittelemät" #: lazarusidestrconsts.dlgrunovalue msgctxt "lazarusidestrconsts.dlgrunovalue" msgid "Value" msgstr "Arvo" #: lazarusidestrconsts.dlgrunovariable msgid "Variable" msgstr "Muuttuja" #: lazarusidestrconsts.dlgrunparameters msgid "Run parameters" msgstr "Suoritusaikaiset parametrit" #: lazarusidestrconsts.dlgsavedfile msgid "Save desktop settings to file" msgstr "Tallenna työpöytäasetukset tiedostoon" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" msgstr "Tallennettu rivi" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "Tallenna editorin tiedot suljetusta tiedostosta" #: lazarusidestrconsts.dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "Tallenna editorin tiedot vain projektin tiedostoista" #: lazarusidestrconsts.dlgscope msgid "Scope" msgstr "Ulottuvuus" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" msgstr "" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling:" msgstr "" #: lazarusidestrconsts.dlgscrollhint msgctxt "lazarusidestrconsts.dlgscrollhint" msgid "Show scroll hint" msgstr "" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" msgstr "Vieritä tiedostoa sen lopun yli" #: lazarusidestrconsts.dlgscrollpastendline msgid "Caret past end of line" msgstr "Kursori liikkuu yli rivin lopun" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." msgstr "Etsittävää hakemistoa \"%s\" ei löydy." #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." msgstr "Käyttäjä keskeytti hakemisen" #: lazarusidestrconsts.dlgsearchcaption msgid "Searching ..." msgstr "Etsitään ..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" msgstr "Hakupolut" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected Text" msgstr "Valittu teksti" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" msgstr "" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" msgstr "" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" msgstr "Aseta ominaisuusmuuttuja (?)" #: lazarusidestrconsts.dlgshowcaps msgid "Show component captions" msgstr "Näytä komponenttien nimet vihjeessä" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "" #: lazarusidestrconsts.dlgshowcompileroptions msgid "Show compiler options" msgstr "" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" msgid "Show line numbers" msgstr "" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" msgstr "" #: lazarusidestrconsts.dlgshowdebuginfo msgid "Show debug info" msgstr "" #: lazarusidestrconsts.dlgshowdefinedmacros msgid "Show defined macros" msgstr "Näytä määritellyt makrot" #: lazarusidestrconsts.dlgshowedrhints msgid "Show editor hints" msgstr "Näytä editointivihjeet" #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" msgstr "Näytä kaikki (hidas)" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "" #: lazarusidestrconsts.dlgshowgeneralinfo msgid "Show general info" msgstr "Näytä yleistä tietoa" #: lazarusidestrconsts.dlgshowgutterhints msgid "Show gutter hints" msgstr "Näytä reunapalkin vihjeet" #: lazarusidestrconsts.dlgshowhint msgid "Show Hints" msgstr "Näytä vihjeet" #: lazarusidestrconsts.dlgshowlinenumbers msgctxt "lazarusidestrconsts.dlgshowlinenumbers" msgid "Show line numbers" msgstr "Näytä rivinumerot" #: lazarusidestrconsts.dlgshownotes msgid "Show Notes" msgstr "Näytä muistutukset" #: lazarusidestrconsts.dlgshownothing msgid "Show nothing (only errors)" msgstr "Näytä ainoastaan virheet" #: lazarusidestrconsts.dlgshowprocserror msgid "Show all procs on error" msgstr "" #: lazarusidestrconsts.dlgshowscrollhint msgctxt "lazarusidestrconsts.dlgshowscrollhint" msgid "Show scroll hint" msgstr "" #: lazarusidestrconsts.dlgshowsummary msgid "Show summary" msgstr "Näytä yhteenveto" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" msgstr "" #: lazarusidestrconsts.dlgshowusedfiles msgid "Show used files" msgstr "" #: lazarusidestrconsts.dlgshowwarnings msgid "Show Warnings" msgstr "Näytä varoitukset" #: lazarusidestrconsts.dlgsingletaskbarbutton msgid "Show single button in TaskBar" msgstr "" #: lazarusidestrconsts.dlgskipforwardclassdeclarations msgid "Skip forward class declarations" msgstr "" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" msgstr "Älykäs tabulointi" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Varmistustiedoston symboli tiedoston tarkenteen loppuun (.pp~)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Lisätään laskijanumero (.pp;1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Varmistustiedoston symboli tiedoston tarkenteen eteen (.~pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Kiinnity kohdistusviivojen avulla" #: lazarusidestrconsts.dlgspacenotcosmos msgctxt "lazarusidestrconsts.dlgspacenotcosmos" msgid "Space" msgstr "Välilyönnit" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "Vihjetekstit työkalupainikkeille" #: lazarusidestrconsts.dlgsrcedit msgctxt "lazarusidestrconsts.dlgsrcedit" msgid "Source Editor" msgstr "Lähdekoodieditori" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" msgstr "Lähtöpiste" #: lazarusidestrconsts.dlgstatickeyword msgid "Static Keyword in Objects" msgstr "" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Pysäytä virhemäärän jälkeen:" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" msgstr "Aliominaisuudet" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" msgstr "Kieliopin optiot" #: lazarusidestrconsts.dlgtabindent msgid "Tab indents blocks" msgstr "Tabulaattori sisentää lohkoa" #: lazarusidestrconsts.dlgtabnumbersnotebook msgid "Show tab numbers in notebook" msgstr "Näytä välilehtien numerot lähdekoodieditorissa" #: lazarusidestrconsts.dlgtabstospaces msgid "Tabs to spaces" msgstr "Tabuloinnit välilyönneiksi" #: lazarusidestrconsts.dlgtabwidths msgctxt "lazarusidestrconsts.dlgtabwidths" msgid "Tab widths" msgstr "Tabuloinnin leveydet" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" msgstr "Kohde CPU perhe" #: lazarusidestrconsts.dlgtargetos msgctxt "lazarusidestrconsts.dlgtargetos" msgid "Target OS" msgstr "Kohde käyttis" #: lazarusidestrconsts.dlgtargetplatform #, fuzzy #| msgid "Target Platform:" msgid "Target Platform" msgstr "Kohdealusta:" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" msgstr "Kohde prosessori" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" msgstr "Kansio jossa käännetään testiprojektit" #: lazarusidestrconsts.dlgtexttofind msgctxt "lazarusidestrconsts.dlgtexttofind" msgid "&Text to Find" msgstr "Etsittävä" #: lazarusidestrconsts.dlgthedirectory msgid "The directory \"" msgstr "" #: lazarusidestrconsts.dlgtimesecondunit msgid "sec" msgstr "" #: lazarusidestrconsts.dlgtooltipeval msgid "Tooltip expression evaluation" msgstr "" #: lazarusidestrconsts.dlgtooltiptools msgid "Tooltip symbol Tools" msgstr "" #: lazarusidestrconsts.dlgtoppos msgid "Top:" msgstr "Ylhäältä:" #: lazarusidestrconsts.dlgtplfname msgid "Template file name" msgstr "Mallitiedoston nimi" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim Spaces Style" msgstr "Välilyöntien siistimistyyli" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" msgstr "Riviä muokattu" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" msgstr "Jätä rivi" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" msgstr "Vain sijainti" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Poista turhat välilyönnit rivinlopusta" #: lazarusidestrconsts.dlguncertopt msgid "Uncertain Optimizations" msgstr "Epävarmat optimoinnit" #: lazarusidestrconsts.dlgundoaftersave msgid "Undo after save" msgstr "Kumoa talletuksen jälkeen" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo:" msgstr "Kumoa / Palauta uudelleen" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" msgstr "Kumoamisen rajat" #: lazarusidestrconsts.dlgunitdepbrowse msgctxt "lazarusidestrconsts.dlgunitdepbrowse" msgid "Open" msgstr "Avaa" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" msgstr "Käännösyksikön riippuvuudet" #: lazarusidestrconsts.dlgunitdeprefresh msgctxt "lazarusidestrconsts.dlgunitdeprefresh" msgid "Refresh" msgstr "Päivitä" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" msgstr "" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" msgstr "Tallentamaton rivi" #: lazarusidestrconsts.dlgupword msgctxt "lazarusidestrconsts.dlgupword" msgid "Up" msgstr "Ylös" #: lazarusidestrconsts.dlgusecodefolding msgid "Code folding" msgstr "Koodin laskostus" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional Compiler Config File" msgstr "" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider drawing" msgstr "" #: lazarusidestrconsts.dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "" #: lazarusidestrconsts.dlguselaunchingapp msgid "Use launching application" msgstr "Käytä käynnistävää ohjelmaa" #: lazarusidestrconsts.dlgusemsgfile msgid "Use messages file" msgstr "Käytä viestitiedostoa" #: lazarusidestrconsts.dlguserschemeerror msgid "Failed to load user-scheme file %s" msgstr "" #: lazarusidestrconsts.dlguseschemedefaults msgid "Use (and edit) global scheme settings" msgstr "" #: lazarusidestrconsts.dlguseschemelocal msgid "Use local scheme settings" msgstr "" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Käytä syntaksin korostusta" #: lazarusidestrconsts.dlgusetabshistory msgid "Use tab history when closing tabs" msgstr "" #: lazarusidestrconsts.dlguseunitcaption msgid "Add unit to Uses section" msgstr "" #: lazarusidestrconsts.dlgvaluecolor msgctxt "lazarusidestrconsts.dlgvaluecolor" msgid "Value" msgstr "Arvo" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" msgstr "" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" msgstr "Reunapalkki näkyy" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" msgstr "Oikea marginaali näkyy" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole Words Only" msgstr "Etsi vain kokonaisia sanoja" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" msgstr "Leveys:" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" msgstr "" #: lazarusidestrconsts.dlgwindow msgctxt "lazarusidestrconsts.dlgwindow" msgid "Window" msgstr "Ikkuna" #: lazarusidestrconsts.dlgwinpos msgid "Window Positions" msgstr "Ikkunoiden paikat" #: lazarusidestrconsts.dlgwordspolicies msgctxt "lazarusidestrconsts.dlgwordspolicies" msgid "Words" msgstr "Sanat" #: lazarusidestrconsts.dlgwrdpreview msgctxt "lazarusidestrconsts.dlgwrdpreview" msgid "Preview" msgstr "Esikatselu" #: lazarusidestrconsts.dlgwritefpclogo msgid "Write an FPC logo" msgstr "" #: lazarusidestrconsts.fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "" #: lazarusidestrconsts.fdmalignmenu msgid "Align ..." msgstr "" #: lazarusidestrconsts.fdmdeleteselection msgid "Delete Selection" msgstr "Poista valittu" #: lazarusidestrconsts.fdmmirrorhorizontal msgid "Mirror Horizontal" msgstr "" #: lazarusidestrconsts.fdmmirrorvertical msgid "Mirror Vertical" msgstr "" #: lazarusidestrconsts.fdmorder msgctxt "lazarusidestrconsts.fdmorder" msgid "Order" msgstr "Järjestys" #: lazarusidestrconsts.fdmorderbackone msgid "Back One" msgstr "Yksi taaksepäin" #: lazarusidestrconsts.fdmorderforwardone msgid "Forward One" msgstr "Yksi eteenpäin" #: lazarusidestrconsts.fdmordermovetoback msgid "Move to Back" msgstr "Siirrä taaimmaksi" #: lazarusidestrconsts.fdmordermovetofront msgid "Move to Front" msgstr "Siirrä päällimmäksi" #: lazarusidestrconsts.fdmsaveformasxml msgid "Save form as XML" msgstr "Tallenna lomake XML-tiedostona" #: lazarusidestrconsts.fdmscalemenu msgid "Scale ..." msgstr "" #: lazarusidestrconsts.fdmscaleword msgid "Scale" msgstr "Skaalaa" #: lazarusidestrconsts.fdmselectall msgctxt "lazarusidestrconsts.fdmselectall" msgid "Select All" msgstr "" #: lazarusidestrconsts.fdmsizemenu msgid "Size ..." msgstr "" #: lazarusidestrconsts.fdmsizeword msgid "Size" msgstr "Koko" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "Sijoita apupisteiden mukaan" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "Sijoita kohdistusviivojen mukaan" #: lazarusidestrconsts.fdmzorder msgid "Z-order" msgstr "" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" msgstr "" #: lazarusidestrconsts.histdlgbtnclearhint msgid "Clear all snapshots" msgstr "" #: lazarusidestrconsts.histdlgbtnenablehint msgid "Toggle view snapshot or current" msgstr "" #: lazarusidestrconsts.histdlgbtnexport msgctxt "lazarusidestrconsts.histdlgbtnexport" msgid "Export" msgstr "Vie" #: lazarusidestrconsts.histdlgbtnimport msgctxt "lazarusidestrconsts.histdlgbtnimport" msgid "Import" msgstr "Tuo" #: lazarusidestrconsts.histdlgbtnmakesnaphint msgid "Take Snapshot" msgstr "" #: lazarusidestrconsts.histdlgbtnpowerhint msgid "Switch on/off automatic snapshots" msgstr "" #: lazarusidestrconsts.histdlgbtnremovehint msgid "Remove selected entry" msgstr "" #: lazarusidestrconsts.histdlgbtnshowhisthint msgid "View history" msgstr "" #: lazarusidestrconsts.histdlgbtnshowsnaphint msgid "View Snapshots" msgstr "" #: lazarusidestrconsts.histdlgcolumnloc msgid "Location" msgstr "" #: lazarusidestrconsts.histdlgcolumntime msgid "Time" msgstr "" #: lazarusidestrconsts.histdlgformname msgctxt "lazarusidestrconsts.histdlgformname" msgid "History" msgstr "" #: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." msgstr "" #: lazarusidestrconsts.lisa2paddfile msgid "Add File" msgstr "Lisää tiedosto" #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" msgstr "Lisää tiedostot" #: lazarusidestrconsts.lisa2paddfilestopackage msgid "Add files to package" msgstr "Lisää nämä tiedostot pakettiin" #: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" msgstr "Lisää LFM, LRS tiedostot, jos niitä on" #: lazarusidestrconsts.lisa2paddtopackage msgid "Add to package" msgstr "Lisää komponenttipakettiin" #: lazarusidestrconsts.lisa2paddunit msgid "Add Unit" msgstr "Lisää käännösyksikkö" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "" #: lazarusidestrconsts.lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "" #: lazarusidestrconsts.lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "" #: lazarusidestrconsts.lisa2pancestortype msgid "Ancestor Type" msgstr "" #: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "" #: lazarusidestrconsts.lisa2pchooseanexistingfile msgid "" msgstr "" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "" #: lazarusidestrconsts.lisa2pcreatenewfile msgid "Create new file" msgstr "" #: lazarusidestrconsts.lisa2pdependency msgid "Dependency" msgstr "" #: lazarusidestrconsts.lisa2pexistingfile msgid "%sExisting file: %s%s%s" msgstr "" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "" #: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." msgstr "" #: lazarusidestrconsts.lisa2pfilealreadyinpackage msgid "File already in package" msgstr "" #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" msgstr "" #: lazarusidestrconsts.lisa2pfilename msgid "File name:" msgstr "Tiedoston nimi:" #: lazarusidestrconsts.lisa2pfilename2 msgid "Filename" msgstr "Tiedoston nimi" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" msgstr "Tiedosto ei ole käännösyksikkö" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "" #: lazarusidestrconsts.lisa2pinvalidcircle msgid "Invalid Circle" msgstr "" #: lazarusidestrconsts.lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "" #: lazarusidestrconsts.lisa2pinvalidfile msgid "Invalid file" msgstr "" #: lazarusidestrconsts.lisa2pinvalidfilename msgid "Invalid filename" msgstr "" #: lazarusidestrconsts.lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "" #: lazarusidestrconsts.lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." msgstr "" #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" msgstr "" #: lazarusidestrconsts.lisa2pnewcomponent msgid "New Component" msgstr "" #: lazarusidestrconsts.lisa2pnewfile msgid "New File" msgstr "" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" msgstr "" #: lazarusidestrconsts.lisa2ppalettepage msgid "Palette Page:" msgstr "" #: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" msgstr "Pascal käännösyksikön pääte on joko .pp tai .pas" #: lazarusidestrconsts.lisa2psavefiledialog msgid "Save file dialog" msgstr "" #: lazarusidestrconsts.lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Supista tai laajenna tiedostonimeä" #: lazarusidestrconsts.lisa2pshowall msgid "Show all" msgstr "Näytä kaikki" #: lazarusidestrconsts.lisa2pswitchpaths msgid "Switch Paths" msgstr "Vaihda tiedostopolkua" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgstr "" #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." msgstr "" #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "" #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." msgstr "" #: lazarusidestrconsts.lisa2punitfilename msgid "Unit file name:" msgstr "Käännösyksikön tiedostonimi:" #: lazarusidestrconsts.lisa2punitfilename2 msgid "Unit File Name:" msgstr "Käännösyksikön tiedostonimi:" #: lazarusidestrconsts.lisa2punitname msgid "Unit Name:" msgstr "Käännösyksikön nimi:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Käännösyksikön nimi on jo olemassa" #: lazarusidestrconsts.lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "Kelvoton käännösyksikön nimi" #: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" msgstr "" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" msgstr "Hylkää muutokset?" #: lazarusidestrconsts.lisabcreationfailed msgid "Error occured during Application Bundle creation: " msgstr "" #: lazarusidestrconsts.lisabortall msgid "Abort all" msgstr "Keskeytä kaikki" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" msgstr "Keskeytä kaikki lataus" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" msgstr "Keskeytä projektin lataaminen" #: lazarusidestrconsts.lisabortwholeloading msgid "Abort whole loading" msgstr "Keskeytä lataus kokonaan" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" msgstr "Dokumentaatio:" #: lazarusidestrconsts.lisaboutide msgid "About IDE" msgstr "Tietoja kehitysympäristöstä" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" msgstr "Tietoja Lazaruksesta" #: lazarusidestrconsts.lisaboutlazarusmsg msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." msgstr "Lisenssi: GPL/LGPL. Katso Lazaruksen ja Free Pascalin lähdekoodeista tarkemmat lisenssit.%sLazarus on kehitysympäristö jolla voi tehdä (graafisia ja komentorivi-) sovelluksia Free Pascalille. Free Pascal on (L)GPL-lisensoitu (mm oliopohjainen) Pascal kääntäjä joka toimii mm. Linux, Win32, OS/2, Mac OS X ja FreeBSD käyttöjärjestelmissä." #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." msgstr "Avustajaluetteloa ei löydy" #: lazarusidestrconsts.lisaboutofficial msgid "Official:" msgstr "Virallinen:" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "" #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" msgstr "Kiitokset" #: lazarusidestrconsts.lisaction msgid "Action:" msgstr "Toiminta:" #: lazarusidestrconsts.lisactions msgid "Actions:" msgstr "Toiminnat:" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Salli etsintäoperandit (mm * ja ?)" #: lazarusidestrconsts.lisactive msgid "Active" msgstr "Aktiivinen" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" msgstr "Aktiivinen suodatin" #: lazarusidestrconsts.lisadddirectory msgid "Add directory" msgstr "Lisää hakemisto" #: lazarusidestrconsts.lisaddfilesofdirectory msgid "Add files of directory" msgstr "Lisää hakemiston tiedostot" #: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Paketeilta perittyjä kääntäjän lisä-optioita" #: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom msgid "Add new build mode, copying settings from \"%s\"" msgstr "" #: lazarusidestrconsts.lisaddnewmacro msgid "Add new macro" msgstr "Lisää uusi makro" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" msgstr "" #: lazarusidestrconsts.lisaddpackagerequirement msgid "Add package requirement?" msgstr "Lisää pakettiriippuvuus?" #: lazarusidestrconsts.lisaddpackagetoproject msgid "Add package %s to project?" msgstr "Lisää paketti %s projektiin?" #: lazarusidestrconsts.lisaddpackagetoproject2 msgid "Add package to project" msgstr "Lisää paketti projektiin" #: lazarusidestrconsts.lisaddparameterbrackets msgid "Add parameter brackets" msgstr "Lisää parametrin sulkeet" #: lazarusidestrconsts.lisaddress msgid "Address:" msgstr "Osoite:" #: lazarusidestrconsts.lisaddressbreakpoint msgctxt "lazarusidestrconsts.lisaddressbreakpoint" msgid "&Address Breakpoint ..." msgstr "Osoitteeseen ..." #: lazarusidestrconsts.lisaddtoincludesearchpath msgid "Add to include search path?" msgstr "" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" msgstr "Lisätäänkö tiedosto %s projektiin?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "Lisätäänkö käännösyksikköjen hakupolkuun?" #: lazarusidestrconsts.lisaddunitinterfaces msgid "Add unit interfaces" msgstr "Lisää käännösyksikön rajapinnat" #: lazarusidestrconsts.lisaddunitnotrecommended msgid "Add unit (not recommended)" msgstr "Lisää käännösyksikkö (ei suositella)" #: lazarusidestrconsts.lisaddvalue msgid "Add value:" msgstr "Lisää arvo:" #: lazarusidestrconsts.lisaddvaluetomacro msgid "Add value to macro %s" msgstr "Lisää arvo makroon %s" #: lazarusidestrconsts.lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Lisää tiedosto pakettiin" #: lazarusidestrconsts.lisaf2pdestinationpackage msgid "Destination Package" msgstr "Kohdepaketti" #: lazarusidestrconsts.lisaf2pfiletype msgid "File Type" msgstr "Tiedoston tyyppi" #: lazarusidestrconsts.lisaf2phasregisterprocedure msgid "Has Register procedure" msgstr "Sisältää Register aliohjelman" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" msgstr "Kelvoton paketti" #: lazarusidestrconsts.lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" msgstr "Kelvoton paketin ID: %s%s%s" #: lazarusidestrconsts.lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" msgstr "Virtuaalinen käännösyksikkö (lähdekoodi ei ole paketissa)" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "Pakettia voidaan vain lukea" #: lazarusidestrconsts.lisaf2ppackagenotfound msgid "Package %s%s%s not found." msgstr "Pakettia %s%s%s ei löydy." #: lazarusidestrconsts.lisaf2pshowall msgid "Show All" msgstr "Näytä kaikki" #: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage" msgid "The file %s%s%s%sis already in the package %s." msgstr "Tiedosto %s%s%s%son jo paketissa %s." #: lazarusidestrconsts.lisaf2pthepackageisreadonly msgid "The package %s is read only." msgstr "Pakettia %s voidaan vain lukea." #: lazarusidestrconsts.lisaf2punitname msgid "Unit Name: " msgstr "Käännösyksikön nimi: " #: lazarusidestrconsts.lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? " #: lazarusidestrconsts.lisalignment msgid "Alignment" msgstr "Sijoita" #: lazarusidestrconsts.lisallblockslooksok msgid "All blocks look ok." msgstr "Kaikki lohkorakenteet vaikuttavat hyviltä." #: lazarusidestrconsts.lisallfiles msgid "All Files" msgstr "Kaikki tiedostot" #: lazarusidestrconsts.lisallinheritedoptions msgid "All inherited options" msgstr "Kaikki periytyvät asetukset" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" msgstr "Salli funktiokutsut" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Salli etsintä monelta riviltä" #: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall msgid "All parameters of this function are already set at this call. Nothing to add." msgstr "" #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened msgid "All your modifications to %s%s%s%swill be lost and the file reopened." msgstr "Kaikki muutokset tiedostoon %s%s%s%smenetetään ja se avataan uudestaan." #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" msgstr "Vaihtoehtoinen näppäin" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "Vaihtoehtoinen näppäin (tai 2 peräkkäistä yhdistelmää)" #: lazarusidestrconsts.lisalways msgid "Always" msgstr "Aina" #: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase msgid "Always convert suggested default file name to lowercase" msgstr "" #: lazarusidestrconsts.lisalwaysignore msgid "Always ignore" msgstr "" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" msgstr "Epäselvä (tai moniselitteinen) tiedosto löytyi" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgstr "" #: lazarusidestrconsts.lisambiguousfilesfound msgid "Ambiguous files found" msgstr "Epäselviä (tai moniselitteisiä) tiedostoja löytyi" #: lazarusidestrconsts.lisambiguousunitfound msgid "Ambiguous Unit found" msgstr "" #: lazarusidestrconsts.lisambiguousunitfound2 msgid "Ambiguous unit found" msgstr "Epäselvä (tai moniselitteinen) käännösyksikkö löytyi" #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "Ankkur - ei yhtään kontrollia valittuna" #: lazarusidestrconsts.lisanchorenabledhint msgid "Enabled = Include %s in Anchors" msgstr "Sallitu = ota %s mukaan ankkureihin" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "Valittujen kontrollien ankkurit" #: lazarusidestrconsts.lisanchortobottomsidekeepborderspace msgid "Anchor to bottom side of sibling, keep border space" msgstr "Ankkuroi naapurin alareunaan, säilytä reuna-alue" #: lazarusidestrconsts.lisanchortoleftsidekeepborderspace msgid "Anchor to left side of sibling, keep border space" msgstr "Ankkuroi naapurin vasempaan reunaan, säilytä reuna-alue" #: lazarusidestrconsts.lisanchortorightsidekeepborderspace msgid "Anchor to right side of sibling, keep border space" msgstr "Ankkuroi naapurin oikeaan reunaan, säilytä reuna-alue" #: lazarusidestrconsts.lisanchortotopsidekeepborderspace msgid "Anchor to top side of sibling, keep border space" msgstr "Ankkuroi naapurin yläreunaan, säilytä reuna-alue" #: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgstr "Virhe esiintyi kun avattiin projektia %s!%s%sAvataanko tämä projekti uudelleen?" #: lazarusidestrconsts.lisappendshortdescriptiontolongdescription msgid "Append short description to long description" msgstr "" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus." msgstr "Sovellus %sGraafinen LCL/Free Pascal ohjelma. Lazarus pitää yllä ohjelman koodia automaattisesti." #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" msgstr "" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "apply build flags (-B) to dependencies too" msgstr "" #: lazarusidestrconsts.lisapplyconventions msgid "Apply conventions" msgstr "" #: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects msgid "A project unit can not be used by other packages/projects" msgstr "" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "Reuna-alue kontrollin ympärillä. Muut neljä reuna-aluetta lisätään tähän arvoon." #: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." msgstr "Perus Pascal-ohjelma tiedosto.%sTämä on tarkoitettu lähinnä testaamiseen.%sYleisesti olisi parempi valita jokin uusi projekti kuten esim. sovellus." #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Varmistetaan vielä erikseen että korvataanko kyseinen kohta" #: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform msgid "Ask for component name after putting it on a designer form" msgstr "Kysytään komponentin nimi välittömästi kun se sijoitetaan suunnitteluaikana lomakkeelle (form) " #: lazarusidestrconsts.lisaskforfilenameonnewfile msgid "Ask for file name on new file" msgstr "Kysytään tiedoston nimi kun luodaan uusi tiedosto" #: lazarusidestrconsts.lisasknameoncreate msgid "Ask name on create" msgstr "Kysy komponentin nimi sitä luodessa" #: lazarusidestrconsts.lisautocompletionoff msgid "Auto completion: off" msgstr "" #: lazarusidestrconsts.lisautocompletionon msgid "Auto completion: on" msgstr "" #: lazarusidestrconsts.lisautocontinue msgid "Auto Continue" msgstr "" #: lazarusidestrconsts.lisautocontinueafter msgid "Auto continue after:" msgstr "" #: lazarusidestrconsts.lisautomarkup msgid "Markup and Matches" msgstr "" #: lazarusidestrconsts.lisautomatic msgctxt "lazarusidestrconsts.lisautomatic" msgid "Automatic" msgstr "Automaattinen" #: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles msgid "Automatically convert .lfm files to .lrs include files" msgstr "" #: lazarusidestrconsts.lisautomaticallyinvokeafterpoint msgid "Automatically invoke after point" msgstr "Tuo automaattisesti esiin pisteen jälkeen" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" msgstr "rivin vaihto" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" msgstr "välilyönti" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" msgstr "sanan loppu" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" msgstr "" #: lazarusidestrconsts.lisautomaticfeatures msgid "Completion and Hints" msgstr "Koodin täydennys ja vihjeet" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" msgstr "Näytetään automaattisesti komponenttimuokkain" #: lazarusidestrconsts.lisavailablepackages msgid "Available packages" msgstr "Käytettävissä olevat komponenttipaketit" #: lazarusidestrconsts.lisbackupchangedfiles msgid "Make backup of changed files" msgstr "Tee varmuuskopio muuttuneista tiedostoista" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" msgstr "Varmuuskopiointi epäonnistui" #: lazarusidestrconsts.lisbackuphint msgid "Creates a Backup directory under project directory" msgstr "" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "" #: lazarusidestrconsts.lisbegins msgid "begins" msgstr "alkaa" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" msgstr "" #: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" msgstr "" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always Build before Run" msgstr "Käännä aina ennen suoritusta" #: lazarusidestrconsts.lisbfbuild msgctxt "lazarusidestrconsts.lisbfbuild" msgid "Build" msgstr "Käännä (Build)" #: lazarusidestrconsts.lisbfbuildcommand msgid "Build Command" msgstr "" #: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts.lisbfrun msgctxt "lazarusidestrconsts.lisbfrun" msgid "Run" msgstr "Suorita" #: lazarusidestrconsts.lisbfruncommand msgid "Run Command" msgstr "Suorita komento" #: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor ..." msgstr "" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (Leave empty for file path)" msgstr "" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2 msgid "Working Directory (Leave empty for file path)" msgstr "" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" msgstr "Lihavoi muutetut arvot (muut kuin oletusarvot)" #: lazarusidestrconsts.lisborderspace #, fuzzy #| msgid "BorderSpace" msgid "Border space" msgstr "Reuna-alue" #: lazarusidestrconsts.lisbottom msgctxt "lazarusidestrconsts.lisbottom" msgid "Bottom" msgstr "Alhaalla" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "Alapuolen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen." #: lazarusidestrconsts.lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "Alaosan ankkurointi" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" msgstr "Alareunat" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." msgstr "Tämä on naapuri-kontrolli, mihin alareuna on ankkuroitu. Tyhjä tarkoittaa emo-kontrollia." #: lazarusidestrconsts.lisbottomspaceequally msgid "Bottom space equally" msgstr "" #: lazarusidestrconsts.lisbreak msgctxt "lazarusidestrconsts.lisbreak" msgid "Break" msgstr "Keskeytä" #: lazarusidestrconsts.lisbreakpointproperties msgid "Breakpoint Properties" msgstr "Keskeytyskohdan ominaisuudet" #: lazarusidestrconsts.lisbrowseforcompiler msgid "Browse for Compiler (%s)" msgstr "" #: lazarusidestrconsts.lisbtnbreak msgctxt "lazarusidestrconsts.lisbtnbreak" msgid "Break" msgstr "Keskeytä" #: lazarusidestrconsts.lisbtncontinue msgctxt "lazarusidestrconsts.lisbtncontinue" msgid "Continue" msgstr "Jatka" #: lazarusidestrconsts.lisbtnfind msgid "&Find" msgstr "Etsi" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" msgstr "Korvaa" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "build all files of project/package/IDE" msgstr "Käännä kaikki projektin/paketin/kehitysympäristön tiedostot" #: lazarusidestrconsts.lisbuildidewithpackages msgid "build IDE with packages" msgstr "Käännä kehitysympäristö paketteineen" #: lazarusidestrconsts.lisbuildinglazarusfailed msgid "Building Lazarus failed" msgstr "Lazaruksen käännös epäonnistui" #: lazarusidestrconsts.lisbuildmacros msgid "Build macros" msgstr "Käännösmakrot" #: lazarusidestrconsts.lisbuildmacros2 msgid "Build macros:" msgstr "Käännösmakrot:" #: lazarusidestrconsts.lisbuildmode msgid "Build mode" msgstr "" #: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes msgid "Differences between build modes" msgstr "" #: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes msgid "Differences to other build modes" msgstr "" #: lazarusidestrconsts.lisbuildmodediffmode msgid "Mode:" msgstr "" #: lazarusidestrconsts.lisbuildmodes msgid "Build modes" msgstr "" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" msgstr "" #: lazarusidestrconsts.lisbuildnumber msgid "Build Number" msgstr "" #: lazarusidestrconsts.lisbuildproject msgid "Build project" msgstr "" #: lazarusidestrconsts.liscallingtocreatemakefilefromfailed msgid "Calling %s to create Makefile from %s failed." msgstr "" #: lazarusidestrconsts.liscallstacknotevaluated msgid "Stack not evaluated" msgstr "Pinoa ei arvioitu" #: lazarusidestrconsts.liscancel msgctxt "lazarusidestrconsts.liscancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "Peru tämän komponentin lataaminen" #: lazarusidestrconsts.liscancelloadingunit msgid "Cancel loading unit" msgstr "" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" msgstr "Perutaan uudelleen nimeäminen" #: lazarusidestrconsts.liscannotcompileproject msgid "Cannot compile project" msgstr "" #: lazarusidestrconsts.liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "Päätason komponenttia ei voida kopioida" #: lazarusidestrconsts.liscannotcreatefile msgid "Can not create file %s%s%s" msgstr "" #: lazarusidestrconsts.liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" msgstr "Lazaruksen käynnistäjää:%s%s ei löydy" #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "Vain TComponent:sta periytyvän luokka voidaan vaihtaa." #: lazarusidestrconsts.liscaptiondiff msgctxt "lazarusidestrconsts.liscaptiondiff" msgid "Diff" msgstr "Eroavuudet" #: lazarusidestrconsts.liscbpfiles msgid "%s (%s files)" msgstr "" #: lazarusidestrconsts.liscbpreallydeletesourcefiles msgid "Really delete %s source files%s%s" msgstr "" #: lazarusidestrconsts.lisccdchangeclassof msgid "Change Class of %s" msgstr "Vaihda %s:n luokka" #: lazarusidestrconsts.lisccdnoclass msgid "no class" msgstr "ei luokkaa" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "Moniselitteinen kääntäjä" #: lazarusidestrconsts.lisccochecktestdir msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" msgstr "Tarkista Test hakemisto kohdasta %sTools -> Options -> Files -> Directory for building test projects" #: lazarusidestrconsts.lisccocompilernotanexe msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "Kääntäjä \"%s\" ei ole suoritettava ohjelma.%sYksityiskohdat: %s" #: lazarusidestrconsts.lisccocontains msgid "contains " msgstr "sisältää " #: lazarusidestrconsts.lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "Kopioi tuloste leikepöydälle" #: lazarusidestrconsts.lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "FPC:n .ppu tiedostojen aikaleimat eroavat yli tunnilla.%sSe voi tarkoittaa, että ne ovat kahdesta eri asennuksesta.%sTiedosto1: %s%sTiedosto2: %s" #: lazarusidestrconsts.lisccoenglishmessagefilemissing msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg" msgstr "englanninkielinen FPC:n viestitiedosto puuttuu:components/codetools/fpc.errore.msg" #: lazarusidestrconsts.lisccoerrorcaption msgctxt "lazarusidestrconsts.lisccoerrorcaption" msgid "Error" msgstr "Virhe" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " msgstr "" #: lazarusidestrconsts.lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "FPC:n käännösyksikköjen polku sisältää lähdekoodia: " #: lazarusidestrconsts.lisccohasnewline msgid "new line symbols" msgstr "rivinvaihtosymbolit" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " msgstr "VIHJE:" #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" msgstr "Kelvoton kääntäjä:" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" msgstr "Kelvoton hakupolku" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "Kelvoton testihakemisto" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" msgstr "Puuttuva käännösyksikkö" #: lazarusidestrconsts.lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" msgstr "FPC käännösyksikköä: %s.ppu ei löydy käännettynä" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "Löytyi monta kääntäjän asetusta:" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" msgstr "fpc.cfg ei löydy" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" msgstr "ei ole ASCII" #: lazarusidestrconsts.lisccoppuexiststwice msgid "ppu exists twice: %s, %s" msgstr "ppu löytyy kahdesta paikasta: %s, %s" #: lazarusidestrconsts.lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." msgstr "FPC käännösyksikköä: %s.ppu ei löydy käännettynä.%sSe tavallisesti tarkoittaa että tiedostossa fpc.cfg on virhe tai FPC:n asennus on rikki." #: lazarusidestrconsts.lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "Löytyi itse kääntäjää vanhempi .ppu tiedosto:%s%s" #: lazarusidestrconsts.lisccorelunitpathfoundincfg msgid "relative unit path found in fpc cfg: %s" msgstr "suhteellinen käännösyksikköjen polku löytyi FPC:n asetuksista: %s" #: lazarusidestrconsts.lisccoseveralcompilers #, fuzzy #| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "Polussa on monta Free Pascal kääntäjää.%s%s%sEhkä unohdit poistaa vanhan kääntäjän?" #: lazarusidestrconsts.lisccoskip msgid "Skip" msgstr "Ohita" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" msgstr "erikoismerkit" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." msgstr "Kaikki testit menivät läpi." #: lazarusidestrconsts.lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "Testitiedoston luonti ei onnistu" #: lazarusidestrconsts.lisccounabletocreatetestpascalfile msgid "Unable to create Test pascal file \"%s\"." msgstr "Pascal testitiedoston \"%s\" luonti ei onnistu." #: lazarusidestrconsts.lisccounabletogetfiledate msgid "Unable to get file date of %s." msgstr "Tiedoston %s aikaleiman lukeminen ei onnistu." #: lazarusidestrconsts.lisccounusualchars msgid "unusual characters" msgstr "epätavallisia merkkejä" #: lazarusidestrconsts.lisccowarningcaption msgid "Warning" msgstr "Varoitus" #: lazarusidestrconsts.lisccowarningmsg msgid "WARNING: " msgstr "VAROITUS:" #: lazarusidestrconsts.lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "Väärä polkuerotin" #: lazarusidestrconsts.liscecategories msgid "Categories" msgstr "Ryhmät" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" msgstr "Monimutkaisuus" #: lazarusidestrconsts.lisceconstants msgid "Constants" msgstr "Vakiot" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" msgstr "Tyhjät lohkot" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" msgstr "Luokkien tyhjät alueet" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" msgstr "Tyhjät rakenteet" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" msgstr "Tyhjät aliohjelmat" #: lazarusidestrconsts.liscefilter msgid "(Filter)" msgstr "(Suodatin)" #: lazarusidestrconsts.liscefollowcursor msgid "Follow cursor" msgstr "Seuraa kursoria" #: lazarusidestrconsts.liscein msgctxt "lazarusidestrconsts.liscein" msgid "%s in %s" msgstr "" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" msgstr "On juuri-kontrolli" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" msgstr "" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" msgstr "" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" msgstr "" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" msgstr "" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" msgstr "" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" msgstr "Keskitä kontrolli vaakatasossa suhteessa annettuun naapuriin" #: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling" msgstr "Keskitä kontrolli pystytasossa suhteessa annettuun naapuriin" #: lazarusidestrconsts.liscenterform msgid "Center form" msgstr "Keskitä lomake" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" msgstr "Keskelle ikkunaa" #: lazarusidestrconsts.liscenters msgid "Centers" msgstr "Keskilinjat" #: lazarusidestrconsts.lisceomode msgid "Preferred Exhibition Mode" msgstr "" #: lazarusidestrconsts.lisceomodecategory msgctxt "lazarusidestrconsts.lisceomodecategory" msgid "Category" msgstr "" #: lazarusidestrconsts.lisceomodesource msgctxt "lazarusidestrconsts.lisceomodesource" msgid "Source" msgstr "" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" msgstr "Ei koskaan automaattisesti. Ainoastaan erikseen käskettäessä." #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "" #: lazarusidestrconsts.lisceoonidle msgid "On idle" msgstr "" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" msgstr "Automaattinen päivitys" #: lazarusidestrconsts.lisceothergroup msgctxt "lazarusidestrconsts.lisceothergroup" msgid "Other" msgstr "" #: lazarusidestrconsts.lisceoupdate msgid "Update" msgstr "" #: lazarusidestrconsts.lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "" #: lazarusidestrconsts.lisceprocedures msgid "Procedures" msgstr "" #: lazarusidestrconsts.lisceproperties msgctxt "lazarusidestrconsts.lisceproperties" msgid "Properties" msgstr "Ominaisuudet" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" msgstr "Julkiset ominaisuudet ilman oletusarvoa" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observerations about" msgstr "" #: lazarusidestrconsts.liscestylegroup msgctxt "lazarusidestrconsts.liscestylegroup" msgid "Style" msgstr "" #: lazarusidestrconsts.liscesurrounding msgid "Surrounding" msgstr "" #: lazarusidestrconsts.liscetodos msgid "ToDos" msgstr "" #: lazarusidestrconsts.liscetypes msgid "Types" msgstr "Tyypit" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" msgstr "Nimeämättömät vakiot" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" msgstr "" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" msgstr "" #: lazarusidestrconsts.lisceuses msgctxt "lazarusidestrconsts.lisceuses" msgid "Uses" msgstr "" #: lazarusidestrconsts.liscevariables msgid "Variables" msgstr "Muuttujat" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" msgstr "" #: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof msgid "An exception occured during deletion of%s\"%s:%s\"%s%s" msgstr "" #: lazarusidestrconsts.liscfecancelloadingthisresource msgid "Cancel loading this resource" msgstr "" #: lazarusidestrconsts.liscfeclassnotfound msgid "%s%sClass \"%s\" not found." msgstr "" #: lazarusidestrconsts.liscfecomponent msgid "%s%sComponent: %s:%s" msgstr "" #: lazarusidestrconsts.liscfecomponentclass msgid "%s%sComponent Class: %s" msgstr "" #: lazarusidestrconsts.liscfecontinueloading msgid "Continue loading" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection msgid "Do not know how to copy this form editing selection" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection msgid "Do not know how to cut this form editing selection" msgstr "" #: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection msgid "Do not know how to delete this form editing selection" msgstr "" #: lazarusidestrconsts.liscfeerrorcreatingcomponent msgid "Error creating component" msgstr "" #: lazarusidestrconsts.liscfeerrorcreatingcomponent2 msgid "Error creating component: %s%s%s" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingcomponent msgid "Error destroying component" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit msgid "Error destroying component of type %s of unit %s:%s%s" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingmediator msgid "Error destroying mediator" msgstr "" #: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit msgid "Error destroying mediator %s of unit %s:%s%s" msgstr "" #: lazarusidestrconsts.liscfeerrorreading msgid "Error reading %s" msgstr "" #: lazarusidestrconsts.liscfeinfile msgid "%sIn file %s%s" msgstr "" #: lazarusidestrconsts.liscfeinvalidcomponentowner msgid "Invalid component owner" msgstr "Kelvoton komponentin omistaja" #: lazarusidestrconsts.liscferoot msgid "%sRoot=%s:%s" msgstr "" #: lazarusidestrconsts.liscfestopallloading msgid "Stop all loading" msgstr "" #: lazarusidestrconsts.liscfestream msgid "%sStream=%s" msgstr "%sVuo=%s" #: lazarusidestrconsts.liscfestreamposition msgid "%s%sStream position: %s" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists msgid "TCustomFormEditor.CreateNonFormForm already exists" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" msgstr "" #: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" msgstr "" #: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" msgstr "" #: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto msgid "The component of type %s failed to set its owner to %s:%s" msgstr "" #: lazarusidestrconsts.liscfeunabletocleartheformeditingselection msgid "Unable to clear the form editing selection%s%s" msgstr "" #: lazarusidestrconsts.lischangebuildmode msgid "Change build mode" msgstr "" #: lazarusidestrconsts.lischangeclass msgid "Change Class" msgstr "" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" msgstr "Muunna merkistökoodaus" #: lazarusidestrconsts.lischangefile msgid "Change file" msgstr "Muunna tiedosto" #: lazarusidestrconsts.lischangeparent msgid "Change Parent" msgstr "Vaihda emo-kontrollia" #: lazarusidestrconsts.lischangeswerenotsaved msgid "Changes were not saved" msgstr "" #: lazarusidestrconsts.lischangetounix msgid "Change to Unix /" msgstr "" #: lazarusidestrconsts.lischangetowindows msgid "Change to Windows \\" msgstr "" #: lazarusidestrconsts.lischaracter msgid "Character" msgstr "" #: lazarusidestrconsts.lischaractermap msgid "Character Map" msgstr "Merkkitaulukko" #: lazarusidestrconsts.lischeckchangesondiskwithloading msgid "Check changes on disk with loading" msgstr "" #: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl msgid "check if the next token in source is an end and if not returns lineend + end; + lineend" msgstr "" #: lazarusidestrconsts.lischeckoptions msgid "Check options" msgstr "" #: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." msgstr "" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" msgstr "Valitse toisenlainen nimi" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." msgstr "" #: lazarusidestrconsts.lischooseanameforthenewcomponent msgid "Choose a name for the new component" msgstr "Anna nimi uudelle komponentille" #: lazarusidestrconsts.lischooseapascalfileforindentationexamples msgid "Choose a pascal file for indentation examples" msgstr "" #: lazarusidestrconsts.lischoosecompilermessages msgid "Choose compiler messages file" msgstr "" #: lazarusidestrconsts.lischoosecompilerpath msgid "Choose compiler filename (%s)" msgstr "Valitse kääntäjän tiedostonimi (%s)" #: lazarusidestrconsts.lischoosedebuggerpath msgid "Choose debugger filename" msgstr "Valitse virheenjäljittimen tiedostonimi" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "Valitse Delphi-paketti (*.dpk)" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "Valitse Delphi-projekti (*.dpr)" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Valitse Delphi-käännösyksikkö (*.pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" msgstr "" #: lazarusidestrconsts.lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "Valitse Lazarus:n kansio" #: lazarusidestrconsts.lischoosemakepath msgid "Choose make path" msgstr "Valitse make-työkalun hakupolku" #: lazarusidestrconsts.lischoosename msgid "Choose name" msgstr "Valitse nimi" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "Valitse jokin näistä kohteista uudeksi tiedostoksi" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "Valitse jokin näistä kohteista uudeksi komponenttipaketiksi" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "Valitse jokin näistä kohteista uudeksi projektiksi" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Valitse ohjelman lähdekoodi (*.pp,*.pas,*.lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Valitse kapseloiva rakenne" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "" #: lazarusidestrconsts.liscircleinmacros msgid "Circle in macros" msgstr "Itseensä viittaava makro" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" msgstr "Luokan täydennys" #: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." msgstr "" #: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked msgid "Classes and properties exist. Values were not checked." msgstr "Luokkia ja ominaisuuksia on. Arvoja ei tarkistettu." #: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg msgid "classes.ppu not found. Check your fpc.cfg." msgstr "classes.ppu ei löytynyt. Tarkista fpc.cfg." #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgstr "" #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" msgstr "Luokkaa ei löydy" #: lazarusidestrconsts.lisclassofmethodnotfound msgid "Class %s%s%s of method %s%s%s not found." msgstr "" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" msgstr "Siivoa hakemisto" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" msgstr "Siivoa alihakemistot" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Säilytä kaikki tekstitiedostot" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "Säilytä suodattimen mukaiset tiedostot" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "Poista suodattimen mukaiset tiedostot" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Yksinkertainen kielioppi (kuten * eikä .*)" #: lazarusidestrconsts.liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Siivoa Lazaruksen lähdekoodi" #: lazarusidestrconsts.liscleanupandbuild msgid "Clean up and build" msgstr "Siivoa ja käännä" #: lazarusidestrconsts.liscleanupandbuildproject msgid "Clean up and build project" msgstr "Siivoa ja käännä projekti" #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" msgstr "Siivotaanko käännösyksikköjen polku?" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" msgstr "Tyhjennä hakemisto?" #: lazarusidestrconsts.lisclearkeymapping msgid "Clear Key Mapping" msgstr "Tyhjennä näppäinkartta" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "" #: lazarusidestrconsts.lisclicktoseethepossibleuses msgid "Click to see the possible uses" msgstr "" #: lazarusidestrconsts.lisclose msgid "&Close" msgstr "&Sulje" #: lazarusidestrconsts.lisclosealltabsclose msgid "Close files" msgstr "Sulje tiedostot" #: lazarusidestrconsts.lisclosealltabshide msgid "Hide window" msgstr "Piilota ikkuna" #: lazarusidestrconsts.lisclosealltabsquestion msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" msgstr "Suljetaan koodieditorin ikkuna. Tahdotko sulkea kaikki tiedostot vai piilottaa ikkunan?" #: lazarusidestrconsts.lisclosealltabstitle msgid "Close Source Editor Window" msgstr "Sulje koodieditorin ikkuna" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "LCL rajapintaan liittyvät asetukset:" #: lazarusidestrconsts.liscmparameter msgid "Parameter" msgstr "Parametri" #: lazarusidestrconsts.liscmplstcomponents msgctxt "lazarusidestrconsts.liscmplstcomponents" msgid "Components" msgstr "Komponentit" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" msgstr "Periytyvyys" #: lazarusidestrconsts.liscmplstlist msgid "List" msgstr "Luettelo" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" msgstr "Paletti" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "Toinen ristiriitainen kääntäjän asetustiedosto" #: lazarusidestrconsts.liscocallon msgid "Call on:" msgstr "" #: lazarusidestrconsts.liscocallonbuild msgctxt "lazarusidestrconsts.liscocallonbuild" msgid "Build" msgstr "Käännä (Build)" #: lazarusidestrconsts.liscocalloncompile msgctxt "lazarusidestrconsts.liscocalloncompile" msgid "Compile" msgstr "Käännä (Compile)" #: lazarusidestrconsts.liscocallonrun msgctxt "lazarusidestrconsts.liscocallonrun" msgid "Run" msgstr "Suorita" #: lazarusidestrconsts.liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "" #: lazarusidestrconsts.liscocommand msgctxt "lazarusidestrconsts.liscocommand" msgid "Command:" msgstr "Komento:" #: lazarusidestrconsts.liscode msgid "Code" msgstr "Koodi" #: lazarusidestrconsts.liscodebrowser msgid "Code browser" msgstr "Koodin selain" #: lazarusidestrconsts.liscodeexplorer msgctxt "lazarusidestrconsts.liscodeexplorer" msgid "Code Explorer" msgstr "Koodin tutkija" #: lazarusidestrconsts.liscodefault msgid "default (%s)" msgstr "" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" msgstr "" #: lazarusidestrconsts.liscodehelpaddlinkbutton msgid "Add link" msgstr "" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" msgstr "" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" msgid "Browse" msgstr "" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" msgstr "" #: lazarusidestrconsts.liscodehelpcreatebutton msgid "Create help item" msgstr "Luo ohjeita" #: lazarusidestrconsts.liscodehelpdeletelinkbutton msgid "Delete link" msgstr "" #: lazarusidestrconsts.liscodehelpdeletepathbutton msgid "Remove path" msgstr "" #: lazarusidestrconsts.liscodehelpdescrtag msgctxt "lazarusidestrconsts.liscodehelpdescrtag" msgid "Description" msgstr "" #: lazarusidestrconsts.liscodehelperrorstag msgctxt "lazarusidestrconsts.liscodehelperrorstag" msgid "Errors" msgstr "" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" msgstr "" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintvartag msgid "Insert var formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpinherited msgctxt "lazarusidestrconsts.liscodehelpinherited" msgid "Inherited" msgstr "Periytynyt" #: lazarusidestrconsts.liscodehelpinsertalink msgid "Insert a link ..." msgstr "" #: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelpmainformcaption msgid "FPDoc editor" msgstr "" #: lazarusidestrconsts.liscodehelpnodocumentation msgctxt "lazarusidestrconsts.liscodehelpnodocumentation" msgid "(none)" msgstr "" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" msgstr "" #: lazarusidestrconsts.liscodehelppathsgroupbox msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox" msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts.liscodehelpreplacebutton msgctxt "lazarusidestrconsts.liscodehelpreplacebutton" msgid "Replace" msgstr "" #: lazarusidestrconsts.liscodehelpsavebutton msgctxt "lazarusidestrconsts.liscodehelpsavebutton" msgid "Save" msgstr "" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" msgstr "" #: lazarusidestrconsts.liscodehelpshortdescriptionof msgid "Short description of" msgstr "" #: lazarusidestrconsts.liscodehelpshorttag msgid "Short" msgstr "" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" msgid "Ignore constants in next functions" msgstr "Jätä huomioonottamatta vakiot seuraavissa funktioissa" #: lazarusidestrconsts.liscodeobscharconst msgctxt "lazarusidestrconsts.liscodeobscharconst" msgid "Search for unnamed char constants" msgstr "" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" msgstr "" #: lazarusidestrconsts.liscodeobsignoreeconstants msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" msgid "Ignore next unnamed constants" msgstr "Jätä huomioonottamatta seuravat nimettömät vakiot" #: lazarusidestrconsts.liscodetempladd msgctxt "lazarusidestrconsts.liscodetempladd" msgid "Add" msgstr "Lisää" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" msgstr "Lisää koodilyhenne" #: lazarusidestrconsts.liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " msgstr "" #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on ..." msgstr "" #: lazarusidestrconsts.liscodetemplchange msgctxt "lazarusidestrconsts.liscodetemplchange" msgid "Change" msgstr "Muuta" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" msgstr "Kommentti:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" msgstr "Muokkaa koodilyhenteitä" #: lazarusidestrconsts.liscodetemplerror msgctxt "lazarusidestrconsts.liscodetemplerror" msgid "Error" msgstr "Virhe" #: lazarusidestrconsts.liscodetempltoken msgid "Token:" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsaction msgid "Action: %s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsblock msgid "Block" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscompilerpath msgid "Compiler path" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsconvertnode msgid "Convert node" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal SVN Sources" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" msgstr "" #: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdefine msgid "Define" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdeletenode msgid "Delete node" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdescription msgid "Description:" msgstr "Kuvaus:" #: lazarusidestrconsts.liscodetoolsdefsdirectory msgid "%s directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsedit msgctxt "lazarusidestrconsts.liscodetoolsdefsedit" msgid "Edit" msgstr "Muokkaa" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" msgstr "" #: lazarusidestrconsts.liscodetoolsdefselseif msgid "ElseIf" msgstr "" #: lazarusidestrconsts.liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" msgstr "Virhe luettaessa %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsexit msgctxt "lazarusidestrconsts.liscodetoolsdefsexit" msgid "Exit" msgstr "Lopeta" #: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave msgid "Exit without Save" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC SVN source directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsif msgid "If" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsifdef msgid "IfDef" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsifndef msgid "IfNDef" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Kansio" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "Kelvoton emo-kontrolli" #: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "Kelvoton emo-solmu" #: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsname msgctxt "lazarusidestrconsts.liscodetoolsdefsname" msgid "Name:" msgstr "Nimi:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsnoneselected msgid "none selected" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." msgstr "Emo-solmu ei voi sisältää lapsi-solmuja" #: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" msgid "Project directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 msgid "%s project directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsreaderror msgid "Read error" msgstr "" #: lazarusidestrconsts.liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal SVN source directory." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsundefine msgid "Undefine" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsundefineall msgid "Undefine All" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid msgid "%s:%svalue \"%s\" is invalid." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" msgstr "" #: lazarusidestrconsts.liscodetoolsdefswriteerror msgid "Write error" msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" msgstr "At (@)" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" msgstr "" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" msgstr "Kaksoispiste (:)" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" msgstr "Pilkku (,)" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" msgid "Identifier" msgstr "Tunniste (mm muuttuja)" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" msgstr "" #: lazarusidestrconsts.liscodetoolsoptsnewline msgid "Newline" msgstr "" #: lazarusidestrconsts.liscodetoolsoptsnone msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" msgid "None" msgstr "Ei yhtään" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" msgstr "Numero" #: lazarusidestrconsts.liscodetoolsoptsok msgctxt "lazarusidestrconsts.liscodetoolsoptsok" msgid "Ok" msgstr "" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" msgstr "Piste (.)" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Puolipiste (;)" #: lazarusidestrconsts.liscodetoolsoptsspace msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" msgid "Space" msgstr "Välilyönnit" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" msgstr "" #: lazarusidestrconsts.liscodetoolsoptssymbol msgid "Symbol" msgstr "" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" msgstr "" #: lazarusidestrconsts.liscoexecutebefore msgid "Execute before" msgstr "" #: lazarusidestrconsts.liscollapseall msgid "Collapse All (/)" msgstr "" #: lazarusidestrconsts.liscollapseallclasses msgid "Collapse all classes" msgstr "Supista kaikki luokat" #: lazarusidestrconsts.liscollapseallpackages msgid "Collapse all packages" msgstr "Supista kaikki paketit" #: lazarusidestrconsts.liscollapseallunits msgid "Collapse all units" msgstr "Supista kaikki käännösyksiköt" #: lazarusidestrconsts.liscommandafter msgid "Command after" msgstr "Komento jälkeen" #: lazarusidestrconsts.liscommandafterinvalid msgid "Command after invalid" msgstr "Komento virheellisen jälkeen" #: lazarusidestrconsts.liscommandafterpublishingmodule msgid "Command after publishing module" msgstr "Komento julkaistun moduulin jälkeen" #: lazarusidestrconsts.liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Ohjelman komentorivi-parametrit" #: lazarusidestrconsts.liscompiler msgid "Compiler" msgstr "Kääntäjä" #: lazarusidestrconsts.liscompilerdoesnotsupporttarget msgid "Compiler \"%s\" does not support target %s-%s" msgstr "Kääntäjä \"%s\" ei tuo kohdetta %s-%s" #: lazarusidestrconsts.liscompilererror msgid "Compiler error" msgstr "Kääntäjän virhe" #: lazarusidestrconsts.liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" msgstr "Virhe: toimimaton kääntäjä: %s" #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" msgstr "Kääntäjän tiedostonimi" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" msgstr "Vihje: voit asettaa kääntäjän hakupolun valikosta Työkalut -> Asetukset -> Tiedostot -> Kääntäjän polku" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "" #: lazarusidestrconsts.liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "Kääntäjän optiot projektissa: %s" #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" msgstr "%s (käännetään ...)" #: lazarusidestrconsts.liscompletionlonglinehinttype msgid "Show long line hints" msgstr "" #: lazarusidestrconsts.liscompletionlonglinehinttypefullleft msgid "Extend far left" msgstr "Laajenna kauas vasemmalle" #: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft msgid "Extend some left" msgstr "Laajenna vähän vasemmalle" #: lazarusidestrconsts.liscompletionlonglinehinttypenone msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" msgid "Never" msgstr "Ei koskaan" #: lazarusidestrconsts.liscompletionlonglinehinttyperightonly msgid "Extend right only" msgstr "Laajenna vain oikealle" #: lazarusidestrconsts.liscomponentnameisapascalkeyword msgid "Component name \"%s\" is a pascal keyword." msgstr "Komponentin nimi \"%s\" on pascalin avainsana." #: lazarusidestrconsts.liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" msgstr "Komponentin nimi %s%s%s on avainsana" #: lazarusidestrconsts.liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" msgstr "Komponentin nimi (name) %s%s%s ei ole sallittu tunnus" #: lazarusidestrconsts.liscomppalfindcomponent msgid "Find component" msgstr "Etsi komponentti" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" msgstr "Avaa paketti" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" msgstr "Avaa käännösyksikkö" #: lazarusidestrconsts.liscomptest msgctxt "lazarusidestrconsts.liscomptest" msgid "&Test" msgstr "Testi" #: lazarusidestrconsts.liscondition msgid "Condition" msgstr "Ehto" #: lazarusidestrconsts.lisconditionals msgid "Conditionals:" msgstr "Ehdolliset:" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" msgstr "Lazaruksen asetus-hakemisto" #: lazarusidestrconsts.lisconfigurebuild msgid "Configure Build %s" msgstr "Konfiguroi %s:n käännös" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" msgstr "Konfiguroi %sLazaruksen käännös%s" #: lazarusidestrconsts.lisconfigurelazaruside msgid "Configure Lazarus IDE" msgstr "Konfiguroi Lazarus IDE" #: lazarusidestrconsts.lisconfirmbuildallprofiles msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" msgstr "Lazarus käännetään uudelleen käyttäen profiilia:%sJatketaanko?" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" msgstr "Vahvista seuraavat muutokset" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" msgstr "Vahvista poisto" #: lazarusidestrconsts.lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus with profile: %s ?" msgstr "Haluatko kääntää Lazaruksen käyttäen profiilia: %s ?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "Vahvista uusi pakettien joukko kehitysympäristöön" #: lazarusidestrconsts.lisconfirmpackageaction msgctxt "lazarusidestrconsts.lisconfirmpackageaction" msgid "Action" msgstr "Toiminta" #: lazarusidestrconsts.lisconfirmpackagenewpackageset msgid "New package set" msgstr "Uusi pakettien joukko" #: lazarusidestrconsts.lisconfirmpackageoldpackageset msgid "Old package set" msgstr "Vanha komponenttipakettien joukko" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" msgstr "Komentorivisovellus" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" msgstr "" #: lazarusidestrconsts.liscontains msgid "contains" msgstr "sisältää" #: lazarusidestrconsts.liscontextsensitive msgid "Context sensitive" msgstr "Tilanteesta riippuva" #: lazarusidestrconsts.liscontinue msgctxt "lazarusidestrconsts.liscontinue" msgid "Continue" msgstr "Jatka" #: lazarusidestrconsts.liscontinueanddonotaskagain msgid "Continue and do not ask again" msgstr "Jatka äläkä kysy enää" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Jatka lataamatta lomaketta" #: lazarusidestrconsts.liscontributors msgid "Contributors" msgstr "Tekijät" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" msgstr "Kontrolli tarvitsee emon" #: lazarusidestrconsts.lisconvcoordhint msgid "An offset is added to Top coordinate of controls inside visual containers" msgstr "Siirtymä lisätään komponentin Top koordinaattiin" #: lazarusidestrconsts.lisconvcoordoffs msgid "Coordinate offsets" msgstr "Koordinaattien siirtymä" #: lazarusidestrconsts.lisconvdelphiaddedpackagerequirement msgid "Added Package %s as a requirement." msgstr "Paketti %s lisättiin riippuvuuksiin." #: lazarusidestrconsts.lisconvdelphiallsubdirsscanned msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" msgid "All sub-directories will be scanned for unit files" msgstr "Käännösyksiköitä etsitään kaikista alihakemistoista" #: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed msgid "BeginCodeTools failed!" msgstr "" #: lazarusidestrconsts.lisconvdelphicategories msgid "Categories:" msgstr "Ryhmät" #: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 msgid "Changed encoding from %s to UTF-8" msgstr "" #: lazarusidestrconsts.lisconvdelphiconversionaborted msgid "Conversion Aborted." msgstr "Muunnos on keskeytetty." #: lazarusidestrconsts.lisconvdelphiconversionready msgid "Conversion Ready." msgstr "Muunnos on valmis." #: lazarusidestrconsts.lisconvdelphiconvertdelphipackage msgid "Convert Delphi package" msgstr "Muunna Delphi paketti" #: lazarusidestrconsts.lisconvdelphiconvertdelphiproject msgid "Convert Delphi project" msgstr "Muunna Delphi projekti" #: lazarusidestrconsts.lisconvdelphiconvertdelphiunit msgid "Convert Delphi unit" msgstr "Muunna Delphi käännösyksikkö" #: lazarusidestrconsts.lisconvdelphiconvertingfile msgid "* Converting file %s *" msgstr "* Muunnetaan tiedostoa %s *" #: lazarusidestrconsts.lisconvdelphiconvertingunitfiles msgid "*** Converting unit files ... ***" msgstr "*** Muunnetaan käännösyksiköitä ... ***" #: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage msgid "Delphi package main source (.dpk) file not found for package%s%s" msgstr "Delphi paketin%s%s päätiedostoa (.dpk) ei löydy" #: lazarusidestrconsts.lisconvdelphierror msgid "Error=\"%s\"" msgstr "Virhe=\"%s\"" #: lazarusidestrconsts.lisconvdelphierrorcantfindunit msgid "%s(%s,%s) Error: Can't find unit %s" msgstr "%s(%s,%s) Virhe: käännösyksikköä %s ei löydy" #: lazarusidestrconsts.lisconvdelphifailedconvertingunit msgid "Failed converting unit" msgstr "Käännösyksikön muunnos epäonnistui" #: lazarusidestrconsts.lisconvdelphifailedtoconvertunit msgid "Failed to convert unit%s%s%s" msgstr "käännösyksikön%s%s%s muunnos epäonnistui" #: lazarusidestrconsts.lisconvdelphifindallunitfiles msgid "*** Find all unit files ... ***" msgstr "*** Etsi kaikki käännösyksiköt ... ***" #: lazarusidestrconsts.lisconvdelphifixedunitcase msgid "Fixed character case of unit \"%s\" to \"%s\"." msgstr "Korjattu kirjainkoko käännösyksikössä \"%s\". Uusi: \"%s\"." #: lazarusidestrconsts.lisconvdelphifixingusedunits msgid "* Fixing used units for file %s *" msgstr "* Korjataan tiedoston %s käyttämiä käännösyksikköjä *" #: lazarusidestrconsts.lisconvdelphifunc msgid "Delphi Function" msgstr "Delphi functio" #: lazarusidestrconsts.lisconvdelphikeepboth msgid "Keep both" msgstr "Pidä molemmat" #: lazarusidestrconsts.lisconvdelphimissingincludefile msgid "%s(%s,%s) missing include file" msgstr "" #: lazarusidestrconsts.lisconvdelphiname msgid "Delphi Name" msgstr "Delphi nimi" #: lazarusidestrconsts.lisconvdelphipackagenameexists msgid "Package name exists" msgstr "Paketti tuolla nimellä on jo olemassa" #: lazarusidestrconsts.lisconvdelphiprojomittedunit msgid "Omitted unit %s from project" msgstr "Käännösyksikkö %s jätettiin pois projektista" #: lazarusidestrconsts.lisconvdelphiremovedunitinusessection msgid "Removed unit \"%s\" in uses section." msgstr "Poistettu käännösyksikkö \"%s\" uses-lauseesta." #: lazarusidestrconsts.lisconvdelphiremovefirst msgid "Remove first" msgstr "Poista ensimmäinen" #: lazarusidestrconsts.lisconvdelphiremovesecond msgid "Remove second" msgstr "Poista toinen" #: lazarusidestrconsts.lisconvdelphirepairingformfile msgid "* Repairing form file %s *" msgstr "* Korjataan lomaketiedostoa %s *" #: lazarusidestrconsts.lisconvdelphirepairingformfiles msgid "*** Repairing form files ... ***" msgstr "*** Korjataan lomakkeita ... ***" #: lazarusidestrconsts.lisconvdelphireplacedunitinusessection msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" msgid "Replaced unit \"%s\" with \"%s\" in uses section." msgstr "Korvattu käännösyksikkö \"%s\" \"%s\":lla uses-lauseessa." #: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname" msgid "There are two units with the same unitname:%s%s%s%s%s" msgstr "Löytyy 2 käännösyksikköä samalla nimellä:%s%s%s%s%s" #: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa msgid "There is already a package with the name \"%s\"%sPlease close this package first." msgstr "\"%s\" niminen paketti on jo olemassa.%sSulje se ensin." #: lazarusidestrconsts.lisconvdelphiunitnameexiststwice msgid "Unitname exists twice" msgstr "Samanniminen käännösyksikkö esiintyy kahdesti" #: lazarusidestrconsts.lisconvdelphiunitstoreplacein msgid "Units to replace in %s" msgstr "Nämä käännösyksiköt korvataan %s:ssa" #: lazarusidestrconsts.lisconversionerror msgid "Conversion error" msgstr "Virhe muunnoksessa" #: lazarusidestrconsts.lisconvert msgid "Convert" msgstr "Muunna" #: lazarusidestrconsts.lisconvertencoding msgid "Convert encoding" msgstr "Muunna merkistökoodaus" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" msgstr "Muunna projektin/paketin merkistökoodaus" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" msgstr "Muunna projekti tai paketti" #: lazarusidestrconsts.lisconverttargethint msgid "Converter adds conditional compilation to support different targets" msgstr "Muunnin lisää ehdollista koodia (IFDEF) tukeakseen eri alustoja" #: lazarusidestrconsts.lisconverttargetmultiplatform msgid "Multi-Platform" msgstr "Monta alustaa" #: lazarusidestrconsts.lisconverttargetmultiplatformhint msgid "Multi-Platform versus Windows-only" msgstr "Monen alustan tuki vastaan pelkkä Windows tuki" #: lazarusidestrconsts.lisconverttargetsamedfmfile msgid "Use the same DFM form file" msgstr "Käytä samaa DFM lomaketiedostoa" #: lazarusidestrconsts.lisconverttargetsamedfmfilehint msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" msgstr "Sama DFM lomake Lazaruksen ja Delphin käyttöön. Ei kopioida LFM lomakkeeksi" #: lazarusidestrconsts.lisconverttargetsupportdelphi msgid "Support Delphi" msgstr "Tue Delphiä" #: lazarusidestrconsts.lisconverttargetsupportdelphihint msgid "Use conditional compilation to support Delphi" msgstr "Käytä ehdollista koodia (IFDEF) niin että koodi kääntyy myös Delphillä" #: lazarusidestrconsts.lisconvfuncreplacements msgid "Function Replacements" msgstr "Funktioiden korvaaminen" #: lazarusidestrconsts.lisconvfuncreplhint msgctxt "lazarusidestrconsts.lisconvfuncreplhint" msgid "Some Delphi functions can be replaced with LCL function" msgstr "Jotkut Delphin funktiot voidaan korvata LCL funktioilla" #: lazarusidestrconsts.lisconvfuncstoreplace msgid "Functions / procedures to replace" msgstr "Korvattavat funktiot" #: lazarusidestrconsts.lisconvleftoff msgid "Left offset" msgstr "Vasen siirtymä" #: lazarusidestrconsts.lisconvnewname msgid "New Name" msgstr "Uusi nimi" #: lazarusidestrconsts.lisconvparentcontainer msgid "Parent Container" msgstr "Emo-säiliö" #: lazarusidestrconsts.lisconvtopoff msgid "Top offset" msgstr "Ylä-siirtymä" #: lazarusidestrconsts.lisconvtypereplacements msgid "Type Replacements" msgstr "Tyyppien korvaaminen" #: lazarusidestrconsts.lisconvtypereplhint msgid "Unknown types in form file (DFM/LFM)" msgstr "Tuntemattomia tyyppejä lomakkeessa (DFM/LFM)" #: lazarusidestrconsts.lisconvtypestoreplace msgid "Types to replace" msgstr "Korvattavat tyypit" #: lazarusidestrconsts.lisconvunitreplacements msgid "Unit Replacements" msgstr "Käännösyksiköiden korvaaminen" #: lazarusidestrconsts.lisconvunitreplhint msgid "Unit names in uses section of a source unit" msgstr "Käännösyksiköiden nimet lähdekoodin uses-lauseessa" #: lazarusidestrconsts.lisconvunitstoreplace msgid "Units to replace" msgstr "Korvattavat käännösyksiköt" #: lazarusidestrconsts.lisconvunknownprops msgid "Unknown properties" msgstr "Tuntemattomat ominaisuudet" #: lazarusidestrconsts.liscopyall msgid "Copy All" msgstr "Kopioi kaikki" #: lazarusidestrconsts.liscopyallitemstoclipboard msgid "Copy all items to clipboard" msgstr "Kopioi kaikki leikepöydälle" #: lazarusidestrconsts.liscopyalloutputclipboard msgid "Copy all output to clipboard" msgstr "Kopioi kaikki tulostus leikepöydälle" #: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard msgid "Copy all shown and hidden messages to clipboard" msgstr " Kopioi kaikki viestit leikepöydälle" #: lazarusidestrconsts.liscopyallshownmessagestoclipboard msgid "Copy all shown messages to clipboard" msgstr "Kopioi kaikki näytetyt viestit leikepöydälle" #: lazarusidestrconsts.liscopydescription msgid "Copy description to clipboard" msgstr "Kopioi selitys leikepöydälle" #: lazarusidestrconsts.liscopyerror msgid "Copy Error" msgstr "Kopiointivirhe" #: lazarusidestrconsts.liscopyerror2 msgid "Copy error" msgstr "Kopiointivirhe" #: lazarusidestrconsts.liscopyidentifier msgid "Copy %s%s%s to clipboard" msgstr "Kopioi %s%s%s leikepöydälle" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "Kokonaisen lomakkeen kopiointia ei tueta." #: lazarusidestrconsts.liscopyitemtoclipboard msgid "Copy item to clipboard" msgstr "Kopioi leikepöydälle" #: lazarusidestrconsts.liscopyselecteditemtoclipboard msgid "Copy selected items to clipboard" msgstr "Kopioi valitut leikepöydälle" #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" msgstr "Kopioi valitut viestit leikepöydälle" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "Käy läpi FPC viestit" #: lazarusidestrconsts.liscoscanformakemessages msgid "Scan for Make messages" msgstr "Käy läpi Make viestit" #: lazarusidestrconsts.liscoscanformessages msgid "Scan for messages:" msgstr "Käy läpi viestit:" #: lazarusidestrconsts.liscoshowallmessages msgid "Show all messages" msgstr "Näytä kaikki viestit" #: lazarusidestrconsts.liscoskipcallingcompiler msgid "Skip calling Compiler" msgstr "" #: lazarusidestrconsts.liscotargetosspecificoptions msgid "Target OS specific options" msgstr "Kohde käyttöjärjestelmän asetukset" #: lazarusidestrconsts.liscouldnotadditomainsource msgid "Could not add %s{$I %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddrtomainsource msgid "Could not add %s{$R %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddtomainsource msgid "Could not add %s%s%s to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremovefrommainsource msgid "Could not remove %s%s%s from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoveifrommainsource msgid "Could not remove %s{$I %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoverfrommainsource msgid "Could not remove %s{$R %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscovarious msgid "%s (various)" msgstr "" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "" #: lazarusidestrconsts.liscpopenpackage msgid "Open Package %s" msgstr "Avaa komponenttipaketti %s" #: lazarusidestrconsts.liscpopenunit msgid "Open Unit %s" msgstr "Avaa käännösyksikkö %s" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" msgstr "Luo ensin projekti!" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" msgstr "Luo hakemisto?" #: lazarusidestrconsts.liscreatefunction msgid "Create function" msgstr "Luo funktio" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" msgstr "Luo ohje-solmu" #: lazarusidestrconsts.liscreateit msgid "Create it" msgstr "Luo se" #: lazarusidestrconsts.liscreateproject msgid "Create project" msgstr "Luo projekti" #: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile msgid "Create/update .po file when saving a lfm file" msgstr "Luo tai päivitä .po tiedosto kun lfm tiedosto talletetaan" #: lazarusidestrconsts.liscreatingfileindexoffpcsources msgid "Creating file index of FPC sources %s ..." msgstr "Luodaan tiedostohakemistoa FPC:n lähdekoodista %s ..." #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" msgstr "Valitse hakemisto" #: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "CodeTools hakemiston arvot" #: lazarusidestrconsts.lisctdefdefinetemplates msgid "Define templates" msgstr "Määritä mallit" #: lazarusidestrconsts.lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts.lisctdefsopenpreview msgid "Open Preview" msgstr "Avaa esikatselu" #: lazarusidestrconsts.lisctdefstools msgid "Tools" msgstr "Työkalut" #: lazarusidestrconsts.lisctdefvariable msgid "Variable: %s" msgstr "Muuttuja: %s" #: lazarusidestrconsts.lisctdefvariablename msgid "Variable Name" msgstr "Muuttujan nimi" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" msgstr "Mallit" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" msgstr "Valitse makro" #: lazarusidestrconsts.lisctselectcodemacro msgid "Select Code Macro" msgstr "Valitse koodimakro" #: lazarusidestrconsts.liscurrent msgctxt "lazarusidestrconsts.liscurrent" msgid "Current" msgstr "Nykyinen" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "" #: lazarusidestrconsts.liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "" #: lazarusidestrconsts.liscustombuildmacros msgid "Custom build macros" msgstr "Räätälöidyt käännösmakrot" #: lazarusidestrconsts.liscustomopthint msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces." msgstr "" #: lazarusidestrconsts.liscustomoptions msgid "custom options" msgstr "" #: lazarusidestrconsts.liscustomoptions2 msgid "Custom options" msgstr "" #: lazarusidestrconsts.liscustomprogram msgid "Custom Program" msgstr "" #: lazarusidestrconsts.liscustomprogramafreepascalprogram msgid "Custom Program%sA Free Pascal program." msgstr "Erikoisohjelma%sFree Pascal ohjelma." #: lazarusidestrconsts.lisdatamodule msgid "Data Module" msgstr "" #: lazarusidestrconsts.lisdate msgid "Date" msgstr "Päiväys" #: lazarusidestrconsts.lisdbgallitemdelete msgctxt "lazarusidestrconsts.lisdbgallitemdelete" msgid "Delete all" msgstr "Poista kaikki" #: lazarusidestrconsts.lisdbgallitemdeletehint msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint" msgid "Delete all" msgstr "Poista kaikki" #: lazarusidestrconsts.lisdbgallitemdisable msgctxt "lazarusidestrconsts.lisdbgallitemdisable" msgid "Disable all" msgstr "Estä kaikki" #: lazarusidestrconsts.lisdbgallitemdisablehint msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" msgid "Disable all" msgstr "Estä kaikki" #: lazarusidestrconsts.lisdbgallitemenable msgctxt "lazarusidestrconsts.lisdbgallitemenable" msgid "Enable all" msgstr "Salli kaikki" #: lazarusidestrconsts.lisdbgallitemenablehint msgctxt "lazarusidestrconsts.lisdbgallitemenablehint" msgid "Enable all" msgstr "Salli kaikki" #: lazarusidestrconsts.lisdbgasmcopytoclipboard msgid "Copy to clipboard" msgstr "Kopioi leikepöydälle" #: lazarusidestrconsts.lisdbgbreakpointpropertieshint msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint" msgid "Breakpoint Properties ..." msgstr "Keskeytyskohdan ominaisuudet ..." #: lazarusidestrconsts.lisdbgemexpression msgid "&Expression:" msgstr "" #: lazarusidestrconsts.lisdbgemnewvalue msgid "&New value:" msgstr "Uusi arvo:" #: lazarusidestrconsts.lisdbgemresult msgid "&Result:" msgstr "Lopputulos:" #: lazarusidestrconsts.lisdbgenbreakpointevaluation msgid "Breakpoint Evaluation" msgstr "Keskeytyskohdan määritys" #: lazarusidestrconsts.lisdbgenbreakpointhit msgid "Breakpoint Hit" msgstr "Keskeytyskohdan osuma" #: lazarusidestrconsts.lisdbgenbreakpointmessage msgid "Breakpoint Message" msgstr "Keskeytyskohdan viesti" #: lazarusidestrconsts.lisdbgenbreakpointstackdump msgid "Breakpoint Stack Dump" msgstr "Keskeytyskohdan pinolistaus" #: lazarusidestrconsts.lisdbgendefaultcolor msgid "Default Color" msgstr "Oletusväri" #: lazarusidestrconsts.lisdbgenexceptionraised msgid "Exception Raised" msgstr "Keskeytys on annettu" #: lazarusidestrconsts.lisdbgenmoduleload msgid "Module Load" msgstr "Lataa Moduuli" #: lazarusidestrconsts.lisdbgenmoduleunload msgid "Module Unload" msgstr "Poista Moduuli" #: lazarusidestrconsts.lisdbgenoutputdebugstring msgid "Output Debug String" msgstr "Näytä virheenjäljitys-teksti" #: lazarusidestrconsts.lisdbgenprocessexit msgid "Process Exit" msgstr "Prosessin loppu" #: lazarusidestrconsts.lisdbgenprocessstart msgid "Process Start" msgstr "Prosessin alku" #: lazarusidestrconsts.lisdbgenthreadexit msgid "Thread Exit" msgstr "Säikeen loppu" #: lazarusidestrconsts.lisdbgenthreadstart msgid "Thread Start" msgstr "Säikeen alku" #: lazarusidestrconsts.lisdbgenwindowsmessageposted msgid "Windows Message Posted" msgstr "Windows-viesti on viety" #: lazarusidestrconsts.lisdbgenwindowsmessagesent msgid "Windows Message Sent" msgstr "Windows-viesti on lähetetty" #: lazarusidestrconsts.lisdbgitemdelete msgctxt "lazarusidestrconsts.lisdbgitemdelete" msgid "Delete" msgstr "Poista" #: lazarusidestrconsts.lisdbgitemdeletehint msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" msgid "Delete" msgstr "Poista" #: lazarusidestrconsts.lisdbgitemdisable msgctxt "lazarusidestrconsts.lisdbgitemdisable" msgid "Disable" msgstr "Estä" #: lazarusidestrconsts.lisdbgitemdisablehint msgctxt "lazarusidestrconsts.lisdbgitemdisablehint" msgid "Disable" msgstr "Estä" #: lazarusidestrconsts.lisdbgitemenable msgctxt "lazarusidestrconsts.lisdbgitemenable" msgid "Enable" msgstr "Salli" #: lazarusidestrconsts.lisdbgitemenablehint msgctxt "lazarusidestrconsts.lisdbgitemenablehint" msgid "Enable" msgstr "Salli" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "Virheenjäljitintä ei ole valittu" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "Merkitse tämä kuitenkin keskeyskohdaksi" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgstr "Kun virheenjäljitintä ei ole valittu niin keskeytyskohdalla ei ole vaikutusta ennenkuin 'Käyttöliittymä'-valikon 'Virheenjäljittimen asetus' on asetettu." #: lazarusidestrconsts.lisdbgwinpower msgid "On/Off" msgstr "Päällä/Pois" #: lazarusidestrconsts.lisdbgwinpowerhint msgid "Disable/Enable updates for the entire window" msgstr "" #: lazarusidestrconsts.lisdebuggererror msgid "Debugger error" msgstr "Virheenjäljittimen virhe" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgstr "" #: lazarusidestrconsts.lisdebuggerfeedbackerror msgid "Debugger Error" msgstr "" #: lazarusidestrconsts.lisdebuggerfeedbackinformation msgid "Debugger Information" msgstr "" #: lazarusidestrconsts.lisdebuggerfeedbackless msgid "Less" msgstr "Vähemmän" #: lazarusidestrconsts.lisdebuggerfeedbackmore msgctxt "lazarusidestrconsts.lisdebuggerfeedbackmore" msgid "More" msgstr "Lisää" #: lazarusidestrconsts.lisdebuggerfeedbackok msgctxt "lazarusidestrconsts.lisdebuggerfeedbackok" msgid "OK" msgstr "" #: lazarusidestrconsts.lisdebuggerfeedbackstop msgctxt "lazarusidestrconsts.lisdebuggerfeedbackstop" msgid "Stop" msgstr "Pysäytä" #: lazarusidestrconsts.lisdebuggerfeedbackwarning msgid "Debugger Warning" msgstr "Virheenjäljittimen varoitus" #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" msgstr "" #: lazarusidestrconsts.lisdebugging msgid "%s (debugging ...)" msgstr "" #: lazarusidestrconsts.lisdebughintautotypecastclass msgid "Automatic type-cast for objects" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" msgstr "Lisää keskeytys" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Keskeytyskohta" #: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Tyhjennä loki enne suoritusta" #: lazarusidestrconsts.lisdebugoptionsfrmdebugger msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" msgid "Debugger" msgstr "Virheenjäljitin" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Virheenjäljittimen yleiset asetukset" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" msgstr "Päällekkäinen keskeytyksen nimi" #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" msgstr "Syötä keskeytyksen nimi" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" msgid "Event Log" msgstr "Tapahtuma loki" #: lazarusidestrconsts.lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmid msgid "ID" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto msgid "Limit line count to" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" msgid "Module" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmname msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" msgid "Name" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Lazarus Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "Käyttöjärjestelmän keskeytys" #: lazarusidestrconsts.lisdebugoptionsfrmoutput msgid "Output" msgstr "Tuloste" #: lazarusidestrconsts.lisdebugoptionsfrmprocess msgid "Process" msgstr "Prosessi" #: lazarusidestrconsts.lisdebugoptionsfrmresume msgid "Resume" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmresumehandled msgid "Resume Handled" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled msgid "Resume Unhandled" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "Näytä viesti pysähdyttäessä" #: lazarusidestrconsts.lisdebugoptionsfrmsignals msgid "Signals" msgstr "Signaalit" #: lazarusidestrconsts.lisdebugoptionsfrmthread msgid "Thread" msgstr "Säie" #: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors msgid "Use event log colors" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmwindows msgid "Windows" msgstr "" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" msgstr "Tiedoston luku ei onnistu" #: lazarusidestrconsts.lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." msgstr "Tiedoston %s%s%s luku ei onnistu." #: lazarusidestrconsts.lisdecimal msgctxt "lazarusidestrconsts.lisdecimal" msgid "Decimal" msgstr "Desimaali" #: lazarusidestrconsts.lisdefaultvalue msgid "Default value" msgstr "Oletusarvo" #: lazarusidestrconsts.lisdelayforcompletionlonglinehint msgid "Delay for long line hints in completion box" msgstr "" #: lazarusidestrconsts.lisdelayforhintsandcompletionbox msgid "Delay for hints and completion box" msgstr "" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" msgstr "Poista kaikki" #: lazarusidestrconsts.lisdeleteallbreakpoints msgid "Delete all breakpoints?" msgstr "Poista kaikki keskeytyskohdat?" #: lazarusidestrconsts.lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" msgstr "Poista kaikki keskeytyskohdat tiedostossa %s%s%s?" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" msgstr "Poista kaikki samassa lähdekoodissa" #: lazarusidestrconsts.lisdeleteallselectedbreakpoints msgid "Delete all selected breakpoints?" msgstr "Poista kaikki valitut keskeytyskohdat?" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Poistetaanko kaikki nämä tiedostot?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "Poista moniselitteinen tiedosto" #: lazarusidestrconsts.lisdeletebreakpoint msgid "Delete Breakpoint" msgstr "Poista keskeytyskohta" #: lazarusidestrconsts.lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" msgstr "Poista keskeytyskohta kohdassa%s\"%s\" rivi %d?" #: lazarusidestrconsts.lisdeletebreakpointforaddress msgid "Delete breakpoint for address %s?" msgstr "Poista osoitteen %s keskeytyskohta?" #: lazarusidestrconsts.lisdeletebreakpointforwatch msgid "Delete watchpoint for \"%s\"?" msgstr "" #: lazarusidestrconsts.lisdeletebuildmacro msgid "Delete build macro %s%s%s?" msgstr "Poista käännösmakro %s%s%s?" #: lazarusidestrconsts.lisdeletebuildmode msgid "Delete build mode" msgstr "" #: lazarusidestrconsts.lisdeletebuildmode2 msgid "Delete build mode?" msgstr "" #: lazarusidestrconsts.lisdeletebuildmode3 msgid "Delete build mode %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletefilefailed msgid "Delete file failed" msgstr "Tiedoston poistaminen epäonnistui" #: lazarusidestrconsts.lisdeletemacro msgid "Delete macro %s" msgstr "Poista makro %s" #: lazarusidestrconsts.lisdeletemode msgid "Delete mode \"%s\"" msgstr "" #: lazarusidestrconsts.lisdeleteoldfile msgid "Delete old file %s%s%s?" msgstr "Poistetaanko %s%s%s-niminen vanha fiedosto?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" msgstr "Poistetaanko vanha tiedosto?" #: lazarusidestrconsts.lisdeleterow msgid "Delete row" msgstr "" #: lazarusidestrconsts.lisdeleteselectedfiles msgid "Delete selected files" msgstr "" #: lazarusidestrconsts.lisdeletesetting msgid "Delete setting" msgstr "" #: lazarusidestrconsts.lisdeletesetting2 msgid "Delete setting?" msgstr "" #: lazarusidestrconsts.lisdeletesetting3 msgid "Delete setting %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletevalue msgid "Delete value %s%s%s" msgstr "" #: lazarusidestrconsts.lisdeletevalue2 msgid "Delete value %s" msgstr "" #: lazarusidestrconsts.lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." msgstr "" #: lazarusidestrconsts.lisdelphi msgid "Delphi" msgstr "" #: lazarusidestrconsts.lisdelphipackage msgid "Delphi package" msgstr "Delphi-paketti" #: lazarusidestrconsts.lisdelphiproject msgid "Delphi project" msgstr "Delphi-projekti" #: lazarusidestrconsts.lisdelphiunit msgid "Delphi unit" msgstr "Delphi-käännösyksikkö" #: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename msgid "There is already another component with the name %s%s%s." msgstr "" #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" msgstr "" #: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "" #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "Kirjaimen koolla ei väliä" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "Jätä huomiotta tyhjät rivit" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "Jätä huomiotta erilaiset rivinloppumerkinnät (esim. #10 = #13#10)" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "Jätä huomiotta välilyöntien määrä merkkien välissä " #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "Jätä välilyönnit huomiotta (ei koske tyhjiä rivejä)" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "Jätä huomiotta välilyönnit rivin lopussa" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "Jätä huomiotta välilyönnit rivin alussa" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" msgstr "Ainoastaan valittu osa" #: lazarusidestrconsts.lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "Avaa eroavuudet editorissa" #: lazarusidestrconsts.lisdiffdlgtext1 msgid "Text1" msgstr "Teksti 1" #: lazarusidestrconsts.lisdiffdlgtext2 msgid "Text2" msgstr "Teksti 2" #: lazarusidestrconsts.lisdigits msgid "Digits:" msgstr "" #: lazarusidestrconsts.lisdirectives msgid "Directives" msgstr "Ohjeet kääntäjälle" #: lazarusidestrconsts.lisdirectivesfornewunit msgid "Directives for new unit" msgstr "" #: lazarusidestrconsts.lisdirectorynotfound msgid "Directory %s%s%s not found." msgstr "" #: lazarusidestrconsts.lisdirectorynotfound2 msgid "directory %s not found" msgstr "" #: lazarusidestrconsts.lisdirectorynotwritable msgid "Directory not writable" msgstr "" #: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles msgid "Directory where the IDE puts the .po files" msgstr "" #: lazarusidestrconsts.lisdisableallinsamesource msgid "Disable All in same source" msgstr "" #: lazarusidestrconsts.lisdisablebreakpoint msgid "Disable Breakpoint" msgstr "Estä keskeytyskohta" #: lazarusidestrconsts.lisdisabled msgid "Disabled" msgstr "Estetty" #: lazarusidestrconsts.lisdisablegroups msgid "Disable Groups" msgstr "Estä ryhmät" #: lazarusidestrconsts.lisdisablei18nforlfm msgid "Disable I18N for LFM" msgstr "" #: lazarusidestrconsts.lisdisassassembler msgctxt "lazarusidestrconsts.lisdisassassembler" msgid "Assembler" msgstr "" #: lazarusidestrconsts.lisdisassgotoaddress msgctxt "lazarusidestrconsts.lisdisassgotoaddress" msgid "Goto address" msgstr "Mene osoitteeseen" #: lazarusidestrconsts.lisdisassgotoaddresshint msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint" msgid "Goto address" msgstr "Mene osoitteeseen" #: lazarusidestrconsts.lisdisassgotocurrentaddress msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress" msgid "Goto current address" msgstr "Mene nykyiseen osoitteeseen" #: lazarusidestrconsts.lisdisassgotocurrentaddresshint msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint" msgid "Goto current address" msgstr "Mene nykyiseen osoitteeseen" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" msgstr "Hylkää muutokset" #: lazarusidestrconsts.lisdiscardchangesall msgid "Discard all changes" msgstr "Hylkää kaikki muutokset" #: lazarusidestrconsts.lisdiscardchangesandopenproject msgid "Discard changes and open project" msgstr "" #: lazarusidestrconsts.lisdiscardchangesandquit msgid "Discard changes and quit" msgstr "" #: lazarusidestrconsts.lisdiscardchangescreatenewproject msgid "Discard changes, create new project" msgstr "" #: lazarusidestrconsts.lisdiskdiffchangedfiles msgid "Changed files:" msgstr "Muuttuneet tiedostot:" #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Klikkaa jotain ylläolevaa kohtaa nähdäksesi muuttuneet kohdat" #: lazarusidestrconsts.lisdiskdifferrorreadingfile msgid "Error reading file: %s" msgstr "Virhe luettaessa tiedostoa: %s" #: lazarusidestrconsts.lisdiskdiffignorediskchanges msgid "Ignore disk changes" msgstr "Jätä huomiotta tallennetun version muutokset" #: lazarusidestrconsts.lisdiskdiffrevertall msgid "Reload from disk" msgstr "Hae tallennettu versio" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "Seuraavat tiedostot ovat muuttuneet:" #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Erottelee pienet ja isot kirjaimet (esim. A ja a )" #: lazarusidestrconsts.lisdocumentationeditor msgid "Documentation Editor" msgstr "Dokumenttieditori" #: lazarusidestrconsts.lisdoesnotexists msgid "%s does not exists: %s" msgstr "%s ei ole olemassa: %s" #: lazarusidestrconsts.lisdonotchange msgid "Do not change" msgstr "Älä muuta" #: lazarusidestrconsts.lisdonotclosetheide msgid "Do not close the IDE" msgstr "Ei sittenkään suljeta Lazarusta" #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" msgstr "Ei suljetakaan projektia" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "do not compile dependencies" msgstr "älä käännä riippuvuuksia" #: lazarusidestrconsts.lisdonotinstall msgid "Do not install" msgstr "Älä asenna" #: lazarusidestrconsts.lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "Älä näytä aloitusikkunaa" #: lazarusidestrconsts.lisdonotshowthisdialogforthisproject msgid "Do not show this dialog for this project" msgstr "Älä näytä tätä ikkunaa tälle projektille" #: lazarusidestrconsts.lisdonotshowthismessageagain msgid "Do not show this message again" msgstr "Älä näytä tätä viestiä enää" #: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject msgid "Do you still want to create the new project?" msgstr "" #: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject msgid "Do you still want to open another project?" msgstr "" #: lazarusidestrconsts.lisdoyoustillwanttoquit msgid "Do you still want to quit?" msgstr "" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" msgstr "Näytä kohdistusviivat" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Kopioi valitut komponentit leikepöydälle" #: lazarusidestrconsts.lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Leikkaa valitut komponentit leikepöydälle" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" msgstr "" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" msgstr "" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" msgstr "" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" msgstr "" #: lazarusidestrconsts.lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Liitä komponentit leikepöydältä" #: lazarusidestrconsts.lisdsgselectparentcomponent msgid "Select parent component" msgstr "Valitse emo-komponentti" #: lazarusidestrconsts.lisduplicatefoundofvalue msgid "Duplicate found of value %s%s%s." msgstr "" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgstr "" #: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "" #: lazarusidestrconsts.lisduplicatesearchpath msgid "Duplicate search path" msgstr "" #: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." msgstr "" #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" msgstr "Muokkaa tilannekohtaista ohjetta" #: lazarusidestrconsts.liseditorfiletypes msgid "Editor file types" msgstr "Editorin tiedostojen tyypit" #: lazarusidestrconsts.lisedoptsloadascheme msgid "Load a scheme" msgstr "" #: lazarusidestrconsts.lisedtdefallpackages msgid "All packages" msgstr "Kaikki paketit" #: lazarusidestrconsts.lisedtdefcurrentproject msgid "Current Project" msgstr "Nykyinen projekti" #: lazarusidestrconsts.lisedtdefcurrentprojectdirectory msgid "Current Project Directory" msgstr "Nykyisen projektin hakemisto" #: lazarusidestrconsts.lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" msgstr "Globaalin lähdehakemiston lisäys" #: lazarusidestrconsts.lisedtdefprojectincpath msgid "Project IncPath" msgstr "" #: lazarusidestrconsts.lisedtdefprojectsrcpath msgid "Project SrcPath" msgstr "Projektin lähdekoodin polku" #: lazarusidestrconsts.lisedtdefprojectunitpath msgid "Project UnitPath" msgstr "Projektin käännösyksiköiden polku" #: lazarusidestrconsts.lisedtdefsallprojects msgid "All projects" msgstr "Kaikki projektit" #: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" msgstr "Aseta 'FPC mode'n arvoksi DELPHI" #: lazarusidestrconsts.lisedtdefsetfpcmodetofpc msgid "set FPC mode to FPC" msgstr "Aseta 'FPC mode'n arvoksi FPC" #: lazarusidestrconsts.lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" msgstr "Aseta 'FPC mode'n arvoksi GPC" #: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas msgid "set FPC mode to MacPas" msgstr "Aseta 'FPC mode'n arvoksi MacPas" #: lazarusidestrconsts.lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" msgstr "Aseta 'FPC mode'n arvoksi TP" #: lazarusidestrconsts.lisedtdefsetiocheckson msgid "set IOCHECKS on" msgstr "Aseta IOCHECKS päälle" #: lazarusidestrconsts.lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" msgstr "Aseta OVERFLOWCHECKS päälle" #: lazarusidestrconsts.lisedtdefsetrangecheckson msgid "set RANGECHECKS on" msgstr "Aseta RANGECHECKS päälle" #: lazarusidestrconsts.lisedtdefuseheaptrcunit msgid "use HeapTrc unit" msgstr "Käytä HeapTrc käännösyksikköä" #: lazarusidestrconsts.lisedtdefuselineinfounit msgid "use LineInfo unit" msgstr "Käytä LineInfo käännösyksikköä" #: lazarusidestrconsts.lisedtexttoolalt msgctxt "lazarusidestrconsts.lisedtexttoolalt" msgid "Alt" msgstr "" #: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Työkalu tarvitsee ainakin otsikon ja tiedostonimen." #: lazarusidestrconsts.lisedtexttoolctrl msgctxt "lazarusidestrconsts.lisedtexttoolctrl" msgid "Ctrl" msgstr "" #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" msgstr "Muokkaa työkalua" #: lazarusidestrconsts.lisedtexttoolhidemainform msgid "Hide main form" msgstr "" #: lazarusidestrconsts.lisedtexttoolinsert msgid "Insert" msgstr "Lisää" #: lazarusidestrconsts.lisedtexttoolkey msgctxt "lazarusidestrconsts.lisedtexttoolkey" msgid "Key" msgstr "Avain" #: lazarusidestrconsts.lisedtexttoolmacros msgid "Macros" msgstr "Makrot" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" msgstr "Parametrit:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Ohjelman tiedostonimi" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" msgstr "" #: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" msgstr "" #: lazarusidestrconsts.lisedtexttoolshift msgctxt "lazarusidestrconsts.lisedtexttoolshift" msgid "Shift" msgstr "" #: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Otsikko ja tiedostonimi vaaditaan" #: lazarusidestrconsts.lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Työhakemisto" #: lazarusidestrconsts.lisemdall msgid "All" msgstr "Kaikki" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" msgstr "Tyhjät metodit" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" msgstr "Löydetyt tyhjät metodit:" #: lazarusidestrconsts.lisemdnoclass msgid "No class" msgstr "Ei luokkaa" #: lazarusidestrconsts.lisemdnoclassat msgid "No class at %s(%s,%s)" msgstr "" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" msgstr "Vain julkaistut" #: lazarusidestrconsts.lisemdpublic msgid "Public" msgstr "Julkinen" #: lazarusidestrconsts.lisemdpublished msgid "Published" msgstr "Julkaistu" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" msgstr "Poista metodit" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "Haetaan näistä luokan (class) osista:" #: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause msgid "Unable to show empty methods of the current class, because%s%s" msgstr "Tämän luokan tyhjien metodien näyttö ei onnistu, koska%s%s" #: lazarusidestrconsts.lisempty msgid "Empty" msgstr "Tyhjä" #: lazarusidestrconsts.lisenableall msgid "&Enable All" msgstr "Salli kaikki" #: lazarusidestrconsts.lisenableallinsamesource msgid "Enable All in same source" msgstr "Salli kaikki samassa lähdekoodissa" #: lazarusidestrconsts.lisenablebreakpoint msgid "Enable Breakpoint" msgstr "Salli keskeytyskohta" #: lazarusidestrconsts.lisenabled msgctxt "lazarusidestrconsts.lisenabled" msgid "Enabled" msgstr "Sallittu" #: lazarusidestrconsts.lisenablegroups msgid "Enable Groups" msgstr "" #: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport msgid "Enable internationalization and translation support" msgstr "" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" msgstr "Salli makrot" #: lazarusidestrconsts.lisenclose msgid "Enclose" msgstr "Kapseloi" #: lazarusidestrconsts.lisencloseinifdef msgid "Enclose in $IFDEF" msgstr "Kapseloi $IFDEF:n sisään" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2 msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2" msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "Merkistö on tiedostossa %s%s%s%skoodattu %s-koodauksella. Koodaukseksi muunnetaan %s." #: lazarusidestrconsts.lisentertransla msgid "Enter translation language" msgstr "" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" msgstr "" #: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick msgid "Jump from message to source line on double click (otherwise: single click)" msgstr "" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" msgstr "Kansiota ei löytynyt" #: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." msgstr "FPC:n lähdekoodin kansiota \"%s\" ei löytynyt." #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "Kääntäjän tiedostonimi on virheellinen" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." msgstr "Kääntäjän tiedosto \"%s\" ei ole ajettavissa." #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ." msgstr "Kansio \"%s\" ei vaikuta FPC lähdekoodin kansiolta. Sen pitäisi sisältää kansioita kuten rtl/inc, packages/fcl-base jne." #: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "Kansio \"%s\" ei vaikuta Lazaruksen kansiolta. Sen pitäisi sisältää kansioita kuten lcl, debugger, designer, components jne." #: lazarusidestrconsts.lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." msgstr "Lazarus:n kansiota \"%s\" ei löytynyt." #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." msgstr "Testiprojektien kansiota \"%s\" ei löytynyt. " #: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" msgstr "" #: lazarusidestrconsts.liseotabwidths msgctxt "lazarusidestrconsts.liseotabwidths" msgid "Tab widths" msgstr "Välilehtien leveydet" #: lazarusidestrconsts.liserrinvalidoption msgid "Invalid option at position %d: \"%s\"" msgstr "" #: lazarusidestrconsts.liserrnooptionallowed msgid "Option at position %d does not allow an argument: %s" msgstr "" #: lazarusidestrconsts.liserroptionneeded msgid "Option at position %d needs an argument : %s" msgstr "" #: lazarusidestrconsts.liserror msgid "Error: " msgstr "Virhe: " #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" msgstr "" #: lazarusidestrconsts.liserrorcreatinglrs msgid "Error creating lrs" msgstr "" #: lazarusidestrconsts.liserrordeletingfile msgid "Error deleting file" msgstr "" #: lazarusidestrconsts.liserrorin msgid "Error in %s" msgstr "" #: lazarusidestrconsts.liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" msgstr "" #: lazarusidestrconsts.liserrorinthecompilerfilename msgid "Error in the compiler file name:" msgstr "" #: lazarusidestrconsts.liserrorinthecustomcompileroptionsother msgid "Error in the custom compiler options (Other):" msgstr "" #: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol msgid "Error in the custom linker options (Linking / Pass options to linker):" msgstr "" #: lazarusidestrconsts.liserrorinthedebuggerpathaddition msgid "Error in the \"Debugger path addition\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforincludefiles msgid "Error in the search path for \"Include files\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforlibraries msgid "Error in the search path for \"Libraries\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles msgid "Error in the search path for \"Object files\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforothersources msgid "Error in the search path for \"Other sources\":" msgstr "" #: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles msgid "Error in the search path for \"Other unit files\":" msgstr "" #: lazarusidestrconsts.liserrorintheunitoutputdirectory msgid "Error in the \"unit output directory\":" msgstr "" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" msgstr "" #: lazarusidestrconsts.liserrorloadingfile2 msgid "Error loading file \"%s\":%s%s" msgstr "" #: lazarusidestrconsts.liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" msgstr "Virhe siirrettäessä komponenttia" #: lazarusidestrconsts.liserrormovingcomponent2 msgid "Error moving component %s:%s" msgstr "Virhe siirrettäessä %s:%s komponenttia" #: lazarusidestrconsts.liserrornamingcomponent msgid "Error naming component" msgstr "" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" msgstr "" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "Virhe jäsennettäessä lfm komponentin virtaa." #: lazarusidestrconsts.liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" msgstr "" #: lazarusidestrconsts.liserrorreadingxmlfile msgid "Error reading xml file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" msgstr "" #: lazarusidestrconsts.liserrors msgctxt "lazarusidestrconsts.liserrors" msgid "Errors" msgstr "Virheet" #: lazarusidestrconsts.liserrorsavingto msgid "Error saving %s to%s%s%s%s" msgstr "" #: lazarusidestrconsts.liserrorsettingthenameofacomponentto msgid "Error setting the name of a component %s to %s" msgstr "" #: lazarusidestrconsts.liserrorwritingfile msgid "Error writing file \"%s\"" msgstr "" #: lazarusidestrconsts.liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "" #: lazarusidestrconsts.liseteditcustomscanners msgid "Edit custom scanners (%s)" msgstr "" #: lazarusidestrconsts.lisevalexpression msgctxt "lazarusidestrconsts.lisevalexpression" msgid "Eval expression" msgstr "" #: lazarusidestrconsts.lisevaluate msgid "E&valuate" msgstr "Arvioi" #: lazarusidestrconsts.lisevaluatemodify msgid "&Evaluate/Modify" msgstr "Arvioi/Muuta" #: lazarusidestrconsts.liseventlogclear msgid "Clear Events" msgstr "Tyhjennä tapahtumat" #: lazarusidestrconsts.liseventlogoptions msgid "Event Log Options ..." msgstr "" #: lazarusidestrconsts.liseventlogsavetofile msgid "Save Events to File" msgstr "" #: lazarusidestrconsts.liseventslogaddcomment msgid "Add Comment ..." msgstr "" #: lazarusidestrconsts.liseventslogaddcomment2 msgid "Add Comment" msgstr "" #: lazarusidestrconsts.liseverynthlinenumber msgid "Every n-th line number:" msgstr "Rivinumeroiden näyttöväli:" #: lazarusidestrconsts.lisexamplefile msgid "Example file:" msgstr "" #: lazarusidestrconsts.lisexamples msgid "Examples" msgstr "" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "" #: lazarusidestrconsts.lisexceptiondialog msgid "Debugger Exception Notification" msgstr "Virheejäljettimen kiinniottaman poikkeuksen havainto" #: lazarusidestrconsts.lisexcludedatruntime msgid "%s excluded at run time" msgstr "" #: lazarusidestrconsts.lisexcludefilter msgid "Exclude Filter" msgstr "" #: lazarusidestrconsts.lisexcludefilter2 msgid "Exclude filter" msgstr "" #: lazarusidestrconsts.lisexecutable msgid "Executable" msgstr "" #: lazarusidestrconsts.lisexecutingcommandafter msgid "Executing command after" msgstr "" #: lazarusidestrconsts.lisexecutingcommandbefore msgid "Executing command before" msgstr "" #: lazarusidestrconsts.lisexecutionpaused msgid "Execution paused" msgstr "" #: lazarusidestrconsts.lisexecutionpausedadress msgid "Execution paused%s Address: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" msgstr "" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" msgstr "Ohjelman suoritus on pysäytetty" #: lazarusidestrconsts.lisexeprograms msgid "Programs" msgstr "Ohjelmat" #: lazarusidestrconsts.lisexpandall msgid "Expand All (*)" msgstr "" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" msgstr "Laajenna kaikki luokat" #: lazarusidestrconsts.lisexpandallpackages msgid "Expand all packages" msgstr "Laajenna kaikki paketit" #: lazarusidestrconsts.lisexpandallunits msgid "Expand all units" msgstr "Laajenna kaikki käännösyksiköt" #: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "" #: lazarusidestrconsts.lisexport msgid "Export ..." msgstr "Vie ..." #: lazarusidestrconsts.lisexportlist msgid "Export list" msgstr "Vie luettelo" #: lazarusidestrconsts.lisexpression msgid "Expression:" msgstr "Ilmaisu:" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" msgstr "Laajennetaanko käännösyksikköjen polkua?" #: lazarusidestrconsts.lisextract msgid "Extract" msgstr "Erota" #: lazarusidestrconsts.lisextractprocedure msgctxt "lazarusidestrconsts.lisextractprocedure" msgid "Extract Procedure" msgstr "Erota aliohjelma" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External tools" msgstr "Ulkoiset työkalut" #: lazarusidestrconsts.lisexttoolfailedtoruntool msgid "Failed to run tool" msgstr "Työkalun suoritus epäonnistui" #: lazarusidestrconsts.lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "Työkalujen maksimimäärä täyttyi" #: lazarusidestrconsts.lisexttoolmovedown msgctxt "lazarusidestrconsts.lisexttoolmovedown" msgid "Down" msgstr "Alas" #: lazarusidestrconsts.lisexttoolmoveup msgctxt "lazarusidestrconsts.lisexttoolmoveup" msgid "Up" msgstr "Ylös" #: lazarusidestrconsts.lisexttoolremove msgctxt "lazarusidestrconsts.lisexttoolremove" msgid "Remove" msgstr "Poista" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Työkaluilla on maksimimäärä" #: lazarusidestrconsts.lisexttooltitlecompleted msgid "\"%s\" completed" msgstr "\"%s\" on valmis" #: lazarusidestrconsts.lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor msgid "Failed to create Application Bundle for \"%s\"" msgstr "" #: lazarusidestrconsts.lisfailedtoloadfoldstat msgid "Failed to load fold state" msgstr "Laskostuksen lataaminen epäonnistui" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" msgstr "Vähennä näytön päivittämistä" #: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" msgstr "Piirretään suunnitteluaikaiset kohdat joutoaikana (vähentää hitaiden tietokoneiden kuormitusta)" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2 msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2" msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" msgstr "" #: lazarusidestrconsts.lisfilefilter msgid "File filter" msgstr "" #: lazarusidestrconsts.lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" msgstr "Tiedeosto %s%s%s on muuttunut. Talletetaanko?" #: lazarusidestrconsts.lisfilehasnoproject msgid "File has no project" msgstr "" #: lazarusidestrconsts.lisfileisnotanexecutable msgid "File is not an executable" msgstr "" #: lazarusidestrconsts.lisfileisnotwritable msgid "File is not writable" msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.lisfileissymlink msgid "File is symlink" msgstr "" #: lazarusidestrconsts.lisfileisvirtual msgid "File %s%s%s is virtual." msgstr "" #: lazarusidestrconsts.lisfilelinkerror msgid "File link error" msgstr "" #: lazarusidestrconsts.lisfilenameaddress msgid "Filename/Address" msgstr "" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "Tiedostoa ei löytynyt" #: lazarusidestrconsts.lisfilenotfound2 msgid "File %s%s%s not found.%s" msgstr "Tiedostoa %s%s%s ei löytynyt.%s" #: lazarusidestrconsts.lisfilenotfound3 msgid "file %s not found" msgstr "" #: lazarusidestrconsts.lisfilenotfound4 msgid "file not found" msgstr "" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" msgstr "Tiedostoa %s%s%s ei löytynyt.%sHaluatko luoda sen?%s" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" msgstr "" #: lazarusidestrconsts.lisfilenottext msgid "File not text" msgstr "Tiedosto ei ole tekstitiedosto" #: lazarusidestrconsts.lisfilesettings msgid "File Settings" msgstr "Tiedoston asetukset" #: lazarusidestrconsts.lisfileshaverightencoding msgid "*** All found files already have the right encoding ***" msgstr "" #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" msgstr "ASCII tai UTF-8 koodatut tiedostot" #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" msgstr "Muut kuin ASCII tai UTF-8 koodatut tiedostot" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" #: lazarusidestrconsts.lisfilter msgid "Filter" msgstr "Suodatin" #: lazarusidestrconsts.lisfilter2 msgid "(filter)" msgstr "(suodatin)" #: lazarusidestrconsts.lisfilter3 msgid "Filter: %s" msgstr "Suodatin: %s" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" msgstr "Suodatinryhmät" #: lazarusidestrconsts.lisfindfiledirectory msgid "D&irectory" msgstr "" #: lazarusidestrconsts.lisfindfiledirectoryoptions msgid "Directory options" msgstr "Kansion lisäasetukset" #: lazarusidestrconsts.lisfindfilefilemask msgid "Fi&le mask" msgstr "" #: lazarusidestrconsts.lisfindfileincludesubdirectories #, fuzzy #| msgid "Include sub directories" msgid "Include &sub directories" msgstr "Sisällytetään myös alikansiot " #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "Monirivinen" #: lazarusidestrconsts.lisfindfileonlytextfiles msgid "Only text files" msgstr "Vain tekstitiedostot" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "search all files in &project" msgstr "Hae projektin kaikista tiedostoista" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "search all &open files" msgstr "Hae kaikista avoinna olevista tiedostoista" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "search in &directories" msgstr "Etsi kansioista" #: lazarusidestrconsts.lisfindfilewhere msgid "Where" msgstr "Mistä" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" msgstr "Etsi näppäinyhdistelmä" #: lazarusidestrconsts.lisfindmissingunit msgid "Find missing unit" msgstr "Etsi puuttuva käännösyksikkö" #: lazarusidestrconsts.lisfirst msgid "First" msgstr "Ensimmäinen" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" msgstr "LFM tiedoston korjaus" #: lazarusidestrconsts.lisfloatingpoin msgid "Floating Point" msgstr "Liukuluku" #: lazarusidestrconsts.lisfocushint msgid "Focus hint" msgstr "" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" msgstr "Kaikesta huolimatta nimetään näin" #: lazarusidestrconsts.lisform msgid "Form" msgstr "Lomake" #: lazarusidestrconsts.lisformaterror msgid "Format error" msgstr "Muotoiluvirhe" #: lazarusidestrconsts.lisformloaderror msgid "Form load error" msgstr "Lomakkeen latausvirhe" #: lazarusidestrconsts.lisfoundversionexpected msgid "Found version %s, expected %s" msgstr "Versio %s löytyi, odotettiin versiota %s" #: lazarusidestrconsts.lisfpccfgismissing msgid "fpc.cfg is missing." msgstr "" #: lazarusidestrconsts.lisfpcmakefailed msgid "fpcmake failed" msgstr "" #: lazarusidestrconsts.lisfpcomponents msgctxt "lazarusidestrconsts.lisfpcomponents" msgid "Components" msgstr "Komponentit" #: lazarusidestrconsts.lisfpcresources msgid "FPC resources" msgstr "" #: lazarusidestrconsts.lisfpcsourcedirectoryerror msgid "FPC Source Directory error" msgstr "" #: lazarusidestrconsts.lisfpcsources msgid "FPC sources" msgstr "" #: lazarusidestrconsts.lisfpctooold msgid "FPC too old" msgstr "" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " msgstr "" #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "" #: lazarusidestrconsts.lisfpdoceditor msgctxt "lazarusidestrconsts.lisfpdoceditor" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lisfpdocerrorwriting msgid "Error writing \"%s\"%s%s" msgstr "" #: lazarusidestrconsts.lisfpdocfpdocsyntaxerror msgid "FPDoc syntax error" msgstr "" #: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" msgstr "" #: lazarusidestrconsts.lisfpfindpalettecomponent msgid "Find palette component" msgstr "Etsi komponenttipaletista komponentti" #: lazarusidestrconsts.lisframe msgid "Frame" msgstr "Kehys" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" msgstr "Taaksepäin" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" msgstr "" #: lazarusidestrconsts.lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "" #: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus." msgstr "Free Pascal ohjelma joka käyttää TCustomApplication luokkaa. Sillä on helppo tarkastaa komentoriviltä annetut parametrit ja poikkeukset. Lazarus pitää yllä ohjelman koodia automaattisesti." #: lazarusidestrconsts.lisfreepascalsourcedirectory msgid "Free Pascal source directory" msgstr "" #: lazarusidestrconsts.lisfreepascalsourcefile msgid "Free Pascal source file" msgstr "" #: lazarusidestrconsts.lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" msgstr "Free Pascalin lähdekoodeja ei löytynyt" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" msgstr "Eteenpäin" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Laajennetaan toiminta koskemaan myös näihin tiedostoihin (esim. /path/*.pas;/path2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "Etsi tai vaihda tunnisteiden nimiä" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" msgstr "Etsi viittaukset" #: lazarusidestrconsts.lisfriidentifier msgid "Identifier: %s" msgstr "Tunniste: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" msgstr "vain käytössä oleva käännösyksikkö" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" msgstr "kaikista tämän projektin tiedostoista" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "" #: lazarusidestrconsts.lisfriinvalididentifier msgid "Invalid Identifier" msgstr "Kelvoton tunniste" #: lazarusidestrconsts.lisfrirename msgctxt "lazarusidestrconsts.lisfrirename" msgid "Rename" msgstr "Nimeä uudelleen" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" msgstr "Nimeä uudelleen viittaukset" #: lazarusidestrconsts.lisfrirenameto msgid "Rename to" msgstr "Uusi nimi on" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Käy myös kommentit läpi" #: lazarusidestrconsts.lisfrisearchwhere msgid "Search where" msgstr "Mistä etsitään" #: lazarusidestrconsts.lisfunction msgctxt "lazarusidestrconsts.lisfunction" msgid "Function" msgstr "Funktio" #: lazarusidestrconsts.lisgeneral msgctxt "lazarusidestrconsts.lisgeneral" msgid "General" msgstr "Yleistä" #: lazarusidestrconsts.lisgetwordatcurrentcursorposition msgid "get word at current cursor position" msgstr "" #: lazarusidestrconsts.lisgotoline msgid "Goto line" msgstr "" #: lazarusidestrconsts.lisgotoselectedsourceline msgctxt "lazarusidestrconsts.lisgotoselectedsourceline" msgid "Goto selected source line" msgstr "Mene valitulle lähdekoodiriville" #: lazarusidestrconsts.lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lisgroup msgid "Group" msgstr "Ryhmä" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" msgstr "Kasvata suurimpaan" #: lazarusidestrconsts.lishashelp msgid "Has Help" msgstr "Ohje löytyy" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" msgstr "" #: lazarusidestrconsts.lishelpentries msgid "Help entries" msgstr "Ohjemerkinnät" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" msgstr "Ohjeen valinta" #: lazarusidestrconsts.lishexadecimal msgid "Hexadecimal" msgstr "Heksadesimaali" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage #, fuzzy #| msgid "Help for FreePascal Compiler message" msgid "Help for Free Pascal Compiler message" msgstr "Free Pascal kääntäjän viestien ohje" #: lazarusidestrconsts.lishidemessageviadirective msgid "Hide message via directive" msgstr "" #: lazarusidestrconsts.lishint msgid "Hint" msgstr "Vihje" #: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals msgid "Hint: A default value can be defined in the conditionals." msgstr "Vihje: oletusarvo voidaan määritellä ehtolauseessa." #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "Vihje: Tarkista sisältääkö kaksi komponenttipakettia käännösyksikön samalla nimellä." #: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit msgid "Hint: double click on the command you want to edit" msgstr "Vihje: kaksoisnapsauta komentoa jota haluat muokata" #: lazarusidestrconsts.lishintopen msgctxt "lazarusidestrconsts.lishintopen" msgid "Open" msgstr "Avaa" #: lazarusidestrconsts.lishintpause msgctxt "lazarusidestrconsts.lishintpause" msgid "Pause" msgstr "Keskeytä" #: lazarusidestrconsts.lishintrun msgctxt "lazarusidestrconsts.lishintrun" msgid "Run" msgstr "Suorita" #: lazarusidestrconsts.lishintsave msgctxt "lazarusidestrconsts.lishintsave" msgid "Save" msgstr "Tallenna" #: lazarusidestrconsts.lishintsaveall msgid "Save all" msgstr "Tallenna kaikki" #: lazarusidestrconsts.lishintstepinto msgid "Step Into" msgstr "Askella sisään" #: lazarusidestrconsts.lishintstepout msgid "Run until function returns" msgstr "Jatka funktion loppuun asti" #: lazarusidestrconsts.lishintstepover msgid "Step Over" msgstr "Askella yli" #: lazarusidestrconsts.lishintstop msgctxt "lazarusidestrconsts.lishintstop" msgid "Stop" msgstr "Pysäytä" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." msgstr "" #: lazarusidestrconsts.lishinttoggleformunit msgid "Toggle Form/Unit" msgstr "Vaihda lomake/käännösyksikkö" #: lazarusidestrconsts.lishintviewforms msgid "View Forms" msgstr "Näytä lomakkeet" #: lazarusidestrconsts.lishintviewunits msgid "View Units" msgstr "Näytä käännösyksiköt" #: lazarusidestrconsts.lishitcount msgid "Hitcount" msgstr "Osumien määrä" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" msgstr "Tietokannat" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" msgstr "Ohjeen asetukset" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" msgstr "Ominaisuudet:" #: lazarusidestrconsts.lishlpoptsviewers msgid "Viewers" msgstr "Katselimet" #: lazarusidestrconsts.lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "FPC Doc HTML polku" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" msgstr "Vaakasuunta" #: lazarusidestrconsts.liside msgid "IDE" msgstr "" #: lazarusidestrconsts.lisidebuildoptions msgid "IDE build options" msgstr "Kehitysympäristön käännösasetukset" #: lazarusidestrconsts.lisideinfocreatingmakefileforpackage msgid "Creating Makefile for package %s" msgstr "Luodaan Make-tiedosto paketille %s" #: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage msgid "Error: running 'compile after' tool failed for package %s" msgstr "" #: lazarusidestrconsts.lisideinfoinformationabouttheide msgid "Information about the IDE" msgstr "Tietoja kehitysympäristöstä" #: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage msgid "WARNING: unit name invalid %s, package=%s" msgstr "" #: lazarusidestrconsts.lisidentifier msgid "identifier" msgstr "tunniste" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "" #: lazarusidestrconsts.lisidentifiercontains msgid "Identifier contains ..." msgstr "Tunniste sisältää ..." #: lazarusidestrconsts.lisideoptions msgid "IDE Options:" msgstr "" #: lazarusidestrconsts.lisideprojectdirinidetitle msgid "Show project directory in IDE title" msgstr "Näytä projektin tiedostopolku Lazaruksen päävalikon otsikossa" #: lazarusidestrconsts.lisidetitlestartswithprojectname msgid "IDE title starts with project name" msgstr "Kehitysympäristön otsikkoteksti alkaa projektin nimellä" #: lazarusidestrconsts.lisiecoerroraccessingxml msgid "Error accessing xml" msgstr "" #: lazarusidestrconsts.lisiecoerroraccessingxmlfile msgid "Error accessing xml file %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts.lisiecoerrorloadingxml msgid "Error loading xml" msgstr "" #: lazarusidestrconsts.lisiecoerrorloadingxmlfile msgid "Error loading xml file %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" msgstr "" #: lazarusidestrconsts.lisiecoopenorloadcompileroptions msgid "Open or Load Compiler Options" msgstr "" #: lazarusidestrconsts.lisiecoopenrecent msgid "Open recent" msgstr "" #: lazarusidestrconsts.lisiecorecentfiles msgid "Recent files" msgstr "" #: lazarusidestrconsts.lisiecosavetofile msgid "Save to file" msgstr "" #: lazarusidestrconsts.lisiecosavetorecent msgid "Save to recent" msgstr "" #: lazarusidestrconsts.lisifdok msgctxt "lazarusidestrconsts.lisifdok" msgid "OK" msgstr "" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" msgstr "Ohita kaikki" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" msgstr "" #: lazarusidestrconsts.lisignorebinaries msgid "Ignore binaries" msgstr "" #: lazarusidestrconsts.lisignoreexceptiontype msgid "Ignore this exception type" msgstr "Ohita tämän tyyppiset poikkeukset" #: lazarusidestrconsts.lisignoremissingfile msgid "Ignore missing file" msgstr "Jätä huomiotta puuttuva tiedosto" #: lazarusidestrconsts.lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" msgstr "" #: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage msgid "Imitate indentation of current unit, project or package" msgstr "" #: lazarusidestrconsts.lisimplementationcommentforclass msgid "Implementation comment for class" msgstr "" #: lazarusidestrconsts.lisimportlist msgid "Import list" msgstr "" #: lazarusidestrconsts.lisimpossible msgid "Impossible" msgstr "" #: lazarusidestrconsts.lisinasourcedirectoryofthepackage msgid "In a source directory of the package \"%s\"." msgstr "" #: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates msgid "In a source directory of the project. Check for duplicates." msgstr "" #: lazarusidestrconsts.lisincludefilter msgid "Include Filter" msgstr "Lisää suodatin" #: lazarusidestrconsts.lisincludepath msgid "include path" msgstr "" #: lazarusidestrconsts.lisincludepaths msgid "Include paths" msgstr "" #: lazarusidestrconsts.lisindentation msgid "Indentation" msgstr "" #: lazarusidestrconsts.lisindentationforpascalsources msgid "Indentation for pascal sources" msgstr "" #: lazarusidestrconsts.lisindex msgid "Index" msgstr "" #: lazarusidestrconsts.lisinfobuildabort msgid "Aborted ..." msgstr "" #: lazarusidestrconsts.lisinfobuildcaption msgid "Compile Project" msgstr "Tietoja projektin käännöksestä" #: lazarusidestrconsts.lisinfobuildcomplile msgid "Compiling ..." msgstr "Käännetään ..." #: lazarusidestrconsts.lisinfobuilderror msgid "Error ..." msgstr "Virhe ..." #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" msgstr "Virheitä:" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" msgstr "Vihjeitä:" #: lazarusidestrconsts.lisinfobuildlines msgctxt "lazarusidestrconsts.lisinfobuildlines" msgid "Lines:" msgstr "Rivejä:" #: lazarusidestrconsts.lisinfobuildmakeabort msgctxt "lazarusidestrconsts.lisinfobuildmakeabort" msgid "Abort" msgstr "Keskeytä" #: lazarusidestrconsts.lisinfobuildnote msgid "Notes:" msgstr "Huomioita:" #: lazarusidestrconsts.lisinfobuildproject msgid "Project:" msgstr "Projekti:" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success ..." msgstr "Kääntäminen onnistui ..." #: lazarusidestrconsts.lisinfobuildwarning msgid "Warnings:" msgstr "Varoituksia:" #: lazarusidestrconsts.lisinformation msgid "Information" msgstr "Tietoja" #: lazarusidestrconsts.lisinformationaboutunit msgid "Information about %s" msgstr "Tietoja %s tiedostosta" #: lazarusidestrconsts.lisinformationaboutusedfpc msgid "Information about used FPC" msgstr "" #: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." msgstr "" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" msgstr "" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" msgstr "" #: lazarusidestrconsts.lisinheritedprojectcomponent msgid "Inherited project component" msgstr "" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" msgstr "" #: lazarusidestrconsts.lisinsertdate msgid "insert date" msgstr "liitä päivämäärä" #: lazarusidestrconsts.lisinsertdateandtime msgid "insert date and time" msgstr "liitä päivämäärä ja aika" #: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring msgid "Insert date and time. Optional: format string" msgstr "liitä päivämäärä ja aika. Valinnaisesti muotoile merkkijono" #: lazarusidestrconsts.lisinsertdateoptionalformatstring msgid "Insert date. Optional: format string" msgstr "liitä päivämäärä. Valinnaisesti muotoile merkkijono" #: lazarusidestrconsts.lisinsertendifneeded msgid "insert end if needed" msgstr "liitä end tarvittaessa" #: lazarusidestrconsts.lisinsertmacro msgctxt "lazarusidestrconsts.lisinsertmacro" msgid "Insert Macro" msgstr "Liitä makro" #: lazarusidestrconsts.lisinsertnameofcurrentprocedure msgid "Insert name of current procedure" msgstr "Liitä nykyisen funktion nimi" #: lazarusidestrconsts.lisinsertprintshorttag msgid "Insert PrintShort tag" msgstr "" #: lazarusidestrconsts.lisinsertprintshorttag2 msgid "Insert printshort tag" msgstr "" #: lazarusidestrconsts.lisinsertprocedurehead msgid "insert procedure head" msgstr "" #: lazarusidestrconsts.lisinsertprocedurename msgid "insert procedure name" msgstr "" #: lazarusidestrconsts.lisinserttime msgid "insert time" msgstr "liitä aika" #: lazarusidestrconsts.lisinserttimeoptionalformatstring msgid "Insert time. Optional: format string" msgstr "Liitä aika. Valinnaisesti muotoile merkkijono" #: lazarusidestrconsts.lisinserturltag msgid "Insert url tag" msgstr "Liitä URL tagi" #: lazarusidestrconsts.lisinsession msgid "In session" msgstr "" #: lazarusidestrconsts.lisinspect msgid "&Inspect" msgstr "Tutki" #: lazarusidestrconsts.lisinspectdata msgid "Data" msgstr "" #: lazarusidestrconsts.lisinspectdialog msgid "Debug Inspector" msgstr "" #: lazarusidestrconsts.lisinspectmethods msgid "Methods" msgstr "Metodit" #: lazarusidestrconsts.lisinspectproperties msgctxt "lazarusidestrconsts.lisinspectproperties" msgid "Properties" msgstr "Ominaisuudet" #: lazarusidestrconsts.lisinstallationfailed msgid "Installation failed" msgstr "Asennus epäonnistui" #: lazarusidestrconsts.lisinstallitilikethefat msgid "Install it, I like the fat" msgstr "Asenna, pidän siitä turvonneena" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" msgstr "Asenna valinta" #: lazarusidestrconsts.lisinstalluninstallpackages msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" msgid "Install/Uninstall packages" msgstr "Asenna/Poista paketteja" #: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile msgid "Instead of compile package create a simple Makefile." msgstr "Paketin kääntämisen sijaan tee yksinkertainen Makefile." #: lazarusidestrconsts.lisinteractive msgid "Interactive" msgstr "Vuorovaikutteinen" #: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier." msgstr "Kelvoton käännösmakro %s%s%s. Sen pitää olla pascal-tunniste." #: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword msgid "Invalid build macro \"%s\". The name is a keyword." msgstr "Kelvoton käännösmakro \"%s\". Nimi on avainsana." #: lazarusidestrconsts.lisinvalidcircle msgid "Invalid circle" msgstr "Kielletty kehä" #: lazarusidestrconsts.lisinvalidcommand msgid "Invalid command" msgstr "Kelvoton komento" #: lazarusidestrconsts.lisinvalidcompilerfilename msgid "Invalid Compiler Filename" msgstr "Virheellinen kääntäjän tiedostonimi" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" msgstr "Onnistumaton poisto" #: lazarusidestrconsts.lisinvaliddestinationdirectory msgid "Invalid destination directory" msgstr "Kelvoton kohdehakemisto" #: lazarusidestrconsts.lisinvalidexpression msgid "Invalid expression:%s%s%s%s" msgstr "Kelvoton lauseke:%s%s%s%s" #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "Kelvoton lauseke.%sVihje: \"Make Resourcestring\" funktio olettaa merkkijonovakiota yhdessä tiedostossa. Valitse lauseke ja yritä uudelleen." #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" msgstr "Kelvoton suodatin" #: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" msgstr "Virheellinen Free Pascalin lähdekoodikansio" #: lazarusidestrconsts.lisinvalidlinecolumninmessage msgid "Invalid line, column in message%s%s" msgstr "Kelvoton rivi, sarake viestissä%s%s" #: lazarusidestrconsts.lisinvalidmode msgid "Invalid mode %s" msgstr "Kelvoton moodi %s" #: lazarusidestrconsts.lisinvalidmultiselection msgid "Invalid multiselection" msgstr "Kelvoton monivalinta" #: lazarusidestrconsts.lisinvalidoff msgid "Invalid (Off)" msgstr "Kelvoton (Pois)" #: lazarusidestrconsts.lisinvalidon msgid "Invalid (On)" msgstr "Kelvoton (Päällä)" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "Kelvoton Pascal-tunniste" #: lazarusidestrconsts.lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." msgstr "Nimi \"%s\" ei ole kelvollinen pascalin tunniste." #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" msgstr "Vääränlainen aliohjelman nimi" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" msgstr "Vääränlainen projektitiedoston nimi" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "Kelvoton julkaisuhakemisto" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" msgstr "Kelvoton valinta" #: lazarusidestrconsts.lisinvalidversionin msgid "invalid version in %s" msgstr "kelvoton versio %s:ssa" #: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes msgid "%s is a group. A setting can only be added to normal build modes." msgstr "" #: lazarusidestrconsts.lisisalreadypartoftheproject msgid "%s is already part of the Project." msgstr "%s on jo osa projektia." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s on vääränlainen projektin tiedostonimi.%sOle hyvä ja valitse joku muu (esim. projekti1.lpi)" #: lazarusidestrconsts.lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." msgstr "" #: lazarusidestrconsts.lisisddirectorynotfound msgid "directory not found" msgstr "hakemistoa ei löydy" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe msgid "I wonder how you did that. Error in the %s:" msgstr "Miten onnistuit tekemään sen? Virhe %s:" #: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory msgid "I wonder how you did that: Error in the base directory:" msgstr "Miten onnistuit tekemään sen? Virhe kantahakemistossa:" #: lazarusidestrconsts.lisjhjumphistory msgctxt "lazarusidestrconsts.lisjhjumphistory" msgid "Jump History" msgstr "Hyppyhistoria" #: lazarusidestrconsts.liskeep msgid "keep" msgstr "säilytä" #: lazarusidestrconsts.liskeep2 msgid "Keep" msgstr "Säilytä" #: lazarusidestrconsts.liskeepfileopen msgid "Keep converted files open in editor" msgstr "Pidä muunnetut tiedostot auki editorissa" #: lazarusidestrconsts.liskeepfileopenhint msgid "All project files will be open in editor after conversion" msgstr "Kaikki projektin tiedostot ovat auki editorissa konversion jälkeen" #: lazarusidestrconsts.liskeepininstalllist msgid "Keep in install list" msgstr "Pidetään asennuksessa" #: lazarusidestrconsts.liskeepname msgid "Keep name" msgstr "Hyväksy nimi tällaisenaan" #: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate msgid "Keep relative indentation of multi line template" msgstr "Säilytä monirivisten mallien suhteellinen sisennys" #: lazarusidestrconsts.liskeepsubindentation msgid "Keep indentation" msgstr "Säilytä sisennys" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" msgstr "Pidä ne ja jatka" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" msgstr "Räätälöidyt komennot" #: lazarusidestrconsts.liskeycatdesigner msgid "Designer commands" msgstr "Designerin komennot" #: lazarusidestrconsts.liskeycatobjinspector msgid "Object Inspector commands" msgstr "Object Inspectorin komennot" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "Näppäin (tai 2 peräkkäistä yhdistelmää)" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" msgstr "Keskeytä käännös" #: lazarusidestrconsts.liskmaddbpaddress msgid "Add address breakpoint" msgstr "Lisää keskeytyskohta osoitteeseen" #: lazarusidestrconsts.liskmaddbpsource msgid "Add source breakpoint" msgstr "Lisää keskeytyskohta lähdekoodiin" #: lazarusidestrconsts.liskmaddbpwatchpoint msgid "Add data/watchPoint" msgstr "" #: lazarusidestrconsts.liskmaddwatch msgid "Add watch" msgstr "Lisää vahti" #: lazarusidestrconsts.liskmbuildprojectprogram msgid "Build project/program" msgstr "Käännä projekti/ohjelma" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "Valitse näppäinkaavio" #: lazarusidestrconsts.liskmclassic msgid "Classic" msgstr "Klassinen" #: lazarusidestrconsts.liskmcleanupcompiled msgid "Clean up build files" msgstr "" #: lazarusidestrconsts.liskmcloseall msgid "Close All" msgstr "Sulje kaikki" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" msgstr "Sulje projekti" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "" #: lazarusidestrconsts.liskmcodetoolsoptions msgid "CodeTools options" msgstr "CodeTools asetukset" #: lazarusidestrconsts.liskmcompileprojectprogram msgid "Compile project/program" msgstr "Käännä projekti/ohjelma" #: lazarusidestrconsts.liskmcompileroptions msgid "Compiler options" msgstr "Kääntäjän optioasetukset" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config %sBuild File%s" msgstr "Konfiguroi %sKäännä tiedosto%s" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure custom components" msgstr "Konfiguroi räätälöidyt komponentit" #: lazarusidestrconsts.liskmconfigurehelp msgid "Configure Help" msgstr "Konfiguroi avustus" #: lazarusidestrconsts.liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "Tilannekohtainen ohje" #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "Muunna Delphi paketti Lazarukselle" #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi project to Lazarus project" msgstr "Muunna Delphi projekti Lazarukselle" #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit msgid "Convert Delphi unit to Lazarus unit" msgstr "Muunna Delphi käännösyksikkö Lazarukselle" #: lazarusidestrconsts.liskmconvertdfmfiletolfm msgid "Convert DFM file to LFM" msgstr "Muunna DFM-tiedosto LFM:ksi" #: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard msgid "Copy selected Components to clipboard" msgstr "Kopioi valitut komponentit leikepöydälle" #: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard msgid "Cut selected Components to clipboard" msgstr "Leikkaa valitut komponentit leikepöydälle" #: lazarusidestrconsts.liskmdeletelastchar msgid "Delete last char" msgstr "Poista viimeksi kirjoitettu merkki" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff editor files" msgstr "Editorin tiedostojen erot" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" msgstr "Muokkaa koodimalleja" #: lazarusidestrconsts.liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "Muokkaa tilannekohtaista ohjetta" #: lazarusidestrconsts.liskmeditoroptions msgctxt "lazarusidestrconsts.liskmeditoroptions" msgid "Editor options" msgstr "Editorin asetukset" #: lazarusidestrconsts.liskmencloseselection msgid "Enclose selection" msgstr "Kapseloi valittu lohko" #: lazarusidestrconsts.liskmevaluatemodify msgid "Evaluate/Modify" msgstr "Arvioi/Muuta" #: lazarusidestrconsts.liskmexternaltoolssettings msgid "External Tools settings" msgstr "Ulkoisten työkalujen asetukset" #: lazarusidestrconsts.liskmfindincremental msgid "Find incremental" msgstr "Etsi kirjain kerrallaan" #: lazarusidestrconsts.liskmgotomarker0 msgid "Go to marker 0" msgstr "Siirry merkkiin 0" #: lazarusidestrconsts.liskmgotomarker1 msgid "Go to marker 1" msgstr "Siirry merkkiin 1" #: lazarusidestrconsts.liskmgotomarker2 msgid "Go to marker 2" msgstr "Siirry merkkiin 2" #: lazarusidestrconsts.liskmgotomarker3 msgid "Go to marker 3" msgstr "Siirry merkkiin 3" #: lazarusidestrconsts.liskmgotomarker4 msgid "Go to marker 4" msgstr "Siirry merkkiin 4" #: lazarusidestrconsts.liskmgotomarker5 msgid "Go to marker 5" msgstr "Siirry merkkiin 5" #: lazarusidestrconsts.liskmgotomarker6 msgid "Go to marker 6" msgstr "Siirry merkkiin 6" #: lazarusidestrconsts.liskmgotomarker7 msgid "Go to marker 7" msgstr "Siirry merkkiin 7" #: lazarusidestrconsts.liskmgotomarker8 msgid "Go to marker 8" msgstr "Siirry merkkiin 8" #: lazarusidestrconsts.liskmgotomarker9 msgid "Go to marker 9" msgstr "Siirry merkkiin 9" #: lazarusidestrconsts.liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "Siirry editoriin 1" #: lazarusidestrconsts.liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "Siirry editoriin 10" #: lazarusidestrconsts.liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "Siirry editoriin 2" #: lazarusidestrconsts.liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "Siirry editoriin 3" #: lazarusidestrconsts.liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "Siirry editoriin 4" #: lazarusidestrconsts.liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "Siirry editoriin 5" #: lazarusidestrconsts.liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "Siirry editoriin 6" #: lazarusidestrconsts.liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "Siirry editoriin 7" #: lazarusidestrconsts.liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "Siirry editoriin 8" #: lazarusidestrconsts.liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "Siirry editoriin 9" #: lazarusidestrconsts.liskminsertdateandtime msgid "Insert date and time" msgstr "Liitä päivämäärä ja aika" #: lazarusidestrconsts.liskminsertusername msgid "Insert username" msgstr "Liitä käyttäjänimi" #: lazarusidestrconsts.liskminspect msgid "Inspect" msgstr "Tutki" #: lazarusidestrconsts.liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "Näppäinkaavio" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus (default)" msgstr "Lazarus (oletus)" #: lazarusidestrconsts.liskmmacosxapple msgid "Mac OS X (Apple style)" msgstr "" #: lazarusidestrconsts.liskmmacosxlaz msgid "Mac OS X (Lazarus style)" msgstr "" #: lazarusidestrconsts.liskmnewpackage msgid "New package" msgstr "Uusi paketti" #: lazarusidestrconsts.liskmnewproject msgid "New project" msgstr "Uusi projekti" #: lazarusidestrconsts.liskmnewprojectfromfile msgid "New project from file" msgstr "Uusi projekti tiedostosta" #: lazarusidestrconsts.liskmnewunit msgctxt "lazarusidestrconsts.liskmnewunit" msgid "New Unit" msgstr "Uusi käännösyksikkö" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." msgstr "" #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" msgstr "Avaa pakettitiedosto" #: lazarusidestrconsts.liskmpastecomponentsfromclipboard msgid "Paste Components from clipboard" msgstr "Liitä komponentit leikepöydältä" #: lazarusidestrconsts.liskmpauseprogram msgid "Pause program" msgstr "Keskeytä ohjelma" #: lazarusidestrconsts.liskmpublishproject msgid "Publish project" msgstr "Julkaise ohjelma" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "Nopea käännös, ei linkkausta" #: lazarusidestrconsts.liskmremoveactivefilefromproject msgid "Remove active file from project" msgstr "" #: lazarusidestrconsts.liskmrunprogram msgid "Run program" msgstr "Suorita ohjelma" #: lazarusidestrconsts.liskmsaveall msgid "SaveAll" msgstr "Tallenna kaikki" #: lazarusidestrconsts.liskmsaveas msgid "SaveAs" msgstr "Tallenna nimellä" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" msgstr "Tallenna projekti" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" msgstr "Tallenna projekti nimellä" #: lazarusidestrconsts.liskmselectlineend msgid "Select line end" msgstr "Valitse rivin loppu" #: lazarusidestrconsts.liskmselectlinestart msgid "Select line start" msgstr "Valitse rivin alku" #: lazarusidestrconsts.liskmselectpagebottom msgid "Select page bottom" msgstr "Valitse sivun loppu" #: lazarusidestrconsts.liskmselectpagetop msgid "Select page top" msgstr "Valitse sivun alku" #: lazarusidestrconsts.liskmselectwordleft msgid "Select word left" msgstr "Valitse sana vasemmalla" #: lazarusidestrconsts.liskmselectwordright msgid "Select word right" msgstr "Valitse sana oikealla" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" msgstr "Aseta vapaa kirjanmerkki" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set marker 0" msgstr "Aseta merkki 0" #: lazarusidestrconsts.liskmsetmarker1 msgid "Set marker 1" msgstr "Aseta merkki 1" #: lazarusidestrconsts.liskmsetmarker2 msgid "Set marker 2" msgstr "Aseta merkki 2" #: lazarusidestrconsts.liskmsetmarker3 msgid "Set marker 3" msgstr "Aseta merkki 3" #: lazarusidestrconsts.liskmsetmarker4 msgid "Set marker 4" msgstr "Aseta merkki 4" #: lazarusidestrconsts.liskmsetmarker5 msgid "Set marker 5" msgstr "Aseta merkki 5" #: lazarusidestrconsts.liskmsetmarker6 msgid "Set marker 6" msgstr "Aseta merkki 6" #: lazarusidestrconsts.liskmsetmarker7 msgid "Set marker 7" msgstr "Aseta merkki 7" #: lazarusidestrconsts.liskmsetmarker8 msgid "Set marker 8" msgstr "Aseta merkki 8" #: lazarusidestrconsts.liskmsetmarker9 msgid "Set marker 9" msgstr "Aseta merkki 9" #: lazarusidestrconsts.liskmstopprogram msgid "Stop program" msgstr "Pysäytä ohjelma" #: lazarusidestrconsts.liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "Siirry käännösyksikön ja lomakkeen välillä" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle marker 0" msgstr "Vaihda kirjanmerkki 0" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle marker 1" msgstr "Vaihda merkki 1" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle marker 2" msgstr "Vaihda merkki 2" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle marker 3" msgstr "Vaihda merkki 3" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle marker 4" msgstr "Vaihda merkki 4" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle marker 5" msgstr "Vaihda merkki 5" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle marker 6" msgstr "Vaihda merkki 6" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle marker 7" msgstr "Vaihda merkki 7" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle marker 8" msgstr "Vaihda merkki 8" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle marker 9" msgstr "Vaihda merkki 9" #: lazarusidestrconsts.liskmtoggleviewassembler msgid "Toggle view Assembler" msgstr "Vaihda Assembler näkymä" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" msgstr "Vaihda keskeytyskohtien näkymä" #: lazarusidestrconsts.liskmtoggleviewcallstack msgid "Toggle view Call Stack" msgstr "Vaihda kutsu-pinon näkymä" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "Vaihda näkymä koodin tutkijaan" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle view component palette" msgstr "Vaihda komponenttipaletti näkymä" #: lazarusidestrconsts.liskmtoggleviewdebugevents msgid "Toggle view Debuger Event Log" msgstr "Vaihda virheenjäljittimen tapahtumat näkymä" #: lazarusidestrconsts.liskmtoggleviewdebuggeroutput msgid "Toggle view Debugger Output" msgstr "Vaihda virheenjäljittimen tuloste näkymä" #: lazarusidestrconsts.liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "Vaihda dokumentti-editori näkymä" #: lazarusidestrconsts.liskmtoggleviewhistory msgid "Toggle view History" msgstr "Vaihda historianäkymä" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "Vaihda IDEn pikakuvakkeiden näkymä" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" msgstr "Vaihda paikallisten muuttujien näkymä" #: lazarusidestrconsts.liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "Vaihda viestien näkymä" #: lazarusidestrconsts.liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "Vaihda Object Inspector näkymä" #: lazarusidestrconsts.liskmtoggleviewpseudoterminal msgid "Toggle view Terminal Output" msgstr "Vaihda komentorivituloste näkymä" #: lazarusidestrconsts.liskmtoggleviewregisters msgid "Toggle view Registers" msgstr "Vaihda rekisterien näkymä" #: lazarusidestrconsts.liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "Vaihda hakutuloksien näkymä" #: lazarusidestrconsts.liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "Vaihda lähdekoodimuokkaimen näkymä" #: lazarusidestrconsts.liskmtoggleviewthreads msgid "Toggle view Threads" msgstr "Vaihda säienäkymä" #: lazarusidestrconsts.liskmtoggleviewwatches msgid "Toggle view Watches" msgstr "Vaihda vahtinäkymä" #: lazarusidestrconsts.liskmviewjumphistory msgid "View jump history" msgstr "Näytä hyppyhistoria" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" msgstr "Näytä projektin asetukset" #: lazarusidestrconsts.liskmviewprojectsource msgid "View project source" msgstr "Näytä projektin lähdekoodi" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" msgstr "Näytä käännösyksikön tietoja" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "" #: lazarusidestrconsts.lislaunchingcmdline msgid "Launching target command line" msgstr "" #: lazarusidestrconsts.lislazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "Lazaruksen työpöytäasetukset" #: lazarusidestrconsts.lislazarusdirectory msgid "Lazarus directory" msgstr "Lazaruksen hakemisto" #: lazarusidestrconsts.lislazarusdirectorynotfound msgid "Lazarus directory not found" msgstr "Lazaruksen hakemistoa ei löydy" #: lazarusidestrconsts.lislazarusdiroverride msgid "directory, to be used as a basedirectory" msgstr "hakemisto, käytetään kantahakemistona" #: lazarusidestrconsts.lislazaruseditorv msgid "Lazarus IDE v%s" msgstr "" #: lazarusidestrconsts.lislazarusfile msgid "Lazarus file" msgstr "Lazarus tiedosto" #: lazarusidestrconsts.lislazarusform msgid "Lazarus form" msgstr "Lazarus lomake" #: lazarusidestrconsts.lislazaruside msgid "Lazarus IDE" msgstr "" #: lazarusidestrconsts.lislazarusinclude msgid "Lazarus include file" msgstr "" #: lazarusidestrconsts.lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "" #: lazarusidestrconsts.lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "" #: lazarusidestrconsts.lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "" #: lazarusidestrconsts.lislazaruspackage msgid "Lazarus package" msgstr "Lazarus komponenttipaketti" #: lazarusidestrconsts.lislazarusproject msgid "Lazarus project" msgstr "Lazarus projekti" #: lazarusidestrconsts.lislazarusprojectinfofile msgid "Lazarus Project Info file" msgstr "Lazarus projektin tietoja" #: lazarusidestrconsts.lislazarusprojectsource msgid "Lazarus project source" msgstr "Lazarus projektin lähdekoodi" #: lazarusidestrconsts.lislazarusunit msgid "Lazarus unit" msgstr "Lazarus käännösyksikkö" #: lazarusidestrconsts.lislazbuildaboaction msgctxt "lazarusidestrconsts.lislazbuildaboaction" msgid "Action" msgstr "Toiminta" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "" #: lazarusidestrconsts.lislazbuildabopart msgid "Part" msgstr "Osa" #: lazarusidestrconsts.lislazbuildadd msgctxt "lazarusidestrconsts.lislazbuildadd" msgid "Add" msgstr "Lisää" #: lazarusidestrconsts.lislazbuildadvancedbuildoptions msgid "Advanced Build Options" msgstr "Edistyneet käännösasetukset" #: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile msgid "Are you sure you want to delete this build profile?" msgstr "" #: lazarusidestrconsts.lislazbuildbuild msgctxt "lazarusidestrconsts.lislazbuildbuild" msgid "Build" msgstr "Käännä (Build)" #: lazarusidestrconsts.lislazbuildbuildadvanced msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced" msgid "Build Advanced" msgstr "" #: lazarusidestrconsts.lislazbuildbuildcodetools msgid "Build CodeTools" msgstr "Käännä CodeTools" #: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools msgid "Build components (SynEdit, CodeTools)" msgstr "Käännä komponentit (SynEdit, CodeTools)" #: lazarusidestrconsts.lislazbuildbuildexamples msgid "Build examples" msgstr "Käännä esimerkit" #: lazarusidestrconsts.lislazbuildbuildide msgid "Build IDE" msgstr "Käännä IDE" #: lazarusidestrconsts.lislazbuildbuildjitform msgid "Build JITForm" msgstr "Käännä JITForm" #: lazarusidestrconsts.lislazbuildbuildsynedit msgid "Build SynEdit" msgstr "Käännä SynEdit" #: lazarusidestrconsts.lislazbuildcancel msgctxt "lazarusidestrconsts.lislazbuildcancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.lislazbuildcleanall msgid "Clean all" msgstr "Siivoa kaikki" #: lazarusidestrconsts.lislazbuildcleanbuild msgid "Clean+Build" msgstr "Siivoa + käännä" #: lazarusidestrconsts.lislazbuildcommonsettings msgid "Common Settings" msgstr "Yleiset asetukset" #: lazarusidestrconsts.lislazbuildconfirmbuild msgid "Confirm before build" msgstr "Varmista ennen kääntämistä" #: lazarusidestrconsts.lislazbuildconfirmdeletion msgid "Confirm deletion" msgstr "Varmista poistaminen" #: lazarusidestrconsts.lislazbuilddebugide msgid "Debug IDE" msgstr "" #: lazarusidestrconsts.lislazbuilddefines msgid "Defines" msgstr "" #: lazarusidestrconsts.lislazbuilddefineswithoutd msgid "Defines without -d" msgstr "" #: lazarusidestrconsts.lislazbuildeditdefines msgctxt "lazarusidestrconsts.lislazbuildeditdefines" msgid "Edit Defines" msgstr "" #: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption" msgid "Edit Defines" msgstr "" #: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile msgid "Edit list of defines which can be used by any profile" msgstr "" #: lazarusidestrconsts.lislazbuilderrorwritingfile msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" msgid "Error writing file" msgstr "Virhe kirjoitettaessa tiedostoa" #: lazarusidestrconsts.lislazbuildidewithoutpackages msgid "IDE without Packages" msgstr "IDE ilman paketteja" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow msgid "%s%s%s%slazbuild is non interactive, aborting now." msgstr "" #: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline msgid "Like \"make clean\" on cmd line" msgstr "Kuten \"make clean\" komentorivillä" #: lazarusidestrconsts.lislazbuildmanageprofiles msgid "Manage Build Profiles" msgstr "" #: lazarusidestrconsts.lislazbuildmanageprofiles2 msgid "Manage profiles" msgstr "" #: lazarusidestrconsts.lislazbuildnameoftheactiveprofile msgid "Name of the active profile" msgstr "" #: lazarusidestrconsts.lislazbuildnewprof msgid "Add New Profile" msgstr "" #: lazarusidestrconsts.lislazbuildnewprofinfo msgid "Current build options will be associated with:" msgstr "" #: lazarusidestrconsts.lislazbuildnone msgctxt "lazarusidestrconsts.lislazbuildnone" msgid "None" msgstr "Ei yhtään" #: lazarusidestrconsts.lislazbuildok msgctxt "lazarusidestrconsts.lislazbuildok" msgid "OK" msgstr "" #: lazarusidestrconsts.lislazbuildoptimizedide msgid "Optimized IDE" msgstr "Optimoitu IDE" #: lazarusidestrconsts.lislazbuildoptions msgid "Options:" msgstr "Asetukset:" #: lazarusidestrconsts.lislazbuildoptionspassedtocompiler msgid "Options passed to compiler" msgstr "Kääntäjän saamat asetukset" #: lazarusidestrconsts.lislazbuildprofile msgid "Profile to Build" msgstr "Käännettävä profiili" #: lazarusidestrconsts.lislazbuildrefresh msgctxt "lazarusidestrconsts.lislazbuildrefresh" msgid "Refresh" msgstr "Päivitä" #: lazarusidestrconsts.lislazbuildremove msgctxt "lazarusidestrconsts.lislazbuildremove" msgid "Remove" msgstr "Poista" #: lazarusidestrconsts.lislazbuildrename msgctxt "lazarusidestrconsts.lislazbuildrename" msgid "Rename" msgstr "Nimeä uudelleen" #: lazarusidestrconsts.lislazbuildrenameprof msgid "Rename Profile" msgstr "Nimeä profiili uudestaan" #: lazarusidestrconsts.lislazbuildrenameprofinfo msgid "New name for profile:" msgstr "Profiilin uusi nimi:" #: lazarusidestrconsts.lislazbuildrestartafterbuild msgid "Restart after building IDE" msgstr "Käynnistä uudelleen kääntämisen jälkeen" #: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" msgstr "" #: lazarusidestrconsts.lislazbuildsavesettings msgid "Save settings" msgstr "Tallenna asetukset" #: lazarusidestrconsts.lislazbuildselectprofilestobuild msgid "Select profiles to build" msgstr "Valitse käännettävät profiilit" #: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool msgid "Show confirmation dialog when building directly from Tools menu" msgstr "Kysy varmistusta kun käännös tehdään suoraan Työkalut-valikosta" #: lazarusidestrconsts.lislazbuildtargetcpu msgid "Target CPU:" msgstr "Kohde CPU:" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" msgstr "Kohde hakemisto:" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" msgstr "Kohde käyttis:" #: lazarusidestrconsts.lislazbuildunabletowritefile msgid "Unable to write file \"%s\":%s" msgstr "Tiedoston \"%s\":%s tallennus epäonnistui" #: lazarusidestrconsts.lislazbuildupdaterevinc msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc" msgid "Update revision.inc" msgstr "Päivitä revision.inc" #: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog msgid "Update revision info in \"About Lazarus\" dialog" msgstr "Päivitä revisiokenttä \"Tietoja Lazaruksesta\" ikkunassa" #: lazarusidestrconsts.lislazcleanupbuildall msgctxt "lazarusidestrconsts.lislazcleanupbuildall" msgid "Clean Up + Build all" msgstr "Siivoa + käännä kaikki" #: lazarusidestrconsts.lislclwidgettype msgid "LCL Widget Type" msgstr "" #: lazarusidestrconsts.lisldaddlinktoinherited msgid "Add link to inherited" msgstr "" #: lazarusidestrconsts.lisldcopyfrominherited msgid "Copy from inherited" msgstr "" #: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s" msgstr "" #: lazarusidestrconsts.lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "" #: lazarusidestrconsts.lisldnovalidlazdocpath msgid "No valid LazDoc path" msgstr "" #: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "" #: lazarusidestrconsts.lisleaveemptyfo msgid "Leave empty for default .po file" msgstr "" #: lazarusidestrconsts.lisleft msgctxt "lazarusidestrconsts.lisleft" msgid "Left" msgstr "Vasen" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "Vasen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen." #: lazarusidestrconsts.lisleftgroupboxcaption msgid "Left anchoring" msgstr "Vasemman reunan ankkurointi" #: lazarusidestrconsts.lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." msgstr "Tämä on naapuri-kontrolli, mihin vasen reuna on ankkuroitu. Tyhjä tarkoittaa emo-kontrollia." #: lazarusidestrconsts.lisleftsides msgid "Left sides" msgstr "Vasemmat reunat" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" msgstr "" #: lazarusidestrconsts.lislevels msgid "Levels" msgstr "Tasot" #: lazarusidestrconsts.lislfmfile msgid "LFM file" msgstr "LFM tiedosto" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" msgstr "" #: lazarusidestrconsts.lislfmisok msgid "LFM is ok" msgstr "" #: lazarusidestrconsts.lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus." msgstr "Kirjasto%sFree Pascal kirjasto (.dll windows:ssa, .so linux:ssa, .dylib MacOSX:ssa). Lazarus pitää yllä kirjaston koodia automaattisesti." #: lazarusidestrconsts.lislibrarypath msgid "library path" msgstr "kirjastopolku" #: lazarusidestrconsts.lisline msgid "Line:" msgstr "Rivi:" #: lazarusidestrconsts.lislinelength msgid "Line/Length" msgstr "Rivi/Pituus" #: lazarusidestrconsts.lislink msgid "Link:" msgstr "Linkki:" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" msgstr "" #: lazarusidestrconsts.lislinktarget msgid "Link target" msgstr "" #: lazarusidestrconsts.lislistofallcasevalues msgid "list of all case values" msgstr "" #: lazarusidestrconsts.lisloadingfailed msgid "Loading %s failed." msgstr "" #: lazarusidestrconsts.lislocals msgid "Locals" msgstr "Paikalliset" #: lazarusidestrconsts.lislocalsdlgcopyname msgid "&Copy Name" msgstr "Kopioi nimi" #: lazarusidestrconsts.lislocalsdlgcopyvalue msgid "C&opy Value" msgstr "Kopioi arvo" #: lazarusidestrconsts.lislocalsdlgname msgctxt "lazarusidestrconsts.lislocalsdlgname" msgid "Name" msgstr "Nimi" #: lazarusidestrconsts.lislocalsdlgvalue msgctxt "lazarusidestrconsts.lislocalsdlgvalue" msgid "Value" msgstr "Arvo" #: lazarusidestrconsts.lislocalsnotevaluated msgid "Locals not evaluated" msgstr "" #: lazarusidestrconsts.lislogcallstack msgid "Log Call Stack" msgstr "" #: lazarusidestrconsts.lislogcallstacklimit msgid "(frames limit. 0 - no limits)" msgstr "" #: lazarusidestrconsts.lislogevalexpression msgctxt "lazarusidestrconsts.lislogevalexpression" msgid "Eval expression" msgstr "" #: lazarusidestrconsts.lislogmessage msgid "Log Message" msgstr "" #: lazarusidestrconsts.lislogo msgid "Logo" msgstr "" #: lazarusidestrconsts.lislowercasestring msgid "lowercase string" msgstr "" #: lazarusidestrconsts.lislowercasestringgivenasparameter msgid "Lowercase string given as parameter" msgstr "" #: lazarusidestrconsts.lislrsincludefiles msgid "lrs include files" msgstr "" #: lazarusidestrconsts.lismacpascal msgid "Mac Pascal" msgstr "" #: lazarusidestrconsts.lismacro msgid "Macro %s" msgstr "" #: lazarusidestrconsts.lismacroname msgid "Macro name" msgstr "" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" msgstr "" #: lazarusidestrconsts.lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Syötä suoritusparametrit" #: lazarusidestrconsts.lismacrovalue msgid "Macro value" msgstr "Makron arvo" #: lazarusidestrconsts.lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" msgstr "Pääohjelmassa on Application.CreateForm -lause" #: lazarusidestrconsts.lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" msgstr "Pääohjelmassa on Application.Title -lause" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" msgstr "Pääohjelman Uses-lauseessa on kaikki projektin käännösyksiköt" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main Unit is Pascal Source" msgstr "" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" msgstr "" #: lazarusidestrconsts.lismakenotfound msgid "Make not found" msgstr "" #: lazarusidestrconsts.lismakeresourcestring msgid "Make ResourceString" msgstr "" #: lazarusidestrconsts.lismakeresstrappendtosection msgid "Append to section" msgstr "" #: lazarusidestrconsts.lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "" #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" msgstr "Muunnoksen optiot" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" msgid "Identifier" msgstr "Tunniste" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" msgstr "Tunnisteen pituus:" #: lazarusidestrconsts.lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "Tunnisteen etuliite:" #: lazarusidestrconsts.lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "Liitä aakkosjärjestyksessä" #: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "Liitä tilannekohtainen" #: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "" #: lazarusidestrconsts.lismakeresstrsourcepreview msgid "Source preview" msgstr "Lähdekoodin esikatselu" #: lazarusidestrconsts.lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "" #: lazarusidestrconsts.lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "" #: lazarusidestrconsts.lismaxs msgid "Max %d" msgstr "" #: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage msgid "%s Maybe you have to recompile the package." msgstr "" #: lazarusidestrconsts.lismemorydump msgid "Memory Dump" msgstr "" #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" msgstr "Keskeytä käännös" #: lazarusidestrconsts.lismenuaboutfpc msgid "About FPC" msgstr "Tietoja FPC:stä" #: lazarusidestrconsts.lismenuaddbreakpoint msgid "Add &Breakpoint" msgstr "Lisää keskeytyskohta" #: lazarusidestrconsts.lismenuaddcurfiletopkg msgid "Add active file to a package ..." msgstr "" #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add jump point to history" msgstr "Lisää hyppypiste historiaan" #: lazarusidestrconsts.lismenuaddtoproject msgid "Add editor file to Project" msgstr "Lisää aktiivinen tiedosto projektiin" #: lazarusidestrconsts.lismenuaddwatch msgid "Add &Watch ..." msgstr "Lisää vahti ..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in selection" msgstr "Rivitä valittu lohko uudelleen" #: lazarusidestrconsts.lismenubuild msgctxt "lazarusidestrconsts.lismenubuild" msgid "Build" msgstr "Käännä (Build)" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" msgstr "Käännä tiedosto" #: lazarusidestrconsts.lismenubuildlazarus msgid "Build Lazarus with current profile" msgstr "Käännä Lazarus käyttäen nykyistä profiilia" #: lazarusidestrconsts.lismenubuildlazarusprof msgid "Build Lazarus with profile: %s" msgstr "Käännä Lazarus käyttäen profiilia: %s" #: lazarusidestrconsts.lismenuchecklfm msgid "Check LFM file in editor" msgstr "Tarkista editorissa oleva LFM tiedosto" #: lazarusidestrconsts.lismenucleandirectory msgid "Clean directory ..." msgstr "Siivoa hakemisto ..." #: lazarusidestrconsts.lismenucleanupcompiled msgid "Clean up build files ..." msgstr "Siivoa käännetyt tiedostot" #: lazarusidestrconsts.lismenuclose msgctxt "lazarusidestrconsts.lismenuclose" msgid "Close" msgstr "Sulje" #: lazarusidestrconsts.lismenucloseall msgid "Close a&ll editor files" msgstr "Sulje kaikki editorin tiedostot" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" msgstr "Sulje projekti" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." msgstr "" #: lazarusidestrconsts.lismenucollectpofil msgid "Collect .po files" msgstr "Kerää .po tiedostot" #: lazarusidestrconsts.lismenucommentselection msgid "Comment selection" msgstr "Kommentoi valittu lohko (//)" #: lazarusidestrconsts.lismenucompile msgctxt "lazarusidestrconsts.lismenucompile" msgid "Compile" msgstr "Käännä (Compile)" #: lazarusidestrconsts.lismenucompileroptions msgid "Compiler Options ..." msgstr "Kääntäjän optiot ..." #: lazarusidestrconsts.lismenucompletecode msgctxt "lazarusidestrconsts.lismenucompletecode" msgid "Complete Code" msgstr "Täydennä koodi" #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Konfiguroi Käännä+Suorita tiedosto" #: lazarusidestrconsts.lismenuconfigcustomcomps msgid "Configure custom components ..." msgstr "Konfiguroi räätälöidyt komponentit" #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." msgstr "Muokkaa ulkoisia työkaluja ..." #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Konfiguroi \"Lazaruksen käännös\" ..." #: lazarusidestrconsts.lismenuconfigurehelp msgid "Configure Help ..." msgstr "Ohjeen asetukset ..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" msgstr "Tilannekohtainen ohje" #: lazarusidestrconsts.lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." msgstr "Muunna Delphi paketti Lazarukselle ..." #: lazarusidestrconsts.lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." msgstr "Muunna Delphi projekti Lazarukselle ..." #: lazarusidestrconsts.lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Muunna Delphi käännösyksikkö Lazarukselle ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm msgid "Convert binary DFM to text LFM + check syntax ..." msgstr "Muunna binaari DFM-tiedosto LFM:ksi ja tarkista syntax ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." msgstr "Muunna projektin/paketin merkistökoodaus ..." #: lazarusidestrconsts.lismenucopy msgctxt "lazarusidestrconsts.lismenucopy" msgid "Copy" msgstr "Kopioi" #: lazarusidestrconsts.lismenucreatefpdocfiles msgid "Create FPDoc files" msgstr "Luo FPDoc tiedostot" #: lazarusidestrconsts.lismenucreatepofile msgid "Create .po files" msgstr "Luo .po tiedostot" #: lazarusidestrconsts.lismenucut msgctxt "lazarusidestrconsts.lismenucut" msgid "Cut" msgstr "Leikkaa" #: lazarusidestrconsts.lismenudebugwindows msgid "Debug windows" msgstr "" #: lazarusidestrconsts.lismenudiff msgctxt "lazarusidestrconsts.lismenudiff" msgid "Diff ..." msgstr "Eroavuudet ..." #: lazarusidestrconsts.lismenuedit msgid "&Edit" msgstr "&Muokkaa" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." msgstr "Koodimallit ..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "Muokkaa tilannekohtaista ohjetta" #: lazarusidestrconsts.lismenueditinstallpkgs msgid "Install/Uninstall packages ..." msgstr "Asenna/Poista paketteja ..." #: lazarusidestrconsts.lismenueditor msgid "Menu Editor ..." msgstr "Valikkomuokkain ..." #: lazarusidestrconsts.lismenueditorcancel msgctxt "lazarusidestrconsts.lismenueditorcancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "Luo alivalikko" #: lazarusidestrconsts.lismenueditordeletefromtemplate msgid "Delete From Template ..." msgstr "" #: lazarusidestrconsts.lismenueditordeleteitem msgid "Delete Item" msgstr "Poista valikon kohta" #: lazarusidestrconsts.lismenueditorhandleonclickevent msgid "Handle OnClick Event" msgstr "Siirry käsittelemään tämän kohdan OnClick-tapahtumaa" #: lazarusidestrconsts.lismenueditorinsertfromtemplate msgid "Insert From Template ..." msgstr "Lisää valmiista malleista ..." #: lazarusidestrconsts.lismenueditorinsertnewitemafter msgid "Insert New Item (after)" msgstr "Lisää uusi valikon kohta (jälkeen)" #: lazarusidestrconsts.lismenueditorinsertnewitembefore msgid "Insert New Item (before)" msgstr "Lisää uusi valikon kohta (eteen)" #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" msgstr "Valikkomuokkain" #: lazarusidestrconsts.lismenueditormovedown msgid "Move Down (or right)" msgstr "Siirrä alaspäin (tai oikeallepäin)" #: lazarusidestrconsts.lismenueditormoveup msgid "Move Up (or left)" msgstr "Siirrä ylöspäin (tai vasemmallepäin)" #: lazarusidestrconsts.lismenueditornewtemplatedescription msgid "New Template Description ..." msgstr "" #: lazarusidestrconsts.lismenueditorsaveastemplate msgid "Save As Template ..." msgstr "Tallenna mallina ..." #: lazarusidestrconsts.lismenueditorselectmenu msgid "Select Menu:" msgstr "Valitse muokattava valikko (menu)" #: lazarusidestrconsts.lismenueditorselecttemplate msgid "Select Template:" msgstr "Valitse valmis malli:" #: lazarusidestrconsts.lismenueditortemplatepreview msgid "Template Preview" msgstr "Mallin esikatselu" #: lazarusidestrconsts.lismenuencloseinifdef msgid "Enclose in $IFDEF ..." msgstr "Kapseloi $IFDEF:n sisään ..." #: lazarusidestrconsts.lismenuencloseselection msgid "Enclose selection ..." msgstr "Kapseloi valittu lohko ..." #: lazarusidestrconsts.lismenuevaluate msgid "E&valuate/Modify ..." msgstr "Arvioi/Muuta ..." #: lazarusidestrconsts.lismenuextractproc msgid "Extract procedure ..." msgstr "Erota aliohjelma ..." #: lazarusidestrconsts.lismenufile msgid "&File" msgstr "&Tiedosto" #: lazarusidestrconsts.lismenufind msgctxt "lazarusidestrconsts.lismenufind" msgid "Find" msgstr "Etsi" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." msgstr "Etsi ..." #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find other end of code block" msgstr "Mene koodilohkon toiseen päähän (begin <-> end)" #: lazarusidestrconsts.lismenufindcodeblockstart msgid "Find code block start" msgstr "Etsi koodilohkon alku" #: lazarusidestrconsts.lismenufinddeclarationatcursor msgid "Find Declaration at cursor" msgstr "Siirry määrittelyyn" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Etsi viittauksia tunnisteisiin ..." #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in files ..." msgstr "Etsi tiedostoista ..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" msgstr "Etsi &Seuraava" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" msgstr "Etsi &Edellinen" #: lazarusidestrconsts.lismenufpdoceditor msgctxt "lazarusidestrconsts.lismenufpdoceditor" msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." msgstr "Asetukset ..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" msgstr "" #: lazarusidestrconsts.lismenugotoline msgid "Goto line ..." msgstr "Hyppää riville ..." #: lazarusidestrconsts.lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" msgstr "Arvaa väärin sijoitettu IFDEF/ENDIF" #: lazarusidestrconsts.lismenuguessunclosedblock msgid "Guess unclosed block" msgstr "Arvaa sulkematta jäänyt lohko" #: lazarusidestrconsts.lismenuhelp msgid "&Help" msgstr "&Ohje" #: lazarusidestrconsts.lismenuideinternals msgid "IDE internals" msgstr "Lazaruksen sisukset" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" msgstr "Etsi kirjain kerrallaan" #: lazarusidestrconsts.lismenuindentselection msgid "Indent selection" msgstr "Sisennä valittu lohko" #: lazarusidestrconsts.lismenuinsertchangelogentry msgid "ChangeLog entry" msgstr "" #: lazarusidestrconsts.lismenuinsertcharacter #, fuzzy #| msgid "Insert from Character Map" msgid "Insert from Character Map ..." msgstr "Lisää merkkitaulukosta ..." #: lazarusidestrconsts.lismenuinsertcvskeyword msgid "Insert CVS keyword" msgstr "Liitä CVS avainsana" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current date and time" msgstr "Päivämäärä ja aika" #: lazarusidestrconsts.lismenuinsertfilename msgid "Insert full Filename ..." msgstr "" #: lazarusidestrconsts.lismenuinsertgeneral msgid "Insert General" msgstr "Liitä kenttiä" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL notice" msgstr "GPL ilmoitus" #: lazarusidestrconsts.lismenuinsertlgplnotice msgid "LGPL notice" msgstr "LGPL ilmoitus" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" msgstr "Muunnettu LGPL ilmoitus" #: lazarusidestrconsts.lismenuinsertusername msgid "Current username" msgstr "Käyttäjätunnus" #: lazarusidestrconsts.lismenuinspect msgctxt "lazarusidestrconsts.lismenuinspect" msgid "&Inspect ..." msgstr "Tutki ..." #: lazarusidestrconsts.lismenujumpback msgid "Jump back" msgstr "Hyppää takaisin" #: lazarusidestrconsts.lismenujumpforward msgid "Jump forward" msgstr "Hyppää eteenpäin" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" msgstr "Hyppää" #: lazarusidestrconsts.lismenujumptoimplementation msgid "Jump to implementation" msgstr "Hyppää toteutukseen" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to next bookmark" msgstr "Hyppää seuraavaan kirjanmerkkiin" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to next error" msgstr "Hyppää seuraavaan virheeseen" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to previous bookmark" msgstr "Hyppää edelliseen kirjanmerkkiin" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to previous error" msgstr "Hyppää edelliseen virheeseen" #: lazarusidestrconsts.lismenulowercaseselection msgid "Lowercase selection" msgstr "Muuta pieniksi kirjaimiksi" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." msgstr "" #: lazarusidestrconsts.lismenunewform msgid "New Form" msgstr "Uusi Lomake" #: lazarusidestrconsts.lismenunewother msgid "New ..." msgstr "Uusi ..." #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." msgstr "Uusi paketti ..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." msgstr "Uusi projekti ..." #: lazarusidestrconsts.lismenunewprojectfromfile msgid "New Project from file ..." msgstr "Luo uusi projekti tiedostosta ..." #: lazarusidestrconsts.lismenunewunit msgctxt "lazarusidestrconsts.lismenunewunit" msgid "New Unit" msgstr "Uusi käännösyksikkö" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "Mukana oleva avustus" #: lazarusidestrconsts.lismenuopen msgid "&Open ..." msgstr "Avaa ..." #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open filename at cursor" msgstr "Avaa kursorin osoittama tiedosto" #: lazarusidestrconsts.lismenuopenpackage msgid "Open loaded package ..." msgstr "Avaa jo ladattu paketti ..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open package file (.lpk) ..." msgstr "Avaa pakettitiedosto (.lpk) ..." #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open package of current unit" msgstr "Avaa aktiivisen käännösyksikön paketti" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." msgstr "Avaa projekti ..." #: lazarusidestrconsts.lismenuopenrecent msgid "Open &Recent" msgstr "Avaa esillä ollut" #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open recent package" msgstr "Avaa esillä ollut paketti" #: lazarusidestrconsts.lismenuopenrecentproject msgctxt "lazarusidestrconsts.lismenuopenrecentproject" msgid "Open Recent Project" msgstr "Avaa esillä ollut projekti" #: lazarusidestrconsts.lismenupackage msgid "Pa&ckage" msgstr "Komponenttipaketti" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph" msgstr "Pakettikuvaaja" #: lazarusidestrconsts.lismenupackagelinks msgid "Package links ..." msgstr "Pakettilinkit ..." #: lazarusidestrconsts.lismenupaste msgctxt "lazarusidestrconsts.lismenupaste" msgid "Paste" msgstr "Liitä" #: lazarusidestrconsts.lismenupause msgctxt "lazarusidestrconsts.lismenupause" msgid "Pause" msgstr "Keskeytä" #: lazarusidestrconsts.lismenuprocedurelist msgctxt "lazarusidestrconsts.lismenuprocedurelist" msgid "Procedure List ..." msgstr "Aliohjelmien luettelo ..." #: lazarusidestrconsts.lismenuproject msgid "&Project" msgstr "&Projekti" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" msgstr "Projektinhallinta" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." msgstr "Projektikohtaiset asetukset ..." #: lazarusidestrconsts.lismenuprojectrun msgctxt "lazarusidestrconsts.lismenuprojectrun" msgid "&Run" msgstr "Suorita" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." msgstr "Julkaise projekti ..." #: lazarusidestrconsts.lismenuquickcompile msgid "Quick compile" msgstr "Käännä nopeasti" #: lazarusidestrconsts.lismenuquicksyntaxcheck msgid "Quick syntax check" msgstr "Nopea syntaksin tarkistus" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "Nopea syntaksin tarkistus OK" #: lazarusidestrconsts.lismenuquit msgid "&Quit" msgstr "Lopeta" #: lazarusidestrconsts.lismenuredo msgctxt "lazarusidestrconsts.lismenuredo" msgid "Redo" msgstr "Tee uudelleen" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." msgstr "Poista projektista ..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Vaihda tunnisteen nimeä ..." #: lazarusidestrconsts.lismenureplace msgctxt "lazarusidestrconsts.lismenureplace" msgid "Replace" msgstr "Etsi ja korvaa" #: lazarusidestrconsts.lismenureplace2 msgid "&Replace ..." msgstr "Etsi ja korvaa ..." #: lazarusidestrconsts.lismenureportingbug #, fuzzy #| msgid "Reporting a bug ..." msgctxt "lazarusidestrconsts.lismenureportingbug" msgid "Reporting a bug" msgstr "Virheen raportointi" #: lazarusidestrconsts.lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" msgstr "Lue uudelleen FPC lähdekoodit" #: lazarusidestrconsts.lismenuresetdebugger msgid "Reset debugger" msgstr "Nollaa virheenjäljitin" #: lazarusidestrconsts.lismenurestart msgid "Restart" msgstr "Käynnistä Lazarus uudelleen" #: lazarusidestrconsts.lismenurevert msgid "Revert" msgstr "Palauta" #: lazarusidestrconsts.lismenurun msgctxt "lazarusidestrconsts.lismenurun" msgid "&Run" msgstr "&Suorita" #: lazarusidestrconsts.lismenurunfile msgid "Run File" msgstr "Suorita tiedosto" #: lazarusidestrconsts.lismenurunparameters msgid "Run &Parameters ..." msgstr "Suoritusparametrit ..." #: lazarusidestrconsts.lismenuruntocursor msgid "Run to &cursor" msgstr "Jatka kursorin kohtaan" #: lazarusidestrconsts.lismenusave msgid "&Save" msgstr "Tallenna" #: lazarusidestrconsts.lismenusaveall msgid "Save All" msgstr "Tallenna kaikki" #: lazarusidestrconsts.lismenusaveas msgid "Save &As ..." msgstr "Tallenna nimellä ..." #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" msgstr "Tallenna projekti" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." msgstr "Tallenna projekti nimellä ..." #: lazarusidestrconsts.lismenusearch msgid "&Search" msgstr "&Etsi" #: lazarusidestrconsts.lismenuselect msgid "Select" msgstr "Valitse" #: lazarusidestrconsts.lismenuselectall msgid "Select all" msgstr "Valitse kaikki" #: lazarusidestrconsts.lismenuselectcodeblock msgid "Select code block" msgstr "Valitse koodilohko" #: lazarusidestrconsts.lismenuselectline msgid "Select line" msgstr "Valitse rivi" #: lazarusidestrconsts.lismenuselectparagraph msgid "Select paragraph" msgstr "Valitse kappale" #: lazarusidestrconsts.lismenuselecttobrace msgid "Select to brace" msgstr "Valitse sulkuun asti" #: lazarusidestrconsts.lismenuselectword msgid "Select word" msgstr "Valitse sana" #: lazarusidestrconsts.lismenusetfreebookmark msgid "Set a free bookmark" msgstr "Aseta vapaa kirjanmerkki" #: lazarusidestrconsts.lismenushowexecutionpoint msgid "S&how execution point" msgstr "Näytä suorituspiste" #: lazarusidestrconsts.lismenusortselection msgid "Sort selection ..." msgstr "Järjestä valittu lohko ..." #: lazarusidestrconsts.lismenusource msgid "S&ource" msgstr "Lähdekoodi" #: lazarusidestrconsts.lismenustepinto msgid "Step in&to" msgstr "Askella sisään" #: lazarusidestrconsts.lismenustepintocontext msgid "Step into (Context)" msgstr "Askella sisään (konteksti)" #: lazarusidestrconsts.lismenustepintoinstr msgctxt "lazarusidestrconsts.lismenustepintoinstr" msgid "Step into instruction" msgstr "Askella sisään käskyyn" #: lazarusidestrconsts.lismenustepintoinstrhint msgctxt "lazarusidestrconsts.lismenustepintoinstrhint" msgid "Step into instruction" msgstr "Askella sisään käskyyn" #: lazarusidestrconsts.lismenustepout msgid "Step o&ut" msgstr "Askella ulos" #: lazarusidestrconsts.lismenustepover msgid "&Step over" msgstr "Askella yli" #: lazarusidestrconsts.lismenustepovercontext msgid "Step over (Context)" msgstr "Askella yli (konteksti)" #: lazarusidestrconsts.lismenustepoverinstr msgctxt "lazarusidestrconsts.lismenustepoverinstr" msgid "Step over instruction" msgstr "Askella yli käskystä" #: lazarusidestrconsts.lismenustepoverinstrhint msgctxt "lazarusidestrconsts.lismenustepoverinstrhint" msgid "Step over instruction" msgstr "Askella yli käskystä" #: lazarusidestrconsts.lismenustop msgctxt "lazarusidestrconsts.lismenustop" msgid "Stop" msgstr "Pysäytä" #: lazarusidestrconsts.lismenuswapcaseselection msgid "Swap case in selection" msgstr "Käännä kirjaimen koko" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to spaces in selection" msgstr "Muuta tabit välilyönneiksi" #: lazarusidestrconsts.lismenutemplateabout msgid "About" msgstr "Tietoja" #: lazarusidestrconsts.lismenutemplateclose msgctxt "lazarusidestrconsts.lismenutemplateclose" msgid "Close" msgstr "Sulje" #: lazarusidestrconsts.lismenutemplatecontents msgid "Contents" msgstr "Konteksti" #: lazarusidestrconsts.lismenutemplatecopy msgctxt "lazarusidestrconsts.lismenutemplatecopy" msgid "Copy" msgstr "Kopioi" #: lazarusidestrconsts.lismenutemplatecut msgctxt "lazarusidestrconsts.lismenutemplatecut" msgid "Cut" msgstr "Leikkaa" #: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" msgstr "" #: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" msgstr "" #: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" msgstr "" #: lazarusidestrconsts.lismenutemplateedit msgctxt "lazarusidestrconsts.lismenutemplateedit" msgid "Edit" msgstr "Muokkaa" #: lazarusidestrconsts.lismenutemplateexit msgctxt "lazarusidestrconsts.lismenutemplateexit" msgid "Exit" msgstr "Lopeta" #: lazarusidestrconsts.lismenutemplatefile msgctxt "lazarusidestrconsts.lismenutemplatefile" msgid "File" msgstr "Tiedosto" #: lazarusidestrconsts.lismenutemplatefind msgctxt "lazarusidestrconsts.lismenutemplatefind" msgid "Find" msgstr "Etsi" #: lazarusidestrconsts.lismenutemplatefindnext msgid "Find Next" msgstr "Etsi seuraava" #: lazarusidestrconsts.lismenutemplatehelp msgctxt "lazarusidestrconsts.lismenutemplatehelp" msgid "Help" msgstr "Ohje" #: lazarusidestrconsts.lismenutemplatenew msgid "New" msgstr "Uusi" #: lazarusidestrconsts.lismenutemplateopen msgctxt "lazarusidestrconsts.lismenutemplateopen" msgid "Open" msgstr "Avaa" #: lazarusidestrconsts.lismenutemplateopenrecent msgctxt "lazarusidestrconsts.lismenutemplateopenrecent" msgid "Open Recent" msgstr "Avaa viimeksi esillä olleista" #: lazarusidestrconsts.lismenutemplatepaste msgctxt "lazarusidestrconsts.lismenutemplatepaste" msgid "Paste" msgstr "Liitä" #: lazarusidestrconsts.lismenutemplateredo msgctxt "lazarusidestrconsts.lismenutemplateredo" msgid "Redo" msgstr "Tee uudelleen" #: lazarusidestrconsts.lismenutemplatesave msgctxt "lazarusidestrconsts.lismenutemplatesave" msgid "Save" msgstr "Tallenna" #: lazarusidestrconsts.lismenutemplatesaveas msgid "Save As" msgstr "Tallenna nimellä" #: lazarusidestrconsts.lismenutemplatetutorial msgid "Tutorial" msgstr "Käyttöopastus" #: lazarusidestrconsts.lismenutemplateundo msgctxt "lazarusidestrconsts.lismenutemplateundo" msgid "Undo" msgstr "Kumoa" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle comment" msgstr "Kommentti päälle/pois" #: lazarusidestrconsts.lismenutools msgid "&Tools" msgstr "&Työkalut" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment selection" msgstr "Poista lohkon kommentointi (//)" #: lazarusidestrconsts.lismenuundo msgctxt "lazarusidestrconsts.lismenuundo" msgid "Undo" msgstr "Kumoa" #: lazarusidestrconsts.lismenuunindentselection msgid "Unindent selection" msgstr "Poista lohkon sisennys" #: lazarusidestrconsts.lismenuuppercaseselection msgid "Uppercase selection" msgstr "Muuta isoiksi kirjaimiksi" #: lazarusidestrconsts.lismenuuseunit msgctxt "lazarusidestrconsts.lismenuuseunit" msgid "Add unit to uses section ..." msgstr "Lisää käännösyksikkö uses-lauseeseen ..." #: lazarusidestrconsts.lismenuview msgid "&View" msgstr "&Näytä" #: lazarusidestrconsts.lismenuviewanchoreditor msgid "Anchor Editor" msgstr "Ankkurointi" #: lazarusidestrconsts.lismenuviewassembler msgctxt "lazarusidestrconsts.lismenuviewassembler" msgid "Assembler" msgstr "" #: lazarusidestrconsts.lismenuviewbreakpoints msgid "BreakPoints" msgstr "Keskeytyskohdat" #: lazarusidestrconsts.lismenuviewcallstack msgid "Call Stack" msgstr "Kutsupino" #: lazarusidestrconsts.lismenuviewcodebrowser msgid "Code Browser" msgstr "Koodin selain" #: lazarusidestrconsts.lismenuviewcodeexplorer msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" msgid "Code Explorer" msgstr "Koodin tutkija" #: lazarusidestrconsts.lismenuviewcomponentpalette msgid "Component Palette" msgstr "Komponenttipaletti" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" msgstr "&Komponentit" #: lazarusidestrconsts.lismenuviewdebugevents msgctxt "lazarusidestrconsts.lismenuviewdebugevents" msgid "Event Log" msgstr "Tapahtuma loki" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug output" msgstr "Virheenjäljittimen tuloste" #: lazarusidestrconsts.lismenuviewforms msgid "Forms ..." msgstr "Lomakkeet ..." #: lazarusidestrconsts.lismenuviewhistory msgctxt "lazarusidestrconsts.lismenuviewhistory" msgid "History" msgstr "Historia" #: lazarusidestrconsts.lismenuviewidespeedbuttons msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons" msgid "IDE speed buttons" msgstr "IDEn pikakuvakkeet" #: lazarusidestrconsts.lismenuviewjumphistory msgctxt "lazarusidestrconsts.lismenuviewjumphistory" msgid "Jump History" msgstr "Hyppyhistoria" #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" msgstr "Paikalliset muuttujat" #: lazarusidestrconsts.lismenuviewmessages msgctxt "lazarusidestrconsts.lismenuviewmessages" msgid "Messages" msgstr "Kääntäjän viestit" #: lazarusidestrconsts.lismenuviewobjectinspector msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" msgid "Object Inspector" msgstr "Komponenttimuokkain" #: lazarusidestrconsts.lismenuviewprojectsource msgid "&View Project Source" msgstr "" #: lazarusidestrconsts.lismenuviewpseudoterminal msgid "Terminal Output" msgstr "Komentorivin tuloste" #: lazarusidestrconsts.lismenuviewregisters msgctxt "lazarusidestrconsts.lismenuviewregisters" msgid "Registers" msgstr "Rekisterit" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "Rajoituksien selain" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" msgstr "Hakutulokset" #: lazarusidestrconsts.lismenuviewsourceeditor msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" msgid "Source Editor" msgstr "Lähdekoodi editori" #: lazarusidestrconsts.lismenuviewtaborder msgid "Tab Order" msgstr "Tabulointijärjestys" #: lazarusidestrconsts.lismenuviewthreads msgctxt "lazarusidestrconsts.lismenuviewthreads" msgid "Threads" msgstr "Säikeet" #: lazarusidestrconsts.lismenuviewtodolist msgctxt "lazarusidestrconsts.lismenuviewtodolist" msgid "ToDo List" msgstr "Tehtävälista (ToDo)" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Siirry lomakkeen ja käännösyksikön välillä" #: lazarusidestrconsts.lismenuviewunitdependencies msgid "Unit Dependencies" msgstr "Käännösyksikön riippuvuudet" #: lazarusidestrconsts.lismenuviewunitinfo msgid "Unit Information ..." msgstr "Käännösyksikön tietoja ..." #: lazarusidestrconsts.lismenuviewunits msgid "Units ..." msgstr "Käännösyksiköt ..." #: lazarusidestrconsts.lismenuviewwatches msgid "Watches" msgstr "Vahdit" #: lazarusidestrconsts.lismenuwindow msgid "&Window" msgstr "Ikkunat" #: lazarusidestrconsts.lismessagecontainsnofilepositioninformation msgid "Message contains no file position information:%s%s" msgstr "Viestissä ei ole tietoa sijainnista tiedostossa:%s%s" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" msgstr "" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" msgstr "Metodin luokkaa ei löydy" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" msgstr "Puuttuvia tapahtumia" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" msgstr "" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" msgstr "Paketteja puuttuu" #: lazarusidestrconsts.lismissingunitschoices msgid "Your choices are:" msgstr "Vaihtoehdot ovat:" #: lazarusidestrconsts.lismissingunitscomment msgid "Comment Out" msgstr "Kommentoi pois" #: lazarusidestrconsts.lismissingunitsfordelphi msgid "For Delphi only" msgstr "Vain Delphille" #: lazarusidestrconsts.lismissingunitsinfo1 msgid "1) Comment out the selected units." msgstr "1) Kommentoi pois valitut käännösyksiköt." #: lazarusidestrconsts.lismissingunitsinfo1b msgid "1) Use the units only for Delphi." msgstr "1) Käytä käännösyksikköjä vain Delphille." #: lazarusidestrconsts.lismissingunitsinfo2 msgid "2) Search for units. Found paths are added to project settings." msgstr "2) Etsi käännösyksiköitä. Löydetyt polut lisätään projektin asetuksiin." #: lazarusidestrconsts.lismissingunitsinfo3 msgid "3) Abort now, install packages or fix paths and try again." msgstr "3) Keskeytä nyt, asenna paketteja tai korjaa polut ja yritä uudelleen." #: lazarusidestrconsts.lismissingunitssearch msgid "Search Unit Path" msgstr "Etsi käännösyksikön polku" #: lazarusidestrconsts.lismissingunitsskip msgid "Skip this Unit" msgstr "Jätä tämä käännösyksikkö väliin" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lismodify msgid "&Modify" msgstr "Muuta" #: lazarusidestrconsts.lismore msgctxt "lazarusidestrconsts.lismore" msgid "More" msgstr "Lisää" #: lazarusidestrconsts.lismoveonepositiondown msgid "Move \"%s\" one position down" msgstr "Siirrä \"%s\" yksi pykälä alaspäin" #: lazarusidestrconsts.lismoveonepositionup msgid "Move \"%s\" one position up" msgstr "Siirrä \"%s\" yksi pykälä ylöspäin" #: lazarusidestrconsts.lismovepage msgid "Move Page" msgstr "Siirrä välilehdelle" #: lazarusidestrconsts.lisms msgid "(ms)" msgstr "" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Tallenna viestit tiedostoon (*.txt)" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" msgstr "Ristiriita nimissä" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" msgstr "Uuden aliohjelman nimi" #: lazarusidestrconsts.lisnever msgctxt "lazarusidestrconsts.lisnever" msgid "Never" msgstr "Ei koskaan" #: lazarusidestrconsts.lisnew msgid "new" msgstr "uusi" #: lazarusidestrconsts.lisnewancestors msgid "New Ancestors" msgstr "Uusia vanhempia" #: lazarusidestrconsts.lisnewbuildmode msgid "New build mode" msgstr "" #: lazarusidestrconsts.lisnewclass msgid "New Class" msgstr "Uusi luokka" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" msgstr "Uusi komentorivisovellus" #: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new CGI application.%sThe application source is maintained by Lazarus." msgstr "" #: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram msgid "Create a new program." msgstr "Luo uusi ohjelma" #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." msgstr "Luo uusi lähdetiedosto.%sValitse tyyppi." #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Luo uusi tyhjä tekstitiedosto." #: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe application source is maintained by Lazarus." msgstr "Luo uusi graafinen sovellus.%sLazarus pitää yllä ohjelman koodia." #: lazarusidestrconsts.lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Luo uusi pascal käännösyksikkö" #: lazarusidestrconsts.lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program source is maintained by Lazarus." msgstr "Luo uusi ohjelma.%sLazarus pitää yllä ohjelman koodia." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." msgstr "Luo uusi projekti.%sValitse tyyppi." #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "Tee uusi standardi paketti.%sPaketti on kokoelma käännösyksiköitä ja komponentteja. Soveltuu pitkälle ehtineille käyttäjille." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "Luo uusi käännösyksikkö datamodulen kanssa." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame." msgstr "Luo uusi käännösyksikkö kehyksen kanssa" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "Tee uusi käännösyksikkö ja lomake (LCL form)" #: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent msgid "Inherit from a project form or component" msgstr "Periytä projektin lomakkeesta tai komponentista" #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" msgstr "Valintoja ei ole" #: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "Valitse jotain ensin." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" msgstr "Uusi merkistö:" #: lazarusidestrconsts.lisnewgroupasetofmodes msgid "New group - a set of modes" msgstr "" #: lazarusidestrconsts.lisnewproject msgid "(new project)" msgstr "(uusi projekti)" #: lazarusidestrconsts.lisnewsetting msgid "New setting" msgstr "Uusi asetus" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections:" msgstr "Uudet tiedostot on lisätty uses-lauseeseen" #: lazarusidestrconsts.lisno msgid "No" msgstr "Ei" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" msgstr "Ei varmuuskopioita" #: lazarusidestrconsts.lisnobuildprofilesselected msgid "No profiles are selected to be built." msgstr "Yhtään profiilia ei ole valittu käännettäväksi." #: lazarusidestrconsts.lisnochange msgid "No change" msgstr "Ei muutoksia" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" msgstr "Ei valittua koodia" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "Kääntäjän asetuksia ei ole periytetty" #: lazarusidestrconsts.lisnoerrors msgid "No errors" msgstr "Ei virheitä" #: lazarusidestrconsts.lisnohints msgid "no hints" msgstr "ei vihjeitä" #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" msgstr "Ei kehitysympäristön ikkunoita valittuna" #: lazarusidestrconsts.lisnolfmfile msgid "No LFM file" msgstr "Ei LFM tiedostoa" #: lazarusidestrconsts.lisnomacroselected msgid "No macro selected" msgstr "Makroja ei ole valittuna" #: lazarusidestrconsts.lisnoname msgid "noname" msgstr "" #: lazarusidestrconsts.lisnone msgid "%snone" msgstr "%sei mikään" #: lazarusidestrconsts.lisnone2 msgid "none" msgstr "Ei mikään" #: lazarusidestrconsts.lisnoneclicktochooseone msgid "none, click to choose one" msgstr "ei mikään, klikkaa valitaksesi joku" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" msgstr "ei solmua valittuna" #: lazarusidestrconsts.lisnopascalfile msgid "No pascal file" msgstr "Ei Pascal tiedosto" #: lazarusidestrconsts.lisnoprogramfilesfound msgid "No program file %s%s%s found." msgstr "Ei ohjelma tiedosto" #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "ResourceString osiota ei löydy" #: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "" #: lazarusidestrconsts.lisnostringconstantfound msgid "No string constant found" msgstr "Merkkijonovakiota ei löydy" #: lazarusidestrconsts.lisnotaninstallpackage msgid "Not an install package" msgstr "Ei ole asennettava paketti" #: lazarusidestrconsts.lisnotavalidpascalidentifier msgid "Not a valid pascal identifier" msgstr "Ei ole kelvollinen pascalin tunniste" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "" #: lazarusidestrconsts.lisnotimplemented msgid "Not implemented" msgstr "Ei toteutettu" #: lazarusidestrconsts.lisnotimplementedyet msgid "Not implemented yet:%s%s" msgstr "Ei toteutettu vielä:%s%s" #: lazarusidestrconsts.lisnotimplementedyet2 msgid "Not implemented yet." msgstr "Ei toteutettu vielä." #: lazarusidestrconsts.lisnotnow msgid "Not now" msgstr "Ei nyt" #: lazarusidestrconsts.lisnpcreate msgid "Create" msgstr "Luo" #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" msgstr "Luo uusi projekti" #: lazarusidestrconsts.lisnpselectaprojecttype msgid "Select a project type" msgstr "Valitse projektin tyyppi" #: lazarusidestrconsts.lisnumberoffilestoconvert msgid "Number of files to convert: %s" msgstr "Muunnettavien tiedostojen määrä: %s" #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" msgstr "Object Pascal - oletus" #: lazarusidestrconsts.lisobjectpath msgid "object path" msgstr "objekti polut" #: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab msgid "Switch to Object Inspector Favorites tab" msgstr "Siirry Object Inspectorin suosikit-lehdelle" #: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking msgid "Switch to Object Inspector Favorites tab after asking for component name" msgstr "Siirry Object Inspectorin suosikit-lehdelle komponentin nimen antamisen jälkeen" #: lazarusidestrconsts.lisoff msgid "? (Off)" msgstr "? (Pois)" #: lazarusidestrconsts.lisoifaddtofavouriteproperties msgid "Add to favourite properties" msgstr "Lisää ominaisuus suosikiksi" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "Valitse kantaluokka suosikkiominaisuudelle %s%s%s." #: lazarusidestrconsts.lisoifclassnotfound msgid "Class %s%s%s not found." msgstr "Luokkaa (Class) %s%s%s ei löydy." #: lazarusidestrconsts.lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" msgstr "Poista ominaisuus suosikeista" #: lazarusidestrconsts.lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "" #: lazarusidestrconsts.lisoipautoinstallstatic msgid "auto install static" msgstr "" #: lazarusidestrconsts.lisoipdescription msgid "Description: " msgstr "Selitys: " #: lazarusidestrconsts.lisoipdescriptiondescription msgid "%sDescription: %s" msgstr "Selitys: %s" #: lazarusidestrconsts.lisoipfilename msgid "Filename: %s" msgstr "Tiedostonimi: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" msgstr "" #: lazarusidestrconsts.lisoipinstalledstatic msgid "installed static" msgstr "" #: lazarusidestrconsts.lisoipmissing msgid "missing" msgstr "puuttuu" #: lazarusidestrconsts.lisoipmodified msgid "modified" msgstr "muutettu" #: lazarusidestrconsts.lisoipnopackageselected msgid "No package selected" msgstr "Ei paketteja valittuna" #: lazarusidestrconsts.lisoipopenloadedpackage msgid "Open loaded package" msgstr "Avaa jo ladattu paketti" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" msgstr "Paketin nimi" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" msgstr "Valitse paketti" #: lazarusidestrconsts.lisoippleaseselectapackagetoopen msgid "Please select a package to open" msgstr "Valitse paketti avattavaksi" #: lazarusidestrconsts.lisoipreadonly msgid "readonly" msgstr "vai luku" #: lazarusidestrconsts.lisoipstate msgctxt "lazarusidestrconsts.lisoipstate" msgid "State" msgstr "Tila" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" msgstr "" #: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" msgstr "Tämä paketti luotiin automaattisesti" #: lazarusidestrconsts.lisok msgid "&OK" msgstr "" #: lazarusidestrconsts.lisold msgid "old" msgstr "vanha" #: lazarusidestrconsts.lisoldancestors msgid "Old Ancestors" msgstr "Entiset vanhemmat" #: lazarusidestrconsts.lisoldclass msgid "Old Class" msgstr "Vanha luokka" #: lazarusidestrconsts.lison msgid "? (On)" msgstr "? (Päällä)" #: lazarusidestrconsts.lisonbreaklineiereturnorenterkey msgid "On break line (i.e. return or enter key)" msgstr "" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" msgstr "Esittävä sana ei voi olla osa toista sanaa" #: lazarusidestrconsts.lisonpastefromclipboard msgid "On paste from clipboard" msgstr "" #: lazarusidestrconsts.lisopen msgid "Open ..." msgstr "Avaa ..." #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" msgstr "Avaa XML-tiedostona" #: lazarusidestrconsts.lisopendesigneronopenunit msgid "Open designer on open unit" msgstr "" #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" msgstr "Avaa tiedosto" #: lazarusidestrconsts.lisopenfile msgid "Open file" msgstr "Avaa tiedosto" #: lazarusidestrconsts.lisopenlfm msgid "Open %s" msgstr "Avaa %s" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" msgstr "Avaa paketti?" #: lazarusidestrconsts.lisopenpackage2 msgid "Open package %s" msgstr "Avaa paketti %s" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" msgstr "Avaa pakettitiedosto" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" msgstr "Avataanko projekti?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" msgstr "Avaa projekti" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" msgstr "Avaa projekti uudelleen" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" msgstr "Avaa projektitiedosto" #: lazarusidestrconsts.lisopensymlink msgid "Open symlink" msgstr "Avaa symlink" #: lazarusidestrconsts.lisopentarget msgid "Open target" msgstr "Avaa kohde" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "Avaa tiedosto normaalina lähdekoodina" #: lazarusidestrconsts.lisopenthepackage msgid "Open the package %s?" msgstr "Avaa paketti %s?" #: lazarusidestrconsts.lisopentheproject msgid "Open the project %s?" msgstr "Avataanko projekti %s?" #: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb msgid "Options changed, recompiling clean with -B" msgstr "Asetukset muuttuivat, käännetään kaikki option -B kanssa" #: lazarusidestrconsts.lisor msgid "or" msgstr "tai" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." msgstr "" #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectbuildmode msgid "%soverride the project build mode." msgstr "" #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau msgid "%soverride the project operating system. e.g. win32 linux. default: %s" msgstr "" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" msgstr "" #: lazarusidestrconsts.lisoverwritefile msgid "Overwrite file?" msgstr "Korvataanko tiedosto?" #: lazarusidestrconsts.lisoverwritefileondisk msgid "Overwrite file on disk" msgstr "Korvaa tällä tiedostolla" #: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot msgid "'Owner' is already used by TReader/TWriter. Please choose another name." msgstr "" #: lazarusidestrconsts.lispackage msgid "Package" msgstr "" #: lazarusidestrconsts.lispackage2 msgid "package %s" msgstr "" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" msgstr "Komponenttipaketin tietoja" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." msgstr "" #: lazarusidestrconsts.lispackagenamecontains msgid "Package name contains ..." msgstr "" #: lazarusidestrconsts.lispackageneedsinstallation msgid "Package needs installation" msgstr "" #: lazarusidestrconsts.lispackageoutputdirectories msgid "Package output directories" msgstr "" #: lazarusidestrconsts.lispackagesourcedirectories msgid "Package source directories" msgstr "" #: lazarusidestrconsts.lispackagestoinstallintheide msgid "Packages to install in the IDE" msgstr "Komponenttipaketit jotka asennetaan kehitysympäristöön" #: lazarusidestrconsts.lispackageunit msgid "package unit" msgstr "" #: lazarusidestrconsts.lisparsed msgid ", parsed " msgstr "" #: lazarusidestrconsts.lispascalsourcefile msgid "Pascal source file" msgstr "" #: lazarusidestrconsts.lispascalunit msgid "Pascal unit" msgstr "" #: lazarusidestrconsts.lispasscount msgid "Pass Count" msgstr "" #: lazarusidestrconsts.lispasteclipboard msgid "paste clipboard" msgstr "liitä leikepöydältä" #: lazarusidestrconsts.lispastetextfromclipboard msgid "Paste text from clipboard" msgstr "Liitä teksti leikepöydältä" #: lazarusidestrconsts.lispath msgid "Path" msgstr "Polku" #: lazarusidestrconsts.lispatheditbrowse msgctxt "lazarusidestrconsts.lispatheditbrowse" msgid "Browse" msgstr "Selaa" #: lazarusidestrconsts.lispatheditmovepathdown msgid "Move path down" msgstr "Siirrä polku alas" #: lazarusidestrconsts.lispatheditmovepathup msgid "Move path up" msgstr "Siirrä polku ylös" #: lazarusidestrconsts.lispatheditpathtemplates msgid "Path templates" msgstr "Polkujen mallit" #: lazarusidestrconsts.lispatheditsearchpaths msgid "Search paths:" msgstr "Hakupolut:" #: lazarusidestrconsts.lispatheditselectdirectory msgid "Select directory" msgstr "Valitse hakemisto" #: lazarusidestrconsts.lispathofthemakeutility msgid "Path of the make utility" msgstr "Polku make-työkaluun" #: lazarusidestrconsts.lispathtoinstance msgid "Path to failed Instance:" msgstr "Polku epäonnistuneeseen tapaukseen:" #: lazarusidestrconsts.lispckeditaddanitem msgid "Add an item" msgstr "" #: lazarusidestrconsts.lispckeditaddtoproject msgctxt "lazarusidestrconsts.lispckeditaddtoproject" msgid "Add to project" msgstr "Lisää projektiin" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" msgstr "Toteuta muutokset" #: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Kutsu valitun käännösyksikön %sRegisteröintiä%s" #: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency msgid "Clear default/preferred filename of dependency" msgstr "" #: lazarusidestrconsts.lispckeditcompile msgctxt "lazarusidestrconsts.lispckeditcompile" msgid "Compile" msgstr "Käännä" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" msgstr "Käännä kaikki" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" msgstr "Käännä komponenttipaketti" #: lazarusidestrconsts.lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" msgstr "Paketin %s käännösasetukset" #: lazarusidestrconsts.lispckeditcompopts msgctxt "lazarusidestrconsts.lispckeditcompopts" msgid "Compiler Options" msgstr "Kääntäjän asetukset" #: lazarusidestrconsts.lispckeditcreatemakefile msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" msgid "Create Makefile" msgstr "Luo Make-tiedosto" #: lazarusidestrconsts.lispckeditdefault msgid "%s, default: %s" msgstr "" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" msgstr "Riippuvuuden ominaisuudet" #: lazarusidestrconsts.lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Muokkaa yleisiä asetuksia" #: lazarusidestrconsts.lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Muokkaa paketin käännösasetuksia" #: lazarusidestrconsts.lispckeditfileproperties msgid "File Properties" msgstr "Tiedoston ominaisuudet" #: lazarusidestrconsts.lispckeditgeneraloptions msgid "General Options" msgstr "Yleiset asetukset" #: lazarusidestrconsts.lispckedithelp msgctxt "lazarusidestrconsts.lispckedithelp" msgid "Help" msgstr "Ohje" #: lazarusidestrconsts.lispckeditinstall msgid "Install" msgstr "Asenna" #: lazarusidestrconsts.lispckeditinstallpackageintheide msgid "Install package in the IDE" msgstr "Asenna paketti kehitysympäristöön" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "Kelvoton maximiversio" #: lazarusidestrconsts.lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "Kelvoton minimiversio" #: lazarusidestrconsts.lispckeditmaximumversion msgid "Maximum Version:" msgstr "Maximiversio:" #: lazarusidestrconsts.lispckeditminimumversion msgid "Minimum Version:" msgstr "Minimiversio:" #: lazarusidestrconsts.lispckeditmodified msgid "Modified: %s" msgstr "Muunnettu: %s" #: lazarusidestrconsts.lispckeditmore msgid "More >>" msgstr "Muut >>" #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" msgstr "Siirrä riippuvuutta alaspäin" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" msgstr "Siirrä riippuvuutta ylöspäin" #: lazarusidestrconsts.lispckeditpackage msgid "Package %s" msgstr "Komponenttipaketti %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" msgstr "Komponenttipaketti %s%s%s on muuttunut.%sTallennetaanko?" #: lazarusidestrconsts.lispckeditpackagenotsaved msgid "package %s not saved" msgstr "komponenttipakettia %s ei ole tallennettu" #: lazarusidestrconsts.lispckeditpage msgid "%s, Page: %s" msgstr "%s, Komponenttipaletin välilehti: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" msgstr "Palauta riippuvuus" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" msgstr "" #: lazarusidestrconsts.lispckeditreadonly msgid "Read Only: %s" msgstr "Tämä on vain luettavissa: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired msgid "Recompile all required" msgstr "" #: lazarusidestrconsts.lispckeditrecompileclean msgid "Recompile clean" msgstr "" #: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "" #: lazarusidestrconsts.lispckeditregisteredplugins msgid "Registered plugins" msgstr "" #: lazarusidestrconsts.lispckeditregisterunit msgid "Register unit" msgstr "" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" msgstr "Poista riippuvuus" #: lazarusidestrconsts.lispckeditremovedependency2 msgid "Remove Dependency?" msgstr "" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "" #: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" msgstr "Poista tiedosto" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" msgstr "Poistetaanko tiedosto?" #: lazarusidestrconsts.lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgstr "Poistetaanko tiedosto %s%s%s%skomponenttipaketista %s%s%s?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" msgstr "" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" msgstr "Tarvittavat komponenttipaketit" #: lazarusidestrconsts.lispckeditsavechanges msgid "Save Changes?" msgstr "Talletetaanko muutokset?" #: lazarusidestrconsts.lispckeditsavepackage msgid "Save package" msgstr "Tallenna komponenttipaketti" #: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency msgid "Store file name as default for this dependency" msgstr "" #: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency msgid "Store file name as preferred for this dependency" msgstr "" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" msgstr "Poista asennuksesta" #: lazarusidestrconsts.lispckeditviewpackagesource msgctxt "lazarusidestrconsts.lispckeditviewpackagesource" msgid "View Package Source" msgstr "" #: lazarusidestrconsts.lispckexplautocreated msgid "AutoCreated" msgstr "" #: lazarusidestrconsts.lispckexplinstalled msgid "Installed" msgstr "Asennettu" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" msgstr "Asennetaan seuraavan käynnistyksen yhteydessä" #: lazarusidestrconsts.lispckexplisrequiredby msgid "Selected package is required by:" msgstr "Valittu komponenttipaketti käyttää:" #: lazarusidestrconsts.lispckexplloadedpackages msgid "Loaded Packages:" msgstr "" #: lazarusidestrconsts.lispckexplpackagenotfound msgid "Package %s not found" msgstr "Komponenttipakettia %s ei löydetty" #: lazarusidestrconsts.lispckexplstate msgid "%sState: " msgstr "%sTila:" #: lazarusidestrconsts.lispckexpluninstallonnextstart msgid "Uninstall on next start" msgstr "" #: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "" #: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "" #: lazarusidestrconsts.lispckoptsauthor msgid "Author:" msgstr "Tekijä:" #: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" msgstr "" #: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "" #: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "" #: lazarusidestrconsts.lispckoptscustom msgid "Custom" msgstr "" #: lazarusidestrconsts.lispckoptsdescriptionabstract msgid "Description/Abstract" msgstr "" #: lazarusidestrconsts.lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" msgstr "" #: lazarusidestrconsts.lispckoptsdesigntimeonly msgid "Designtime only" msgstr "" #: lazarusidestrconsts.lispckoptsideintegration msgid "IDE Integration" msgstr "" #: lazarusidestrconsts.lispckoptsinclude msgid "Include" msgstr "" #: lazarusidestrconsts.lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "" #: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation" msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" msgstr "Aliohjelmakirjasto" #: lazarusidestrconsts.lispckoptslicense msgid "License:" msgstr "Lisenssi:" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" msgstr "" #: lazarusidestrconsts.lispckoptsmajor msgid "Major" msgstr "" #: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "" #: lazarusidestrconsts.lispckoptsminor msgid "Minor" msgstr "" #: lazarusidestrconsts.lispckoptsobject msgid "Object" msgstr "" #: lazarusidestrconsts.lispckoptspackageoptions msgid "Package Options" msgstr "" #: lazarusidestrconsts.lispckoptspackagetype msgid "PackageType" msgstr "" #: lazarusidestrconsts.lispckoptsprovides msgid "Provides" msgstr "" #: lazarusidestrconsts.lispckoptsrelease msgid "Release" msgstr "" #: lazarusidestrconsts.lispckoptsruntimeonly msgid "Runtime only" msgstr "" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgstr "" #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "" #: lazarusidestrconsts.lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "" #: lazarusidestrconsts.lispckoptsusage msgid "Usage" msgstr "" #: lazarusidestrconsts.lispdabort msgctxt "lazarusidestrconsts.lispdabort" msgid "Abort" msgstr "Keskeytä" #: lazarusidestrconsts.lispdprogress msgid "Progress" msgstr "" #: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts.lispecollapsedirectory msgid "Collapse directory" msgstr "Supista hakemisto" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" msgstr "" #: lazarusidestrconsts.lispedirectories msgid "Directories" msgstr "Hakemistot" #: lazarusidestrconsts.lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "Muokkaa virtuaalista käännösyksikköä" #: lazarusidestrconsts.lispeexpanddirectory msgid "Expand directory" msgstr "Laajenna hakemisto" #: lazarusidestrconsts.lispefilename msgid "Filename:" msgstr "Tiedostonimi:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" msgstr "Korjaa tiedostojen kirjainkoko" #: lazarusidestrconsts.lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Kelvoton käännösyksikön tiedostonimi" #: lazarusidestrconsts.lispeinvalidunitname msgid "Invalid unitname" msgstr "Kelvoton käännösyksikön nimi" #: lazarusidestrconsts.lispemissingfilesofpackage msgid "Missing files of package %s" msgstr "Paketin %s puuttuvat tiedostot" #: lazarusidestrconsts.lispemovefiledown msgid "Move file down" msgstr "Siirrä tiedosto alas" #: lazarusidestrconsts.lispemovefileup msgid "Move file up" msgstr "Siirrä tiedosto ylös" #: lazarusidestrconsts.lispenewfilenotinincludepath msgid "New file not in include path" msgstr "" #: lazarusidestrconsts.lispenofilesmissingallfilesexist msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist" msgid "No files missing. All files exist." msgstr "Ei puuttuvia tiedostoja. Kaikki löytyvät." #: lazarusidestrconsts.lisperemovefiles msgid "Remove files" msgstr "Poista tiedostot" #: lazarusidestrconsts.lisperemoveselectedfiles msgid "Remove selected files" msgstr "Poista valitut tiedostot" #: lazarusidestrconsts.lisperevertpackage msgid "Revert package" msgstr "Palauta paketti" #: lazarusidestrconsts.lispesavepackageas msgid "Save package as" msgstr "Tallenna paketti nimellä" #: lazarusidestrconsts.lispeshowdirectoryhierarchy msgid "Show directory hierarchy" msgstr "Näytä hakemistorakenne" #: lazarusidestrconsts.lispeshowmissingfiles msgid "Show missing files" msgstr "Näytä puuttuvat tiedostot" #: lazarusidestrconsts.lispesortfiles msgid "Sort files" msgstr "Järjestä tiedostot" #: lazarusidestrconsts.lispesortfilesalphabetically msgid "Sort files alphabetically" msgstr "Järjestä tiedostot aakkosjärjestykseen" #: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" msgstr "" #: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses" msgid "The unitname is used when the IDE extends uses clauses." msgstr "Käännösyksikön nimeä käytetään kun Lazarus laajentaa uses-lauseketta." #: lazarusidestrconsts.lispeunitname msgid "Unitname:" msgstr "Käännösyksikön nimi:" #: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "" #: lazarusidestrconsts.lispeuseallunitsindirectory msgid "Use all units in directory" msgstr "Käytä kaikkia käännösyksiköitä hakemistossa" #: lazarusidestrconsts.lispeusenounitsindirectory msgid "Use no units in directory" msgstr "Älä käytä käännösyksiköitä hakemistossa" #: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" msgstr "" #: lazarusidestrconsts.lispkgdefsoutputdirectory msgid "Output directory" msgstr "Tulostehakemisto" #: lazarusidestrconsts.lispkgdefssrcdirmark msgid "Package Source Directory Mark" msgstr "" #: lazarusidestrconsts.lispkgdefsunitpath msgid "Unit Path" msgstr "Käännösyksiköiden polku" #: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Tahdotko todella unohtaa kaikki paketin %s muutokset ja ladata sen uudelleen?" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Uusi käännösyksikkö ei ole hakupolussa" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" msgstr "Julkaise paketti" #: lazarusidestrconsts.lispkgeditrevertpackage msgid "Revert package?" msgstr "Palauta paketti?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?" msgstr "Tiedosto %s%s%s%sei ole komponenttipaketin hakupolussa.%s%sLisätäänkö %s%s%s polkuun?" #: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" msgstr "Avustusta ei ole vielä tehty" #: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "Näpäyttämällä hiiren oikeaa näppäintä saat esiin ponnahdusvalikon jossa on kaikki saatavissa olevat komponenttipakettiin liittyvät toiminnallisuudet" #: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" msgstr "Lista lisätoiminnoista" #: lazarusidestrconsts.lispkgfiletypebinary msgctxt "lazarusidestrconsts.lispkgfiletypebinary" msgid "Binary" msgstr "Binaari" #: lazarusidestrconsts.lispkgfiletypeinclude msgid "Include file" msgstr "" #: lazarusidestrconsts.lispkgfiletypeissues msgid "Issues xml file" msgstr "" #: lazarusidestrconsts.lispkgfiletypelfm msgid "LFM - Lazarus form text" msgstr "" #: lazarusidestrconsts.lispkgfiletypelrs msgid "LRS - Lazarus resource" msgstr "" #: lazarusidestrconsts.lispkgfiletypemainunit msgid "Main Unit" msgstr "Pää-käännösyksikkö" #: lazarusidestrconsts.lispkgfiletypetext msgctxt "lazarusidestrconsts.lispkgfiletypetext" msgid "Text" msgstr "Teksti" #: lazarusidestrconsts.lispkgfiletypeunit msgctxt "lazarusidestrconsts.lispkgfiletypeunit" msgid "Unit" msgstr "Käännösyksikkö" #: lazarusidestrconsts.lispkgfiletypevirtualunit msgid "Virtual Unit" msgstr "Virtuaalinen käännösyksikkö" #: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid msgid "Package directory. Parameter is package ID" msgstr "Paketti-hakemisto. Parametri on paketin ID" #: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid msgid "Package include files search path. Parameter is package ID" msgstr "" #: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid msgid "Package source search path. Parameter is package ID" msgstr "" #: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid msgid "Package unit search path. Parameter is package ID" msgstr "" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" msgstr "Lisätään uusi riippuvuus paketille %s: paketti %s%s" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" msgstr "Lisätään uusi riippuvuus projektille %s: paketti %s%s" #: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "Lisää käännösyksikkö uses-lausekkeeseen. Estä se vain yksiköiltä, joita ei saa koskaan kääntää." #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Löytyi moniselitteisiä käännösyksiköitä" #: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." msgstr "Tarvittavaa pakettia ei löytynyt. Katso paketti-luettelosta." #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Automaattisesti asennettavat komponenttipaketit" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "" #: lazarusidestrconsts.lispkgmangbrokendependency msgid "Broken dependency" msgstr "" #: lazarusidestrconsts.lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" msgstr "" #: lazarusidestrconsts.lispkgmangcompilingpackage msgid "Compiling package %s" msgstr "Käännetään pakettia %s" #: lazarusidestrconsts.lispkgmangdeletefailed msgid "Delete failed" msgstr "Poistaminen epäonnistui" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Poistetaanko vanha paketti-tiedosto?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" msgstr "Poistetaanko vanha paketti-tiedosto %s%s%s?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Riippuvuus ilman omistajaa: %s" #: lazarusidestrconsts.lispkgmangerrorreadingfile msgid "Error reading file" msgstr "Virhe luettaessa tiedostoa" #: lazarusidestrconsts.lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "Virhe luettaessa pakettia" #: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage msgid "Error: updating po files failed for package %s" msgstr "Virhe päivitettäessä po tiedostoja paketille %s" #: lazarusidestrconsts.lispkgmangerrorwritingfile msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" msgid "Error writing file" msgstr "Virhe kirjoitettaessa tiedostoa" #: lazarusidestrconsts.lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "Virhe kirjoitettaessa pakettia" #: lazarusidestrconsts.lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "Tiedosto on jo projektissa" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" msgstr "Tiedosto on projektissa" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "Tiedostonimi eroaa paketin nimestä" #: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "Tiedostonimi on toisen paketin käytössä" #: lazarusidestrconsts.lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "Tiedostonimi on projektin käytössä" #: lazarusidestrconsts.lispkgmangfilenotfound msgid "File %s%s%s not found." msgstr "Tiedostoa %s%s%s ei löytynyt." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" msgstr "Tiedostoa ei ole tallennettu" #: lazarusidestrconsts.lispkgmangignoreandsavepackagenow msgid "Ignore and save package now" msgstr "" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" msgstr "Asennettaessa komponettipaketti %s asennataan automaattisesti paketti:" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" msgstr "Asennettaessa komponettipaketti %s asennataan automaattisesti paketit:" #: lazarusidestrconsts.lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" msgstr "Kelvoton kääntäjän tiedostonimi" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "Kelvoton tiedoston tarkennin" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "Kelvoton paketti-tiedoston tarkennin" #: lazarusidestrconsts.lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "Kelvoton paketin tiedostonimi" #: lazarusidestrconsts.lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Kelvoton paketin nimi" #: lazarusidestrconsts.lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "Kelvoton paketin nimi" #: lazarusidestrconsts.lispkgmanglazarus msgctxt "lazarusidestrconsts.lispkgmanglazarus" msgid "Lazarus" msgstr "" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgstr "" #: lazarusidestrconsts.lispkgmangnewpackage msgid "NewPackage" msgstr "" #: lazarusidestrconsts.lispkgmangpackage msgid "Package: %s" msgstr "Paketti: %s" #: lazarusidestrconsts.lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "Paketti %s%s%s on muuttunut. Talletetaanko?" #: lazarusidestrconsts.lispkgmangpackageconflicts msgid "Package conflicts" msgstr "" #: lazarusidestrconsts.lispkgmangpackagefilemissing msgid "Package file missing" msgstr "Paketti-tiedosto puuttuu" #: lazarusidestrconsts.lispkgmangpackagefilenotsaved msgid "Package file not saved" msgstr "Paketti-tiedostoa ei ole talletettu" #: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" msgstr "Paketilla %s%s%s ei ole kelvollista tulostushakemistoa:%s%s%s%s" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "Ei ole suunnitteluaikainen komponenttipaketti" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" msgstr "Komponenttipaketti tarvitaan" #: lazarusidestrconsts.lispkgmangpackagemainsourcefile msgid "package main source file" msgstr "paketin pää-lähdekooditiedosto" #: lazarusidestrconsts.lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "Paketti samalla nimellä on jo olemassa" #: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "Paketilla pitää olla pääte .lpk" #: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst msgid "Please compile the package first." msgstr "" #: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "Tallenna tiedosto ennen sen lisäämistä pakettiin." #: lazarusidestrconsts.lispkgmangproject msgid "Project: %s" msgstr "Projekti: %s" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Käännetäänkö Lazarus uudelleen?" #: lazarusidestrconsts.lispkgmangrenamefileinpackage msgid "Rename file in package?" msgstr "Vaihdetaanko tiedoston nimeä komponenttipaketissa?" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts.lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "Korvaa nykyinen tiedosto %s%s%s?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" msgstr "Korvaa tiedosto" #: lazarusidestrconsts.lispkgmangsavepackage msgid "Save Package?" msgstr "Tallenna paketti?" #: lazarusidestrconsts.lispkgmangsavepackage2 msgid "Save package?" msgstr "Tallenna paketti?" #: lazarusidestrconsts.lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" msgstr "Tallenna komponenttipaketti %s (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "Pitäisikö tiedoston nimi olla pienillä kirjaimilla:%s%s%s%s?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" msgstr "Ohita tämä paketti" #: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "" #: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "Kääntäjä paketille %s ei ole suoritettava ohjelma:%s%s" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" msgid "The file %s%s%s%sis already in the package %s." msgstr "Tiedosto %s%s%s%son jo paketissa %s." #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." msgstr "Tiedosto %s%s%s ei ole Lazarus paketti." #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgstr "" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgstr "" #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgstr "" #: lazarusidestrconsts.lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." msgstr "Tiedosto %s%s%s%spaketista %s puuttuu." #: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "Seuraavan komponenttipaketin lataaminen epäonnistui:" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "Seuraavien komponenttipakettien lataaminen epäonnistui:" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgstr "%sSeuraavat käännösyksiköt lisätään tiedoston %s uses-lauseeseen :%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgstr "Komponenttipaketin %s%s%s kääntäminen epäonnistui.%sPoistetaanko se asennuksesta?" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgstr "Komponenttipaketti %s on ainoastaan ajonaikainen.%sVain ajonaikaisia komponenttipaketteja ei asenneta kehitysympäristöön." #: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates a circle.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" msgstr "Komponenttipaketti %s%s%s oli merkitty asennettavaksi mutta sitä ei löydetty. Poistetaanko tämä riippuvuus komponettipakettien asennusluettelosta?" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgstr "Komponenttipakettia %s tarvitaan komponettipaketissa %s, mikä on merkitty asennukseen.%sKatso komponenttipakettien kuvauksista" #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" msgstr "Komponenttipaketti %s omistaa tiedoston%s%s%s%s.%sPitäisikö tuota komponenttipaketin nimeäkin myöskin muuttaa?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "Komponenttipaketti %s%s%s oli merkitty.%sNykyinen Lazarus tukee ainoastaan staattisesti linkitettyjä komponenttipaketteja. komponenttipakettien poistaminen vaatii Lazaruksen uudelleen käääntämisen ja käynnistämisen.%s%sTehdäänkö se nyt?" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "Paketti %s%s%s on merkitty asennettavaksi.%sNykyinen lazarus tukee ainoastaan staattisesti linkattuja paketteja. Asennus vaatii Lazaruksen uudelleen rakentamisen ja uudelleen käynnistämisen.%s%sHaluako tehdä sen nyt?" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgstr "Sovellus tarvitsee komponenttipaketin %s%s%s.%sMutta sitä ei löydy (tai ei ole asennettu). Katso projektivalikon kohtaa -> Projektinhallinta." #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." msgstr "" #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "Tämä on virtuaalinen paketti eikä sillä ole vielä lähdekoodia. Tallenna se ensin." #: lazarusidestrconsts.lispkgmangunabletocreatedirectory msgid "Unable to create directory" msgstr "Kansion luonti epäonnistui" #: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." msgstr "" #: lazarusidestrconsts.lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." msgstr "Tiedoston %s%s%s. poistaminen ei onnistu" #: lazarusidestrconsts.lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "Tiedoston poistaminen ei onnistu" #: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "Paketin lataaminen ei onnistu" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgstr "Ei pystytä avaamaan komponenttipakettia %s%s%s.%sTämä komponenttipaketti oli merkitty asennettavaksi." #: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Poistetaanko paketti asennuksesta?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 msgid "Uninstall package %s?" msgstr "Poistetaanko paketti %s ?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" msgstr "Tallentamaton paketti" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" msgstr "Käytä käännösyksikköä" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Varoitus: Tiedosto %s%s%s%skuuluu jo projektiin." #: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" msgstr "Ei voi rekisteröidä komponenttia ilman käännösyksikköä" #: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" msgstr "" #: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" msgstr "" #: lazarusidestrconsts.lispkgsysfilename msgid "%s%sFile Name: %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "" #: lazarusidestrconsts.lispkgsysinvalidunitname msgid "Invalid Unitname: %s" msgstr "" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" msgstr "" #: lazarusidestrconsts.lispkgsyspackageregistrationerror msgid "Package registration error" msgstr "" #: lazarusidestrconsts.lispkgsysregisterprocedureisnil msgid "Register procedure is nil" msgstr "" #: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." msgstr "" #: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" msgstr "" #: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - Free Pascal Component Library provides the base classes for Object Pascal." msgstr "" #: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." msgstr "" #: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgstr "" #: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." msgstr "" #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." msgstr "" #: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." msgstr "" #: lazarusidestrconsts.lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sKäännösyksikön nimi: %s%s%s" #: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit." msgstr "" #: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk" msgid "Unit \"%s\" was removed from package (lpk)" msgstr "" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "Tämä tiedosto ei ole missään ladatussa paketissa." #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" msgstr "Paketin %s%s%s lukeminen ei onnistu.%sVirhe: %s" #: lazarusidestrconsts.lispldexists msgid "Exists" msgstr "On olemassa" #: lazarusidestrconsts.lispldglobal msgctxt "lazarusidestrconsts.lispldglobal" msgid "Global" msgstr "Yleinen" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" msgstr "Vain olemassaolevat tiedostot" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" msgstr "Paketti-linkit" #: lazarusidestrconsts.lispldshowgloballinks msgid "Show global links" msgstr "Näytä yleiset linkit" #: lazarusidestrconsts.lispldshowuserlinks msgid "Show user links" msgstr "Näytä käyttäjän linkit" #: lazarusidestrconsts.lisplduser msgid "User" msgstr "Käyttäjä" #: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow msgid "Please fix the error shown in the message window, which is normally below the source editor." msgstr "Korjaa viesti-ikkunassa näkyvä virhe." #: lazarusidestrconsts.lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "Avaa käänösyksikkö ennen suoritusta." #: lazarusidestrconsts.lispleaseselectabuildmodefirst msgid "Please select a build mode first." msgstr "" #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "Valitse ensin jokin koodin osa josta tehdään uusi aliohjelma tai metodi" #: lazarusidestrconsts.lisplistall msgid "" msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" msgstr "" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "Kopio metodin nimi leikepöydälle" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" msgstr "" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" msgstr "" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" msgstr "Hyppää valintaan" #: lazarusidestrconsts.lisplistnone msgid "" msgstr "" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" msgstr "Luokka" #: lazarusidestrconsts.lisplistprocedurelist msgid "Procedure List" msgstr "" #: lazarusidestrconsts.lisplisttype msgctxt "lazarusidestrconsts.lisplisttype" msgid "Type" msgstr "Tyyppi" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "" #: lazarusidestrconsts.lispointer msgid "Pointer" msgstr "" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" msgstr "" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" msgstr "" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" msgstr "" #: lazarusidestrconsts.lisprecedingword msgid "Preceding word" msgstr "" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " msgstr "" #: lazarusidestrconsts.lisprimaryconfigpath msgid "Primary config path" msgstr "" #: lazarusidestrconsts.lisprint msgid "Print" msgstr "Tulosta" #: lazarusidestrconsts.lisprivate msgid "Private" msgstr "" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" msgstr "Private - metodi" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s" msgstr "" #: lazarusidestrconsts.lisprocedure msgctxt "lazarusidestrconsts.lisprocedure" msgid "Procedure" msgstr "Aliohjelma" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" msgstr "Aliohjelma ja sen rajapinta" #: lazarusidestrconsts.lisprogram msgctxt "lazarusidestrconsts.lisprogram" msgid "Program" msgstr "Ohjelma" #: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus." msgstr "Ohjelma%s Free Pascal ohjelma. Lazarus pitää yllä ohjelman koodia automaattisesti." #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" msgstr "Tunnistettiin ohjelmaksi" #: lazarusidestrconsts.lisprogramnotfound msgid "Program %s not found" msgstr "" #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "Ohjelman lähdekoodin tiedosto tarkennin pitää olla .pas, .pp tai .lpr" #: lazarusidestrconsts.lisprojaddaddfilestoproject msgid "Add files to project" msgstr "" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" msgstr "Lisää tiedosto projektiin:" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "" #: lazarusidestrconsts.lisprojaddeditorfile msgid "Add editor files" msgstr "Lisää editorissa avoinna olevia tiedostoja" #: lazarusidestrconsts.lisprojaddfiles msgid "Add files" msgstr "Lisää tiedostoja" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidpackagename msgid "Invalid packagename" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" msgstr "" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" msgstr "" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" msgstr "" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" msgstr "Komponenttipakettia ei löytynyt" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgstr "Riippuvuutta %s%s%s ei löytynyt.%sValitse jokin toinen komponenttipaketti." #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgstr "" #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgstr "Käännösyksikkö %s%s%s on jo projektissa%stiedostona: %s%s%s." #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lisprojaddtoproject msgctxt "lazarusidestrconsts.lisprojaddtoproject" msgid "Add to project" msgstr "Lisää projektiin" #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Käännösyksikön nimi on jo olemassa" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" msgstr "Projekti on muuttunut" #: lazarusidestrconsts.lisprojectchangedondisk msgid "Project changed on disk" msgstr "Projektin tallennus on muuttunut" #: lazarusidestrconsts.lisprojectdirectory msgctxt "lazarusidestrconsts.lisprojectdirectory" msgid "Project directory" msgstr "" #: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar msgid "Title in taskbar shows also directory path of the project" msgstr "" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" msgstr "" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" msgstr "" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" msgstr "Tunnistettiin 'Project Info'-tiedostoksi" #: lazarusidestrconsts.lisprojectinformation msgid "Project Information" msgstr "" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" msgstr "Projekti on ajettavissa virheenjäljittimessä" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" msgstr "Projektin makron ominaisuudet" #: lazarusidestrconsts.lisprojectmacrounitpath msgid "macro ProjectUnitPath" msgstr "" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" msgstr "Projektin tulostehakemisto (esim. ppu hakemisto)" #: lazarusidestrconsts.lisprojectoutputdirectory msgid "Project output directory" msgstr "Projektin tulostehakemisto" #: lazarusidestrconsts.lisprojectpath msgid "Project Path:" msgstr "Projektin polku:" #: lazarusidestrconsts.lisprojectpathhint msgid "Directory where project's main file must be" msgstr "Hekemisto missä projektin päätiedoston pitää olla" #: lazarusidestrconsts.lisprojectsourcedirectories msgid "Project source directories" msgstr "Projektin lähdehakemisto" #: lazarusidestrconsts.lisprojectsraisedexceptionataddress msgid "%0:s%0:s At address %1:x" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclasss msgid "Project %s raised exception class '%s'." msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess msgid "Project %s raised exception class '%s' with message:%s%s" msgstr "Projekti %s nosti poikkeuksen luokalla '%s' jossa viestinä oli:%s%s" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress msgid "%0:s%0:s In file '%1:s' at address %2:x" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptioninfileline msgid "%0:s%0:s In file '%1:s' at line %2:d" msgstr "" #: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" msgstr "" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Projektin Src hakemisto" #: lazarusidestrconsts.lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built" msgstr "Projekti %s%s%s on onnistuneesti käännetty (built)" #: lazarusidestrconsts.lisprojectunit msgid "project unit" msgstr "Projektin käännösyksikkö" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" msgstr "Projektin käännösyksikköjen polku" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" msgstr "Projektin valinta" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "Vahvista riippuvuuden poistaminen" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "Vahvista tiedoston poistaminen" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" msgstr "Poistetaanko riippuvuus %s :n ?" #: lazarusidestrconsts.lisprojinspprojectinspector msgid "Project Inspector - %s" msgstr "Projektinhallinta - %s" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgid "Removed required packages" msgstr "Poistettuja tarvittavia komponenttipaketteja" #: lazarusidestrconsts.lisprojinspremovefilefromproject msgid "Remove file %s from project?" msgstr "Poistetaanko tiedosto %s projektista?" #: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Aina käännetään kaikki (vaikka mikään ei muuttunutkaan)" #: lazarusidestrconsts.lisprojoptserror msgctxt "lazarusidestrconsts.lisprojoptserror" msgid "Error" msgstr "Virhe" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "" #: lazarusidestrconsts.lisprojprojectsourcedirectorymark msgid "Project Source Directory Mark" msgstr "Projektin lähdehakemiston merkki" #: lazarusidestrconsts.lispromptforvalue msgid "Prompt for value" msgstr "Kysy arvoa" #: lazarusidestrconsts.lisproperties msgid "Properties (replace or remove)" msgstr "Ominaisuudet (korvaa tai poista)" #: lazarusidestrconsts.lispropertiesofconditionalcompileroption msgid "Properties of conditional compiler option" msgstr "Ehdollisen käännöksen ominaisuudet" #: lazarusidestrconsts.lisprotected msgid "Protected" msgstr "Suojattu" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" msgstr "Protected - metodi" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" msgstr "Public - metodi" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" msgstr "Published - metodi" #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" msgstr "" #: lazarusidestrconsts.lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" msgstr "" #: lazarusidestrconsts.lispublprojinvalidincludefilter msgid "Invalid Include filter" msgstr "" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" msgstr "" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" msgid "A pascal unit must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" msgstr "" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier" msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses" msgid "The unitname is used when the IDE extends uses clauses." msgstr "Käännösyksikön nimeä käytetään kun Lazarus laajentaa uses-lauseketta." #: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni" msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "" #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" msgstr "Muunna Delphi-projektista" #: lazarusidestrconsts.lispwnewproject msgid "New Project" msgstr "Luo uusi projekti" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" msgstr "Avaa projekti" #: lazarusidestrconsts.lispwopenrecentproject msgctxt "lazarusidestrconsts.lispwopenrecentproject" msgid "Open Recent Project" msgstr "Avaa edellinen projekti" #: lazarusidestrconsts.lisquickfixcreatelocalvariable msgid "Create local variable" msgstr "Luo paikallinen muuttuja" #: lazarusidestrconsts.lisquickfixes msgid "Quick fixes" msgstr "Nopeat korjaukset" #: lazarusidestrconsts.lisquickfixremoveunit msgid "Quick fix: Remove unit" msgstr "Nopea korjaus: poista käännösyksikkö" #: lazarusidestrconsts.lisquickfixsearchidentifier msgid "Search identifier" msgstr "" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" msgstr "Poistu Lazaruksesta" #: lazarusidestrconsts.lisreaderror msgid "Read Error" msgstr "Lukuvirhe" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" msgstr "" #: lazarusidestrconsts.lisregisters msgctxt "lazarusidestrconsts.lisregisters" msgid "Registers" msgstr "Rekisterit" #: lazarusidestrconsts.lisregistersdlgname msgctxt "lazarusidestrconsts.lisregistersdlgname" msgid "Name" msgstr "Nimi" #: lazarusidestrconsts.lisregistersdlgvalue msgctxt "lazarusidestrconsts.lisregistersdlgvalue" msgid "Value" msgstr "Arvo" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" msgstr "Säännöllinen lauseke" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" msgstr "Suhteelliset hakupolut" #: lazarusidestrconsts.lisremove msgid "remove" msgstr "Poista" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Poista kaikki vikaantuneet tai toimimattomat ominaisuudet" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" msgstr "Poista kaikki käännösyksiköt" #: lazarusidestrconsts.lisremovefrominstalllist msgid "Remove from install list" msgstr "Poistetaan asennuksesta" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" msgstr "Valitse projektista poistettava käännösyksikkö" #: lazarusidestrconsts.lisremovefromsearchpath msgid "Remove from search path" msgstr "" #: lazarusidestrconsts.lisremoveincludepath msgid "Remove include path?" msgstr "" #: lazarusidestrconsts.lisremovelocalvariable msgid "Remove local variable %s" msgstr "" #: lazarusidestrconsts.lisremovelocalvariable2 msgid "Remove local variable" msgstr "" #: lazarusidestrconsts.lisremovenonexistingfiles msgid "Remove non existing files" msgstr "" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" msgstr "Poista valitut käännösyksiköt" #: lazarusidestrconsts.lisremovethem msgid "Remove them" msgstr "Poista ne" #: lazarusidestrconsts.lisremovethepathsfromothersources msgid "Remove the paths from \"Other sources\"" msgstr "" #: lazarusidestrconsts.lisremoveunitfromusessection msgid "Remove unit from uses section" msgstr "Poista käännösyksikkö uses-lauseesta" #: lazarusidestrconsts.lisremoveunitpath msgid "Remove unit path?" msgstr "Poista käännösyksikön polku?" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" msgstr "Muutetaanko tiedoston nimeä?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" msgstr "Tiedoston uudelleennimeäminen epäonnistui" #: lazarusidestrconsts.lisrenameto msgid "Rename to %s" msgstr "Nimeä %s:ksi" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" msgstr "Vaihda nimi pienillä kirjaimilla kirjoitetuksi" #: lazarusidestrconsts.lisreopenproject msgid "Reopen project" msgstr "Avaa projekti uudestaan" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "Avaa uudestaan toisella merkistön koodauksella" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" msgstr "Toistojen määrä:" #: lazarusidestrconsts.lisreplacement msgid "Replacement" msgstr "Korvaus" #: lazarusidestrconsts.lisreplacementfuncs msgid "Replacement functions" msgstr "Korvaavat funktiot" #: lazarusidestrconsts.lisreplacements msgid "Replacements" msgstr "Korvaukset" #: lazarusidestrconsts.lisreplaceremoveunknown msgid "Fix unknown properties and types" msgstr "Korjaa tuntemattomat ominaisuudet ja tyypit" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "Valinnan korvaaminen epäonnistui" #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources msgid "Requires FPC 2.4 or above. Like Delphi resources" msgstr "" #: lazarusidestrconsts.lisrescan msgid "Rescan" msgstr "Lue uudelleen" #: lazarusidestrconsts.lisresourceloaderror msgid "Resource load error" msgstr "Resurssitiedoston lukeminen epäonnistui" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" msgstr "" #: lazarusidestrconsts.lisresourcetypeofnewfiles msgid "Resource type of project:" msgstr "" #: lazarusidestrconsts.lisresponsecontinue msgid "Response: %sContinue ?" msgstr "" #: lazarusidestrconsts.lisresult msgid "Result :=" msgstr "Paluuarvo :=" #: lazarusidestrconsts.lisresult2 msgid "Result:" msgstr "Paluuarvo:" #: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria msgid "returns list of all values of case variable in front of variable" msgstr "" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" msgstr "Palauttaminen epäonnistui" #: lazarusidestrconsts.lisright msgctxt "lazarusidestrconsts.lisright" msgid "Right" msgstr "Oikea" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" msgstr "Oikean reunan ankkurointi" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "Oikea reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen." #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." msgstr "Tämä on naapuri-kontrolli, mihin oikea reuna on ankkuroitu. Tyhjä tarkoittaa emo-kontrollia." #: lazarusidestrconsts.lisrightsides msgid "Right sides" msgstr "Oikeat reunat" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" msgstr "" #: lazarusidestrconsts.lisroot msgid "Root" msgstr "" #: lazarusidestrconsts.lisrunning msgid "%s (running ...)" msgstr "" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" msgstr "" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "" #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" msgstr "" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract methods - not yet overridden" msgstr "Abstraktit methodit - ei vielä syrjäytetty" #: lazarusidestrconsts.lissamabstractmethodsof msgid "Abstract methods of %s" msgstr "%s:n abstraktit methodit" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" msgstr "" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods msgid "%s is an abstract class, it has %s abstract methods." msgstr "%s on abstrakti luokka, sillä on abstrakteja methodeja" #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "Abstrakteja metodeja ei löydy" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" msgstr "Kirjoita yli kaikki valitut" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" msgstr "Kirjoita yli ensimmäinen valittu" #: lazarusidestrconsts.lissamselectnone msgid "Select none" msgstr "" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "Löytyi %s abstraktia metodia. Valitse ne, joihin tahdot luoda koodirungon:" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "Ei löydy enempää abstrakteja metodeja." #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "Tämän luokan abstrakteja metodeja ei voi näyttää, koska" #: lazarusidestrconsts.lissave msgid "Save ..." msgstr "Tallenna ..." #: lazarusidestrconsts.lissaveallmessagestofile msgid "Save all messages to file" msgstr "Tallenna kaikki kääntäjän viestit tiedostoon" #: lazarusidestrconsts.lissaveallmodified msgid "Save all modified files" msgstr "Tallenna kaikki muuttuneet tiedostot" #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" msgstr "Tallenna ja poistu" #: lazarusidestrconsts.lissaveandrebuildide msgid "Save and rebuild IDE" msgstr "Tallenna ja käännä uudelleen" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" msgstr "Tallennetaanko muutokset?" #: lazarusidestrconsts.lissavechangestoproject msgid "Save changes to project %s?" msgstr "Tallennetaanko %s -projektiin tehdyt muutokset?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "Save current editor file" msgstr "Tallenna nykyinen editorin tiedosto" #: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" msgstr "" #: lazarusidestrconsts.lissavefileas msgid "Save file as" msgstr "Tallenna tiedosto nimellä" #: lazarusidestrconsts.lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgstr "Tallennetaanko tiedosto %s%s%s%sennenkuin suljetaan lomake (form) %s%s%s?" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" msgstr "" #: lazarusidestrconsts.lissaveproject msgid "Save project %s (*%s)" msgstr "Tallenna projekti %s (*%s)" #: lazarusidestrconsts.lissavesettings msgid "Save Settings" msgstr "Tallenna asetukset" #: lazarusidestrconsts.lissavespace msgid "Save " msgstr "Tallenna " #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" msgstr "Skaalauskerroin:" #: lazarusidestrconsts.lissearchfor msgid "Search For " msgstr "Viittaukset tunnisteeseen: " #: lazarusidestrconsts.lissearchunit msgid "Search unit" msgstr "Etsi käännösyksikkö" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " msgstr "" #: lazarusidestrconsts.lissecondaryconfigpath msgid "Secondary config path" msgstr "" #: lazarusidestrconsts.lisseemessages msgid "See messages." msgstr "Katso \"Kääntäjän viestit \" -ikkunaa" #: lazarusidestrconsts.lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" msgstr "%sKatso projektivalikon kohtaa -> Projektinhallinta" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" msgstr "Valitse jokin kohta seuraavista:" #: lazarusidestrconsts.lisselectanode msgid "Select a node" msgstr "" #: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype msgid "Select another LCL widget set (macro LCLWidgetType)" msgstr "" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Valitse Delphi form (lomake) tiedosto (*.dfm)" #: lazarusidestrconsts.lisselected msgctxt "lazarusidestrconsts.lisselected" msgid "Selected" msgstr "Valittu" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" msgstr "" #: lazarusidestrconsts.lisselectfile msgid "Select the file" msgstr "Valitse tiedosto" #: lazarusidestrconsts.lisselectfpcsourcedirectory msgid "Select FPC source directory" msgstr "" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" msgstr "Valintatyökalu" #: lazarusidestrconsts.lisselectlazarussourcedirectory msgid "Select Lazarus source directory" msgstr "Valitse Lazaruksen lähdehakemisto" #: lazarusidestrconsts.lisselectpathof msgid "Select path of %s" msgstr "Valitse %s:n polku" #: lazarusidestrconsts.lisselectpathto msgid "Select path to %s" msgstr "" #: lazarusidestrconsts.lisselecttheactivebuildmode msgid "Select the active build mode" msgstr "" #: lazarusidestrconsts.lissetdefault msgid "Set default" msgstr "Aseta oletus" #: lazarusidestrconsts.lissetmacrovalues msgid "Set macro values" msgstr "Aseta makron arvot" #: lazarusidestrconsts.lissetupdefaultindentation msgid "(Setup default indentation)" msgstr "" #: lazarusidestrconsts.lissetvalue msgid "Set value" msgstr "Aseta arvo" #: lazarusidestrconsts.lisshort msgid "Short:" msgstr "Lyhyt:" #: lazarusidestrconsts.lisshowdeclarationhints msgid "Show declaration hints" msgstr "" #: lazarusidestrconsts.lisshowdifferencesbetweenmodes msgid "Show differences between modes ..." msgstr "" #: lazarusidestrconsts.lisshowemptyunitspackages msgid "Show empty units/packages" msgstr "Näytä tyhjät käännösyksiköt/paketit" #: lazarusidestrconsts.lisshowglyphsfor msgid "Show Glyphs for:" msgstr "Näytä kuvakkeet :" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" msgstr "Näytä reunapalkki" #: lazarusidestrconsts.lisshowhelp msgid "Show help" msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" msgstr "Näytä komponenttimuokkaimessa vihjeet" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" msgstr "Näytä tunnisteet" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" msgstr "Näytä lisätietojaosa" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" msgstr "Näytä paketit" #: lazarusidestrconsts.lisshowpositionofsourceeditor msgid "Show position of source editor" msgstr "" #: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings msgid "Show setup dialog for most important settings" msgstr "" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" msgstr "Tuo esille erikoismerkit (kuten välilyönnit pisteinä, kelpaattomat merkit kysymysmerkkeinä)" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" msgstr "" #: lazarusidestrconsts.lisshowunits msgid "Show units" msgstr "Näytä käännösyksiköt" #: lazarusidestrconsts.lisshowvaluehintswhiledebugging msgid "Show value hints while debugging" msgstr "" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" msgstr "" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" msgstr "Kutista pienimpään" #: lazarusidestrconsts.lissibling msgid "Sibling" msgstr "Sisarus" #: lazarusidestrconsts.lissimplesyntax msgid "Simple Syntax" msgstr "Yksinkertainen kielioppi" #: lazarusidestrconsts.lisskiperrors msgid "Skip errors" msgstr "" #: lazarusidestrconsts.lisskipfile msgid "Skip file" msgstr "Ohita tiedosto" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "Ohita tiedosto ja jatka lataamista" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project" msgstr "Ohita viime projektin lataaminen" #: lazarusidestrconsts.lissmallerratherthanfaster msgid "smaller rather than faster" msgstr "pienempi mieluummin kuin nopeampi" #: lazarusidestrconsts.lissmatches msgid "Matches" msgstr "Löydetty" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" msgstr "" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "" #: lazarusidestrconsts.lissortselascending msgid "Ascending" msgstr "Nouseva" #: lazarusidestrconsts.lissortselcancel msgctxt "lazarusidestrconsts.lissortselcancel" msgid "Cancel" msgstr "Peru" #: lazarusidestrconsts.lissortselcasesensitive msgctxt "lazarusidestrconsts.lissortselcasesensitive" msgid "&Case Sensitive" msgstr "Sama kirjainkoko" #: lazarusidestrconsts.lissortseldescending msgid "Descending" msgstr "Laskeva" #: lazarusidestrconsts.lissortseldomain msgid "Domain" msgstr "Lajittelu peruste" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" msgstr "Jätä välilyönnit huomiotta" #: lazarusidestrconsts.lissortsellines msgid "Lines" msgstr "Rivit" #: lazarusidestrconsts.lissortseloptions msgctxt "lazarusidestrconsts.lissortseloptions" msgid "Options" msgstr "Optiot" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" msgstr "Kappaleet" #: lazarusidestrconsts.lissortselpreview msgctxt "lazarusidestrconsts.lissortselpreview" msgid "Preview" msgstr "Esikatselu" #: lazarusidestrconsts.lissortselsort msgid "Accept" msgstr "Hyväksy" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" msgstr "Järjestä valittu lohko" #: lazarusidestrconsts.lissortselwords msgctxt "lazarusidestrconsts.lissortselwords" msgid "Words" msgstr "Sanat" #: lazarusidestrconsts.lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "Lähde ja kohde ovat samat:%s%s" #: lazarusidestrconsts.lissourcebreakpoint msgid "&Source Breakpoint ..." msgstr "Lähdekoodin keskeytyskohta..." #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." msgstr "" #: lazarusidestrconsts.lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." msgstr "Lähdekoodihakemistoa %s%s%s ei ole." #: lazarusidestrconsts.lissourcemodified msgid "Source modified" msgstr "Lähdekoodi muuttunut" #: lazarusidestrconsts.lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts.lissourceofpagehaschangedsaveextended msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)" msgstr "" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" msgstr "Lähdekoodin polut" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" msgstr "" #: lazarusidestrconsts.lissrcos msgid "Src OS" msgstr "" #: lazarusidestrconsts.lisssearching msgid "Searching" msgstr "Etsitään" #: lazarusidestrconsts.lisssearchtext msgid "Search text" msgstr "Etsittävä teksti" #: lazarusidestrconsts.lisstartconversion msgid "Start Conversion" msgstr "Aloita muunnos" #: lazarusidestrconsts.lisstartide msgid "Start IDE" msgstr "Käynnistä IDE" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" msgstr "Aloita uusi projekti" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Pysäytetäänkö nykyinen virheenjäljitys ja käännetään uudelleen?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" msgstr "Lopetetaanko virheenjäljitys?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" msgstr "Pysäytetäänkö virheenjäljitys?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" msgstr "" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" msgstr "Pysäytetäänkö virheenjäljitys?" #: lazarusidestrconsts.lisstorepathdelimitersandas msgid "Store path delimiters \\ and / as" msgstr "" #: lazarusidestrconsts.lisstrangelpifile msgid "Strange lpi file" msgstr "Outo lpi-tiedosto" #: lazarusidestrconsts.lisstreamerror msgid "Stream Error" msgstr "Virran virhe" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" msgstr "Virran virhe" #: lazarusidestrconsts.lisstring msgid "String" msgstr "" #: lazarusidestrconsts.lisstyle msgctxt "lazarusidestrconsts.lisstyle" msgid "Style" msgstr "Tyyli" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" msgstr "Aliohjelman sisäinen aliohjelma" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "" #: lazarusidestrconsts.lissuccess msgid "Success" msgstr "Onnistui" #: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase msgid "Suggest default name of new file in lowercase" msgstr "" #: lazarusidestrconsts.lissuspiciousincludepath msgid "Suspicious include path" msgstr "" #: lazarusidestrconsts.lissuspiciousunitpath msgid "Suspicious unit path" msgstr "" #: lazarusidestrconsts.lissvnrevision msgid "SVN Revision: " msgstr "SVN Revisio: " #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "Kelvoton muuttujan nimi" #: lazarusidestrconsts.lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." msgstr "%s%s%s ei ole laillinen tunniste" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" msgstr "" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" msgstr "" #: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg msgid "system.ppu not found. Check your fpc.cfg." msgstr "" #: lazarusidestrconsts.listab msgid "Tab" msgstr "" #: lazarusidestrconsts.listaborderconfirmsort msgid "Sort tab orders of all child controls of \"%s\" by their positions?" msgstr "" #: lazarusidestrconsts.listaborderdownhint msgid "Move the selected control down in tab order" msgstr "" #: lazarusidestrconsts.listaborderof msgid "Tab Order of %s" msgstr "%s:n tabulointijärjestys" #: lazarusidestrconsts.listabordersorthint msgid "Calculate the tab order of controls by their X- and Y- positions" msgstr "" #: lazarusidestrconsts.listaborderuphint msgid "Move the selected control up in tab order" msgstr "" #: lazarusidestrconsts.listakesnapshot msgid "Take a Snapshot" msgstr "" #: lazarusidestrconsts.listargetcpu msgid "Target CPU" msgstr "Kohde CPU" #: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory msgid "Target file name: (-o, empty = use unit output directory)" msgstr "Kohdetiedoston nimi (-o, tyhjä = käytä käännösyksiköiden hakemistoa)" #: lazarusidestrconsts.listargetfilenameo msgid "Target file name (-o):" msgstr "Kohdetiedoston nimi (-o):" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" msgstr "Projektin kohdetiedosto" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" msgstr "Kohdetiedosto + parametrit" #: lazarusidestrconsts.listargetos msgctxt "lazarusidestrconsts.listargetos" msgid "Target OS" msgstr "Kohde käyttis" #: lazarusidestrconsts.listcompilerinternalerror msgid "Internal compiler error! (%d)" msgstr "Sisäinen kääntäjän virhe! (%d)" #: lazarusidestrconsts.listemplateeditparamcell msgid "Editable Cell" msgstr "Muokattava solu" #: lazarusidestrconsts.listemplateeditparamcellhelp msgid "" "Inserts an editable Cell, with a default value\n" "\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n" "\"default\",Sync, to Sync with a previous cell of equal default\n" msgstr "" #: lazarusidestrconsts.listestdirectory msgid "Test directory" msgstr "Testihakemisto" #: lazarusidestrconsts.listheapplicationbundlewascreatedfor msgid "The Application Bundle was created for \"%s\"" msgstr "" #: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith msgid "The build macro \"%s\" does not begin with \"%s\"." msgstr "" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." msgstr "" #: lazarusidestrconsts.listhecodetoolsfoundanerror msgid "The codetools found an error:%s%s%s" msgstr "" #: lazarusidestrconsts.listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." msgstr "" #: lazarusidestrconsts.listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "Komponentti %s kuuluu luokkaan %s. Komponentin voi poistaa avaamalla kyseisen luokan ja poistamalla sen sieltä." #: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." msgstr "" #: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier." msgstr "" #: lazarusidestrconsts.listhecontainsanotexistingdirectory msgid "The %s contains a not existing directory:%s%s" msgstr "%s sisältää olemattoman hakemiston:%s%s" #: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." msgstr "%s sisältää tähtimerkin *.%sLazarus kohtelee sitä tavallisena merkkinä eikä laajenna sitä tiedostohaussa" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" msgstr "Käytössä oleva kääntäjän tiedosto %s%s%s%sei ole suoritettava ohjelma.%sValitsemalla Ok käytetään oletuksena olevaa %s%s%s.%sMuussa tapauksessa tarkista valikosta Tools -> Asetukset -> Tiedostot" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Tools -> Options -> Files" msgstr "Käytössä oleva kääntäjän tiedosto %s%s%s%sei ole suoritettava ohjelma.%sTarkista valikosta Tools -> Asetukset -> Tiedostot" #: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." msgstr "" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" msgstr "Käytössä oleva Free Pascalin lähdekoodikansio %s%s%s%sei näytä oikealta. %sValitse Ok käyttääksesi oletuksena olevaa asetusta %s%s%s.%sMuussa tapauksessa tarkista asetukset: Tools -> Asetukset -> Tiedostot" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Tools -> Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Tools -> Options -> Files" msgstr "" #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options" msgstr "" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." msgstr "Kohdehakemistoa%s%s%s%s ei ole." #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." msgstr "" #: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" msgstr "" #: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" msgstr "Hakemistossa \"%s\" ei ole enää käännösyksiköitä. Poistetaanko hakemisto projektin hakupolusta?" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgstr "Kansiota %s%s%s ei enää tarvita käännösyksikön tiedostopolussa.%sPoistetaanko se?" #: lazarusidestrconsts.listhedirectoryisnotwritable msgid "The directory %s%s%s is not writable." msgstr "Hakemistoon %s%s%s ei voi kirjoittaa." #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgstr "Kansio %s%s%s ei vielä ole käännösyksikön polussa.%sLisätäänkö se sinne?" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." msgstr "Hakemistoa %s ei loytynyt." #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" msgstr "Tiedosto %s%s%s" #: lazarusidestrconsts.listhefiledoesnotlooklikealpifile msgid "The file %s does not look like a lpi file." msgstr "Tiedosto %s ei vaikuttaisi olevan lpi-tiedosto." #: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." msgstr "" #: lazarusidestrconsts.listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" msgstr "" #: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?" msgstr "" #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "Tiedosto %s%s%s%s näyttää olevan Pascal-ohjelma. Suljetaanko nykyinen projekti ja avataan tämä uutena projektina?%s\"Ei\"-näppäin avaa sen vain lähdekoodina." #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." msgstr "Tiedosto %s vaikuttaa siltä että se on ohjelmatiedosto Lazaruksella tehdyssä projektissa." #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgstr "" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "Tiedostoa %s%s%s%sei löytynyt.%sOhita-näppäimen nainallus jatkaa projektin lataamista,%sKeskeytä-näppäin keskeyttää sen." #: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin" msgid "The first build mode is the default mode and must be stored in the project, not in the session." msgstr "" #: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2 msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2" msgid "The first build mode is the default mode and must be stored in the project, not in the session." msgstr "" #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgstr "Seuraavia metodeja käyttää %s mutta niitä ei löydy lähdekoodista%s%s%s%s%s%sPoistetaanko 'roikkuva' viittaus?" #: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." msgstr "" #: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." msgstr "" #: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun #, fuzzy #| msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sTools -> Options -> Files" msgstr "Free Pascalin lähdekoodi hakemistoa ei löytynyt. Jotkut toiminnot eivät toimi.%sOn suositeltavaa että lähdekoodit on asennettu ja niiden hakupolku asetettu %sTyökalut -> Asetukset -> Tiedostot" #: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s" msgstr "" #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "" #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." msgstr "" #: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Tools -> Options -> Files" msgstr "" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgstr "Lazaruksen lomake eli LFM-tiedosto sisältää vääränlaisia ominaisuuksia. Tämä tarkoittanee esimerkiksi jotain luokkaa tai sen ominaisuutta mitä ei ole käytettävissä käytössä olevassa LCL-kirjastossa. Normaali korjaus on poistaa nämä ominaisuudet LFM-tiedostosta ja korjata Pascal-koodi käsin." #: lazarusidestrconsts.listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd msgid "The new include file is not yet in the include search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "Tämä käännösyksikkö ei vielä ole hakupolussa.%sLisätäänkö kansio %s hakupolkuun?" #: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" msgstr "" #: lazarusidestrconsts.listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr "" #: lazarusidestrconsts.listheownerclasshasthisname msgid "The owner class has this name" msgstr "Omistajaluokan nimi on" #: lazarusidestrconsts.listheownerhasthisname msgid "The owner has this name" msgstr "Omistajan nimi on" #: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "" #: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." msgstr "" #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "" #: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth msgid "The package %s can not be uninstalled, because it is needed by the IDE itself." msgstr "" #: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." msgstr "" #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" msgstr "" #: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" msgstr "" #: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces." msgstr "" #: lazarusidestrconsts.listheprojecthasnomainsourcefile msgid "The project has no main source file." msgstr "" #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" msgstr "Projektin info tiedosto %s%s%s%son/olisi saman niminen kuin projektin pääohjelman tiedosto!" #: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk msgid "The project information file %s%s%s%shas changed on disk." msgstr "Tallennettuna oleva projektin lpi-tiedosto (project information file) %s%s%s%son muuttunut." #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" msgstr "" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgstr "" #: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea msgid "The project uses the new FPC resources, which requires at least FPC 2.4" msgstr "" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "Kansiossa on muitakin saman nimisiä tiedostoja,%sne eroavat ainoastaan kirjaimien koon perusteella:%s%s%sPoistetaanko ne?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "Kansiosta löytyy jo myös samanlainen (epäselvä) tiedosto samantapaisella tiedostopäätteellä%sTallennettavatiedosto: %s%sSamanlainen (epäselvä) tiedosto: %s%s%sPoistetaanko samanlainen (epäselvä) tiedosto?" #: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename msgid "There is already a build macro with the name %s%s%s." msgstr "" #: lazarusidestrconsts.listhereisalreadyacomponentwiththisname msgid "There is already a component with this name" msgstr "Samanniminen komponentti on jo olemassa" #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" msgstr "Projektissa on jo %s%s%s-niminen lomake (form)" #: lazarusidestrconsts.listhereisalreadyanidemacrowiththename msgid "There is already an IDE macro with the name \"%s\"" msgstr "" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgstr "" #: lazarusidestrconsts.listheremustbeatleastonebuildmode msgid "There must be at least one build mode." msgstr "" #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "" #: lazarusidestrconsts.listherootcomponentcannotbedeleted msgid "The root component can not be deleted." msgstr "" #: lazarusidestrconsts.listhesefileswillbedeleted msgid "These files will be deleted:" msgstr "" #: lazarusidestrconsts.listhesesettingsarestoredwiththeproject msgid "These settings are stored with the project." msgstr "" #: lazarusidestrconsts.listheseunitswerenotfound msgid "These units were not found:" msgstr "Näitä käännösyksikköjä ei löydy:" #: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." msgstr "" #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)" msgstr "" #: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "Käännösyksikön %s%s%s nimi on jo käytössä.%sVoit kaikesta huolimatta nimetä näin jolloin nimenvaihto tapahtuu,%sMahdollista on myös perua tämä tallennus tai sitten keskeyttää kaikki tallennukset." #: lazarusidestrconsts.listheunitbelongstopackage msgid "The unit belongs to package %s." msgstr "Käännösyksikkö kuuluu pakettiin %s." #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" msgstr "Käännösyksikkö %s löytyy %s:n kahdesta eri hakupolusta:" #: lazarusidestrconsts.listheunithasthisname msgid "The unit has this name" msgstr "Käännösyksiköllä on tämä nimi" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" msgstr "" #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "Muutkin tiedostot käyttävät käännösyksikköä %s.%sPäivitetäänkö viittaukset niihin automaattisesti?" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgstr "Käännösyksikkö on jo nimeltään %s%s%s. Pascal:ssa tunnukset pitää olla yksilöllisiä" #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" msgstr "" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "" #: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor msgid "This function needs an open .lfm file in the source editor." msgstr "" #: lazarusidestrconsts.listhishelpmessage msgid "this help message" msgstr "tämä avusteviesti" #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "Tämä vaikuttaa pascal-tiedostolta.%sOn suositeltavaa käyttää pieniä kirjaimia tiedoston nimessä jotta vältytään ongelmilta joissakin tiedostojärjestelmissä.%Vaihdetaanko tiedoston nimi pienillä kirjaimilla kirjoitetuksi?" #: lazarusidestrconsts.listhisprojecthasnomainsourcefile msgid "This project has no main source file" msgstr "Tällä projektilla ei ole pää-lähdekooditiedostoa" #: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus." msgstr "" #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "Tästä ei voi tehdä omaa aliohjelmaa.%sValitse ensin jokin muu koodin osa josta voi tehdä uusi aliohjelma tai metodi" #: lazarusidestrconsts.listhiswillcreateacircle msgid "This will create a circle." msgstr "Tämä synnyttäisi kehän." #: lazarusidestrconsts.listhreads msgctxt "lazarusidestrconsts.listhreads" msgid "Threads" msgstr "Säikeet" #: lazarusidestrconsts.listhreadscurrent msgctxt "lazarusidestrconsts.listhreadscurrent" msgid "Current" msgstr "Nykyinen" #: lazarusidestrconsts.listhreadsfunc msgctxt "lazarusidestrconsts.listhreadsfunc" msgid "Function" msgstr "Funktio" #: lazarusidestrconsts.listhreadsgoto msgid "Goto" msgstr "Mene" #: lazarusidestrconsts.listhreadsid msgid "Id" msgstr "" #: lazarusidestrconsts.listhreadsline msgctxt "lazarusidestrconsts.listhreadsline" msgid "Line" msgstr "Rivi" #: lazarusidestrconsts.listhreadsname msgctxt "lazarusidestrconsts.listhreadsname" msgid "Name" msgstr "Nimi" #: lazarusidestrconsts.listhreadsnotevaluated msgid "Threads not evaluated" msgstr "Säikeitä ei arvioida" #: lazarusidestrconsts.listhreadssrc msgctxt "lazarusidestrconsts.listhreadssrc" msgid "Source" msgstr "Lähdekoodi" #: lazarusidestrconsts.listhreadsstate msgctxt "lazarusidestrconsts.listhreadsstate" msgid "State" msgstr "Tila" #: lazarusidestrconsts.listinfobuildautocloseonsuccess msgid "&Automatically close on success" msgstr "Sulje automaattisesti onnistuneen käännöksen jälkeen" #: lazarusidestrconsts.listinfobuildcompiling msgid "Compiling:" msgstr "Kääntää:" #: lazarusidestrconsts.listitle msgid "&Title" msgstr "Otsikko" #: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus msgid "Title in taskbar shows for example: project1.lpi - Lazarus" msgstr "Tehtäväpalkin otsikko näyttää esim: project1.lpi - Lazarus" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "Otsikko (oletusotsikko jos tyhjä)" #: lazarusidestrconsts.listmfunctionappendpathdelimiter msgid "Function: append path delimiter" msgstr "Funktio: lisää polkuerotin" #: lazarusidestrconsts.listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" msgstr "Funktio: katkaise polkuerotin" #: lazarusidestrconsts.listmfunctionextractfileextension msgid "Function: extract file extension" msgstr "Funktio: erota tiedoston pääte" #: lazarusidestrconsts.listmfunctionextractfilenameextension msgid "Function: extract file name+extension" msgstr "Funktio: erota tiedoston nimi ja pääte" #: lazarusidestrconsts.listmfunctionextractfilenameonly msgid "Function: extract file name only" msgstr "Funktio: erota pelkkä tiedoston nimi" #: lazarusidestrconsts.listmfunctionextractfilepath msgid "Function: extract file path" msgstr "Funktio: erota tiedoston polku" #: lazarusidestrconsts.listmunknownmacro msgid "(unknown macro: %s)" msgstr "(tuntematon makro: %s)" #: lazarusidestrconsts.listofpcpath msgid "Path:" msgstr "Polku:" #: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" msgstr "Vaihda näyttö tiedostojen täyden polun ja suhteellisen polun välillä" #: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide msgid "To install you must compile and restart the IDE" msgstr "Asentaaksesi sinun pitää kääntää ja käynnistää Lazarus" #: lazarusidestrconsts.listop msgctxt "lazarusidestrconsts.listop" msgid "Top" msgstr "Ylhäällä" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" msgstr "Yläosan ankkurointi" #: lazarusidestrconsts.listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "Yläpuolen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen." #: lazarusidestrconsts.listops msgid "Tops" msgstr "Yläreunat" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." msgstr "Tämä on naapuri-kontrolli, mihin yläreuna on ankkuroitu. Tyhjä tarkoittaa emo-kontrollia." #: lazarusidestrconsts.listopspaceequally msgid "Top space equally" msgstr "" #: lazarusidestrconsts.listreeneedsrefresh msgid "Tree needs refresh" msgstr "Puu pitää päivittää" #: lazarusidestrconsts.listurbopascal msgid "Turbo Pascal" msgstr "" #: lazarusidestrconsts.listypes msgid "Types (not removed if no replacement)" msgstr "Tyypit (ei poisteta vaikkei ole korvaavaa)" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." msgstr "Älä näytä tätä viestiä uudelleen" #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Virhe säännöllisessä lausekkeessa" #: lazarusidestrconsts.lisuefontwith msgid "Font without UTF-8" msgstr "Fontti ilman UTF-8:aa" #: lazarusidestrconsts.lisuegotoline msgid "Goto line:" msgstr "Hyppää riville:" #: lazarusidestrconsts.lisuemodeseparator msgid "/" msgstr "" #: lazarusidestrconsts.lisuenotfound msgid "Not found" msgstr "Ei löytynyt" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgstr "Korvataanko tässä esiintyvä %s%s%s%s tekstillä %s%s%s?" #: lazarusidestrconsts.lisuesearching msgid "Searching: %s" msgstr "Etsitään tiedostosta: %s" #: lazarusidestrconsts.lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "Etsittyä merkkijonoa '%s' ei löydetty!" #: lazarusidestrconsts.lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgstr "Nykyinen editorin kirjaisin ei tue UTF-8 merkistöä, mutta käyttöjärjestelmä tukee sitä. %sTämä merkitsee sitä että ei ASCII merkit voivat näkyä väärin.%sSopivamman kirjaisimen voi valita editorin asetuksista." #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" msgstr "Tyhjennä include-tiedostojen välimuisti" #: lazarusidestrconsts.lisuidbytes msgid "%s bytes" msgstr "%s tavua" #: lazarusidestrconsts.lisuidclear msgid "Clear" msgstr "Tyhjennä" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" msgstr "Luettu käännösyksiköihin:" #: lazarusidestrconsts.lisuidinproject msgid "in Project:" msgstr "Projektissa:" #: lazarusidestrconsts.lisuidlines msgctxt "lazarusidestrconsts.lisuidlines" msgid "Lines:" msgstr "Rivejä:" #: lazarusidestrconsts.lisuidname msgctxt "lazarusidestrconsts.lisuidname" msgid "Name:" msgstr "Nimi:" #: lazarusidestrconsts.lisuidno msgid "no" msgstr "ei" #: lazarusidestrconsts.lisuidok msgctxt "lazarusidestrconsts.lisuidok" msgid "Ok" msgstr "" #: lazarusidestrconsts.lisuidpathsreadonly msgid "Paths (Read Only)" msgstr "Polut (vain luku)" #: lazarusidestrconsts.lisuidsize msgid "Size:" msgstr "Koko:" #: lazarusidestrconsts.lisuidsrc msgid "Src" msgstr "" #: lazarusidestrconsts.lisuidtype msgid "Type:" msgstr "Tyyppi" #: lazarusidestrconsts.lisuidunit msgctxt "lazarusidestrconsts.lisuidunit" msgid "Unit" msgstr "Käännösyksikkö" #: lazarusidestrconsts.lisuidyes msgid "yes" msgstr "kyllä" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "Näytä CodeTools arvot" #: lazarusidestrconsts.lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "Binaari-virran muuttaminen tekstiksi ei onnistu" #: lazarusidestrconsts.lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "Komponenttien kopiointi leikepöydälle ei onnistu" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts.lisunabletoaddsetting msgid "Unable to add setting" msgstr "asetuksien lisääminen ei onnistu" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "%s:n lisääminen projektiin ei onnistu, koska projektissa on jo samanniminen tiedosto." #: lazarusidestrconsts.lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "Ei voida tehdä varmuuskopiota tiedostosta %s%s%s tiedostoon %s%s%s!" #: lazarusidestrconsts.lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" msgstr "Ei voida muuttaa luokkaa %s luokaksi %s" #: lazarusidestrconsts.lisunabletochangeprojecttitleinsource msgid "Unable to change project title in source.%s%s" msgstr "Ei voida muuttaa projektin otsikkoa lähdekoodissa.%s%s" #: lazarusidestrconsts.lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "Ei voida siivota kohde hakemistoa" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgstr "Ei voida siivota %s%s%s.%sTarkista oikeudet." #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "Ei voida muuntaa komponentin tekstiä binaariseksi:%s%s" #: lazarusidestrconsts.lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" msgstr "Ei voida muuntaa tiedostoa %s%s%s%sVirhe: %s" #: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." msgstr "Muunnos lfm tiedostosta lrs tiedostoksi ja sen kirjoitus ei onnistu." #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgstr "" #: lazarusidestrconsts.lisunabletocopyfile msgid "Unable to copy file" msgstr "Tiedoston kopiointi ei onnistunut" #: lazarusidestrconsts.lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s" #: lazarusidestrconsts.lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s." #: lazarusidestrconsts.lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." msgstr "Backup-hakemiston %s%s%s luominen ei onnistu." #: lazarusidestrconsts.lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." msgstr "Hakemiston %s%s%s luominen ei onnistu." #: lazarusidestrconsts.lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" msgstr "Hakemiston %s%s%s luominen ei onnistu" #: lazarusidestrconsts.lisunabletocreatefile msgid "Unable to create file" msgstr "Tiedoston luominen ei onnistu." #: lazarusidestrconsts.lisunabletocreatefile2 msgid "Unable to create file %s%s%s" msgstr "Tiedoston %s%s%s luominen ei onnistu" #: lazarusidestrconsts.lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" msgstr "Tiedoston%s%s%s%s luominen ei onnistu" #: lazarusidestrconsts.lisunabletocreatefilename msgid "Unable to create file %s%s%s." msgstr "Tiedoston %s%s%s luominen ei onnistu." #: lazarusidestrconsts.lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr "Linkin %s%s%s luominen kohteeseen %s%s%s ei onnistu" #: lazarusidestrconsts.lisunabletocreatenewmethod msgid "Unable to create new method." msgstr "Uuden metodin luominen ei onnistu." #: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "Väliaikaisen lfm bufferin luominen ei onnistu." #: lazarusidestrconsts.lisunabletodelete msgid "Unable to delete" msgstr "Poistaminen ei onnistu" #: lazarusidestrconsts.lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" msgstr "Moniselitteisen tiedoston %s%s%s poistaminen ei onnistu" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts.lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletofindfile msgid "Unable to find file %s%s%s." msgstr "Ei löydetä tiedostoa %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" msgstr "" #: lazarusidestrconsts.lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." msgstr "%s ei löydy LFM virrasta." #: lazarusidestrconsts.lisunabletofindmethod msgid "Unable to find method." msgstr "Metodia ei löydy." #: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." msgstr "Ei löydy käännösyksikköä komponentin luokalle %s%s%s." #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "Editorin muutosten kokoaminen ei onnistu." #: lazarusidestrconsts.lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "Designer-lähdekoodia ei löydy." #: lazarusidestrconsts.lisunabletoloadfile msgid "Unable to load file:%s%s" msgstr "Tiedoston:%s%s lataaminen ei onnistu" #: lazarusidestrconsts.lisunabletoloadfile2 msgid "unable to load file %s: %s" msgstr "Tiedoston %s: %s lataaminen ei onnistu" #: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." msgstr "Resurssitiedoston lukeminen ei onnistunut.%sResurssitiedosto pitää olla ensimmäisenä tiedostona %sinitialization osassa.%sEli tämän kaltainen määrittely siellä pitäisi olla {$I %s.lrs}.%sTodennäköisesti kyseessä on syntaksivirhe." #: lazarusidestrconsts.lisunabletoloadpackage msgid "Unable to load package %s%s%s" msgstr "Paketin %s%s%s lataaminen ei onnistu" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." msgstr "" #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "" #: lazarusidestrconsts.lisunabletoread msgid "Unable to read %s" msgstr "%s:n lukeminen ei onnistu" #: lazarusidestrconsts.lisunabletoreadfile msgid "Unable to read file" msgstr "Tiedoston lukeminen ei onnistu" #: lazarusidestrconsts.lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" msgstr "Ei pystytä lukemaan tiedostoa %s%s%s!" #: lazarusidestrconsts.lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" msgstr "Ei pystytä lukemaan tiedostoa%s%s%s%sVirhe: %s" #: lazarusidestrconsts.lisunabletoreadfilename msgid "Unable to read file %s%s%s." msgstr "Ei pystytä lukemaan tiedostoa %s%s%s." #: lazarusidestrconsts.lisunabletoreadtheprojectinfofile msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile" msgid "Unable to read the project info file%s%s%s%s." msgstr "Ei pystytä lukemaan 'project info file'- tiedostoa." #: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2 msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2" msgid "Unable to read the project info file%s%s%s%s." msgstr "Ei pystytä lukemaan 'project info file'- tiedostoa" #: lazarusidestrconsts.lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" msgstr "" #: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource msgid "Unable to remove project title from source.%s%s" msgstr "" #: lazarusidestrconsts.lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletorenamefile msgid "Unable to rename file" msgstr "" #: lazarusidestrconsts.lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts.lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "" #: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "Metodin nimeäminen ei onnistu. Korjaa viesti-ikkunassa näkyvä virhe." #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "Ei pystytä tekemään muutoksia lähdekoodiin." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" msgstr "Suoritus ei onnistu" #: lazarusidestrconsts.lisunabletosavefile msgid "Unable to save file %s%s%s" msgstr "Tiedoston %s%s%s tallentaminen ei onnistu" #: lazarusidestrconsts.lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "Ankkuri-kontrollin asettaminen ei onnistu" #: lazarusidestrconsts.lisunabletoshowmethod msgid "Unable to show method." msgstr "Metodin näyttäminen ei onnistu" #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "Valittujen komponenttien kirjoittaminen virtaan ei onnistu" #: lazarusidestrconsts.lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "Valittujen komponenttien kirjoittaminen virtaan ei onnistu." #: lazarusidestrconsts.lisunabletostreamt msgid "Unable to stream %s:T%s." msgstr "%s:T%s kirjoittaminen virtaan ei onnistu." #: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "" #: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "CreateForm lausekkeen päivitys projektin lähdekoodissa ei onnistu" #: lazarusidestrconsts.lisunabletowrite msgid "Unable to write %s%s%s%s%s." msgstr "Kirjoittaminen ei onnistu %s%s%s%s%s." #: lazarusidestrconsts.lisunabletowrite2 msgid "Unable to write %s%s%s" msgstr "Kirjoittaminen ei onnistu %s%s%s" #: lazarusidestrconsts.lisunabletowritefile msgid "Unable to write file" msgstr "Tallentaminen tiedostoon ei onnistu" #: lazarusidestrconsts.lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" msgstr "Tallentaminen ei onnistunut tiedostoon %s%s%s%sVirheenä oli: %s" #: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror msgid "Unable to write the project info file%s%s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror msgid "Unable to write the project session file%s\"%s\".%sError: %s" msgstr "" #: lazarusidestrconsts.lisunabletowritetofile msgid "Unable to write to file %s%s%s." msgstr "Kirjoittaminen tiedostoon %s%s%s ei onnistu." #: lazarusidestrconsts.lisunabletowritetofile2 msgid "Unable to write to file \"%s\"." msgstr "Kirjoittaminen tiedostoon \"%s\" ei onnistu." #: lazarusidestrconsts.lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate msgid "Unexpected result:%sThe debugger will terminate" msgstr "" #: lazarusidestrconsts.lisuninstallimpossible msgid "Uninstall impossible" msgstr "Asennuksen poisto on mahdotonta" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" msgstr "Poista asennuksesta" #: lazarusidestrconsts.lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" msgstr "Käännösyksikkö %s%s%s on muuttunut. Talletetaanko?" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "" #: lazarusidestrconsts.lisunitinpackage msgid "%s unit %s in package %s%s" msgstr "" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "Tätä käännösyksikön nimeä käytetään jo projektissa" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "Käännösyksikön nimi alkaa ..." #: lazarusidestrconsts.lisunitnamecontains msgid "Unit name contains ..." msgstr "Käännösyksikön nimi sisältää ..." #: lazarusidestrconsts.lisunitnotfoundinproject msgid "A unit not found in project %s" msgstr "" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" msgstr "Käännösyksiköiden kirjoitushakemisto" #: lazarusidestrconsts.lisunitpath msgid "unit path" msgstr "Käännösyksiköiden polku" #: lazarusidestrconsts.lisunitpaths msgid "Unit paths" msgstr "Käännösyksiköiden polut" #: lazarusidestrconsts.lisunitsnotfoundinproject msgid "Units not found in project %s" msgstr "" #: lazarusidestrconsts.lisunsigned msgid "Unsigned" msgstr "Etumerkitön" #: lazarusidestrconsts.lisunusedunits msgid "Unused units" msgstr "Käyttämättömät käännösyksiköt" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" msgstr "Päivitetäänkö viittaukset?" #: lazarusidestrconsts.lisuppercasestring msgid "uppercase string" msgstr "muuta isoiksi kirjaimiksi" #: lazarusidestrconsts.lisuppercasestringgivenasparameter msgid "Uppercase string given as parameter" msgstr "muuta parametrina annettu merkkijono isoiksi kirjaimiksi" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" msgstr "Käyttöopastus (-h valinta)" #: lazarusidestrconsts.lisuse msgid "Use >>" msgstr "Käytä >>" #: lazarusidestrconsts.lisuseansistrings msgid "Use Ansistrings" msgstr "Käytä Ansistringia" #: lazarusidestrconsts.lisusedesigntimepackages msgid "Use design time packages" msgstr "Käytä suunnittelupaketteja" #: lazarusidestrconsts.lisuseexcludefilter msgid "Use Exclude Filter" msgstr "Käytä poissulkevaa suodatinta" #: lazarusidestrconsts.lisuseidentifier msgid "Use identifier" msgstr "Käytä tunnistetta" #: lazarusidestrconsts.lisuseidentifierinat msgid "Use identifier %s in %s at %s" msgstr "Käytä tunnistetta %s %s:ssa %s:n kanssa" #: lazarusidestrconsts.lisuseincludefilter msgid "Use Include Filter" msgstr "Käytä mukaan ottavaa suodatinta" #: lazarusidestrconsts.lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "Ohjelman käynnistys" #: lazarusidestrconsts.lisusepackageinpackage msgid "Use package %s in package %s" msgstr "Käytä pakettia %s paketissa %s" #: lazarusidestrconsts.lisusepackageinpackage2 msgid "Use package in package" msgstr "Käytä pakettia paketissa" #: lazarusidestrconsts.lisusepackageinproject msgid "Use package %s in project" msgstr "Käytä pakettia %s projektissa" #: lazarusidestrconsts.lisusepackageinproject2 msgid "Use package in project" msgstr "Käytä pakettia projektissa" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" msgstr "Käyttäjän kotihakemisto" #: lazarusidestrconsts.lisuseunit msgctxt "lazarusidestrconsts.lisuseunit" msgid "Add unit to uses section" msgstr "Lisää käännösyksikkö uses-lauseeseen" #: lazarusidestrconsts.lisuseunitinunit msgid "Use unit %s in unit %s" msgstr "Käytä käännösyksikköä %s käännösyksikössä %s" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" msgstr "" #: lazarusidestrconsts.lisvalue msgid "Value:" msgstr "Arvo:" #: lazarusidestrconsts.lisvalue2 msgid "Value%s" msgstr "Arvo%s" #: lazarusidestrconsts.lisvalue3 msgid "Value: " msgstr "Arvo: " #: lazarusidestrconsts.lisvalues msgid "Values" msgstr "Arvot" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" msgstr "Tarkista metodi kutsut" #: lazarusidestrconsts.lisversion msgid "Version" msgstr "Versio" #: lazarusidestrconsts.lisvertical msgid "Vertical" msgstr "Pystysuunta" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" msgstr "Kopio versiotieto leikepöydälle" #: lazarusidestrconsts.lisviewbreakpointproperties msgctxt "lazarusidestrconsts.lisviewbreakpointproperties" msgid "Breakpoint Properties ..." msgstr "Keskeytyskohdan ominaisuudet ..." #: lazarusidestrconsts.lisviewprojectunits msgid "View Project Units" msgstr "Näytä projektin käännösyksiköt" #: lazarusidestrconsts.lisviewsource msgid "View Source" msgstr "" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Näytä lomakkeen koodi (.lfm)" #: lazarusidestrconsts.lisvsrforwardsearch msgid "Forward Search" msgstr "Eteenpäin" #: lazarusidestrconsts.lisvsrresetresultlist msgid "Reset Result List" msgstr "Tyhjennä tulosluettelo" #: lazarusidestrconsts.liswarning msgid "Warning: " msgstr "Varoitus: " #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgstr "" #: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." msgstr "" #: lazarusidestrconsts.liswatch msgid "&Watch" msgstr "Vahti" #: lazarusidestrconsts.liswatchdata msgid "Watch:" msgstr "" #: lazarusidestrconsts.liswatchkind msgid "Watch action" msgstr "" #: lazarusidestrconsts.liswatchkindread msgid "Read" msgstr "" #: lazarusidestrconsts.liswatchkindreadwrite msgid "Read/Write" msgstr "" #: lazarusidestrconsts.liswatchkindwrite msgid "Write" msgstr "" #: lazarusidestrconsts.liswatchpoint msgid "&Data/Watch Breakpoint ..." msgstr "" #: lazarusidestrconsts.liswatchpointbreakpoint msgid "&Data/watch Breakpoint ..." msgstr "" #: lazarusidestrconsts.liswatchpropert msgid "Watch Properties" msgstr "Vahdin ominaisuudet" #: lazarusidestrconsts.liswatchscope msgid "Watch scope" msgstr "" #: lazarusidestrconsts.liswatchscopeglobal msgctxt "lazarusidestrconsts.liswatchscopeglobal" msgid "Global" msgstr "Kaiken kattava" #: lazarusidestrconsts.liswatchscopelocal msgid "Declaration" msgstr "" #: lazarusidestrconsts.liswatchtowatchpoint msgid "Create &Data/Watch Breakpoint ..." msgstr "" #: lazarusidestrconsts.liswelcometolazaruside msgid "Welcome to Lazarus IDE %s" msgstr "Tervetuloa lazarus IDE:en %s" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references ..." msgstr "Käännösyksikön nimeä muutettaessa päivitetään viittaukset ..." #: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew msgid "When enabled the current options are saved to the template, which is used when creating new projects" msgstr "Nykyiset asetukset talletetaan malliksi, mitä käytetään luotaessa uusia projekteja" #: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein msgid "When the source editor cursor moves, show the current node in the code explorer" msgstr "Kun kursori liikkuu lähdekoodissa, näytä aktiivinen solmu koodin tutkijassa" #: lazarusidestrconsts.liswithincludes msgid "%s, with includes %s" msgstr "" #: lazarusidestrconsts.liswithincludes2 msgid ", with includes " msgstr "" #: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw msgid "Without a proper compiler the code browsing and compiling will be disappointing." msgstr "" #: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn msgid "Without a proper Lazarus directory you will get a lot of warnings." msgstr "" #: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio msgid "Without the proper FPC sources code browsing and completion will be very limited." msgstr "" #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" msgstr "Tarvittavien pakettien kanssa" #: lazarusidestrconsts.liswladd msgid "&Add" msgstr "Lisää" #: lazarusidestrconsts.liswldelete msgid "&Delete" msgstr "Poista" #: lazarusidestrconsts.liswldeleteall msgid "De&lete All" msgstr "Poista kaikki" #: lazarusidestrconsts.liswldisableall msgid "D&isable All" msgstr "Estä kaikki" #: lazarusidestrconsts.liswlenableall msgid "E&nable All" msgstr "Salli kaikki" #: lazarusidestrconsts.liswlenabled msgid "&Enabled" msgstr "Sallittu" #: lazarusidestrconsts.liswlexpression msgid "Expression" msgstr "" #: lazarusidestrconsts.liswlproperties msgid "&Properties" msgstr "Ominaisuudet" #: lazarusidestrconsts.liswlwatchlist msgid "Watch list" msgstr "Vahtiluettelo" #: lazarusidestrconsts.liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Aktiivisen editorin kursorin kohdalla oleva sana" #: lazarusidestrconsts.lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "Työhakemisto kääntämistä varten" #: lazarusidestrconsts.lisworkingdirectoryforrun msgid "Working directory for run" msgstr "Työhakemisto suoritusta varten" #: lazarusidestrconsts.lisworkingdirectorynotfound msgid "Working directory %s not found" msgstr "Työhakemistoa %s ei löydy" #: lazarusidestrconsts.liswriteerror msgid "Write Error" msgstr "Tiedoston tallentaminen ei onnistunut" #: lazarusidestrconsts.liswriteerrorfile msgid "Write error: %s%sFile: %s%s%s" msgstr "Virhe kirjoittaessa: %s%sTiedosto: %s%s%s" #: lazarusidestrconsts.liswrongversionin msgid "wrong version in %s: %s" msgstr "väärä versio %s: %s" #: lazarusidestrconsts.lisxmlerror msgid "XML Error" msgstr "XML virhe" #: lazarusidestrconsts.lisxmlfiles msgid "XML files" msgstr "XML tiedostot" #: lazarusidestrconsts.lisxmlparsererrorinfileerror msgid "XML parser error in file %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu msgid "You can disable this for individual forms via the popup menu in the project inspector" msgstr "" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." msgstr "Lazarusta ei voi kääntää kun ohjelmaa ajetaan tai käännetään." #: lazarusidestrconsts.locwndsrceditor msgctxt "lazarusidestrconsts.locwndsrceditor" msgid "Source Editor" msgstr "Lähdekoodi-editori" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "Lisää paketin käännösyksikkö uses-lauseeseen" #: lazarusidestrconsts.regdlgbinary msgctxt "lazarusidestrconsts.regdlgbinary" msgid "Binary" msgstr "Binaari" #: lazarusidestrconsts.regdlgdecimal msgctxt "lazarusidestrconsts.regdlgdecimal" msgid "Decimal" msgstr "Decimaali" #: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters msgid "Display type for selected Registers" msgstr "Näyttö valituille rekistereille" #: lazarusidestrconsts.regdlghex msgid "Hex" msgstr "Hexa" #: lazarusidestrconsts.regdlgoctal msgid "Octal" msgstr "Oktaali" #: lazarusidestrconsts.regdlgraw msgid "Raw" msgstr "Raaka" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" msgstr "Lisää käänteinen" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "Lisää käännöksen numeroa automaattisesti" #: lazarusidestrconsts.rsavailablescanners msgid "Available scanners" msgstr "Tarjolla olevat skannerit" #: lazarusidestrconsts.rsbuild msgid "&Build:" msgstr "Käännä:" #: lazarusidestrconsts.rscharacterset msgid "Character set:" msgstr "" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page" msgstr "Sulje käytössä oleva välilehti" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" msgstr "" #: lazarusidestrconsts.rscreatenewdefine msgid "Create new define" msgstr "" #: lazarusidestrconsts.rscreatingdirfailed msgid "Creating directory \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinkfailed msgid "Creating symbolic link \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinknotsupported msgid "Creating symbolic link is not supported on this platform!" msgstr "Tämä alusta ei tue symbolisia linkkejä" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" msgstr "Salli kansainvälistäminen" #: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma" msgstr "Anna vähintään yksi merkkijono mitä tahdot etsiä tai millä tahdot suodattaa luettelon. Erota välilyönnillä tai pilkulla" #: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression msgid "Filter the list with the current filter expression" msgstr "Suodata luettelo nykyisellä suodattimella" #: lazarusidestrconsts.rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" msgstr "Lomaketiedosto (*.dfm)|*.dfm" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found, but not listed here: " msgstr "Löytyi, muttei ole luettelossa: " #: lazarusidestrconsts.rsgotothenextiteminthesearchlist msgid "Go to the next item in the search list" msgstr "" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" msgstr "Kansainvälisyys-asetukset" #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include Version Info in executable" msgstr "Lisää versiotieto suoritettavaan ohjelmaan" #: lazarusidestrconsts.rsiwpcustomposition msgid "Custom position" msgstr "" #: lazarusidestrconsts.rsiwpdefault msgctxt "lazarusidestrconsts.rsiwpdefault" msgid "Default" msgstr "Oletus" #: lazarusidestrconsts.rsiwpdocked msgid "Docked" msgstr "Telakoitu" #: lazarusidestrconsts.rsiwprestorewindowgeometry msgid "Restore window geometry" msgstr "Palauta ikkunan mitat" #: lazarusidestrconsts.rsiwprestorewindowsize msgid "Restore window size" msgstr "Palauta ikkunan koko" #: lazarusidestrconsts.rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Käytä ikkunamanagerin asetuksia" #: lazarusidestrconsts.rskey msgctxt "lazarusidestrconsts.rskey" msgid "Key" msgstr "Näppäin" #: lazarusidestrconsts.rslanguageafrikaans msgid "Afrikaans" msgstr "afrikaans" #: lazarusidestrconsts.rslanguagearabic msgid "Arabic" msgstr "arabia" #: lazarusidestrconsts.rslanguageautomatic msgid "Automatic (or english)" msgstr "oletuskieli (tai englanti)" #: lazarusidestrconsts.rslanguagecatalan msgid "Catalan" msgstr "katalaani" #: lazarusidestrconsts.rslanguagechinese msgid "Chinese" msgstr "kiina" #: lazarusidestrconsts.rslanguageczech msgid "Czech" msgstr "tsekki" #: lazarusidestrconsts.rslanguagedutch msgid "Dutch" msgstr "hollanti" #: lazarusidestrconsts.rslanguageenglish msgid "English" msgstr "englanti" #: lazarusidestrconsts.rslanguagefinnish msgid "Finnish" msgstr "suomi" #: lazarusidestrconsts.rslanguagefrench msgid "French" msgstr "ranska" #: lazarusidestrconsts.rslanguagegerman msgid "German" msgstr "saksa" #: lazarusidestrconsts.rslanguagehebrew msgid "Hebrew" msgstr "heprea" #: lazarusidestrconsts.rslanguageindonesian msgid "Indonesian" msgstr "indonesia" #: lazarusidestrconsts.rslanguageitalian msgid "Italian" msgstr "italia" #: lazarusidestrconsts.rslanguagejapanese msgid "Japanese" msgstr "japani" #: lazarusidestrconsts.rslanguagelithuanian msgid "Lithuanian" msgstr "liettua" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" msgstr "Kieli valinnat" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" msgstr "puola" #: lazarusidestrconsts.rslanguageportuguese msgid "Portuguese" msgstr "portugali" #: lazarusidestrconsts.rslanguageportuguesebr msgid "Brazilian Portuguese" msgstr "Brasilian portugali" #: lazarusidestrconsts.rslanguagerussian msgid "Russian" msgstr "venäjä" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" msgstr "Kielen valinta:" #: lazarusidestrconsts.rslanguageslovak msgid "Slovak" msgstr "slovakki" #: lazarusidestrconsts.rslanguagespanish msgid "Spanish" msgstr "espanja" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" msgstr "turkki" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" msgstr "ukraina" #: lazarusidestrconsts.rsmajorversion msgid "&Major version:" msgstr "Suuri versionumero:" #: lazarusidestrconsts.rsminorversion msgid "Mi&nor version:" msgstr "Pieni versionumero:" #: lazarusidestrconsts.rsok msgctxt "lazarusidestrconsts.rsok" msgid "OK" msgstr "" #: lazarusidestrconsts.rsotherinfo msgid "Other info" msgstr "Muuta tietoa" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" msgstr "" #: lazarusidestrconsts.rsremove msgid "&Remove" msgstr "Poista" #: lazarusidestrconsts.rsresetfilter msgid "Reset filter" msgstr "" #: lazarusidestrconsts.rsrevision msgid "&Revision:" msgstr "" #: lazarusidestrconsts.rsscanners msgid "Scanners" msgstr "" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" msgstr "" #: lazarusidestrconsts.rsstartanewsearch msgid "Start a new search" msgstr "Aloita uusi etsintä" #: lazarusidestrconsts.rsvalue msgctxt "lazarusidestrconsts.rsvalue" msgid "Value" msgstr "Arvo" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" msgstr "Versionumerointi" #: lazarusidestrconsts.srkmalreadyconnected msgid " The key \"%s\" is already connected to \"%s\"." msgstr "" #: lazarusidestrconsts.srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "Vaihtoehtoinen näppäin (tai kahden näppäimen yhdistelmä)" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" msgstr "Ohjevalikon komennot" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" msgstr "Komentojen komennot" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" msgstr "" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" msgstr "" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" msgstr "Kursorin siirtokomennot" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" msgstr "Tekstin muokkauskomennot" #: lazarusidestrconsts.srkmcatenvmenu msgid "Environment menu commands" msgstr "Käyttöliittymä valikon komennot" #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" msgstr "Tiedostovalikon komennot" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" msgstr "Tekstin laskostuskomennot" #: lazarusidestrconsts.srkmcatmarker msgid "Text marker commands" msgstr "Tekstin merkkauskomennot" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" msgstr "Pakettivalikon komennot" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" msgstr "Projektivalikon komennot" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" msgstr "Suorita-valikon komennot" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Tekstin etsintä- ja korvauskomennot" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" msgstr "Tekstin valintakomennot" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "Lähdekoodieditorin komennot" #: lazarusidestrconsts.srkmcatsyncroedit msgid "Syncron Editing" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditoff msgid "Syncron Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcatsyncroeditsel msgid "Syncron Editing (while selecting)" msgstr "" #: lazarusidestrconsts.srkmcattemplateedit msgid "Template Editing" msgstr "" #: lazarusidestrconsts.srkmcattemplateeditoff msgid "Template Editing (not in Cell)" msgstr "" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" msgstr "Työkalutvalikon komennot" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" msgstr "Näytä valikon komennot" #: lazarusidestrconsts.srkmcommand msgctxt "lazarusidestrconsts.srkmcommand" msgid "Command:" msgstr "Komento:" #: lazarusidestrconsts.srkmcommand1 msgid " command1 \"" msgstr "" #: lazarusidestrconsts.srkmcommand2 msgid " command2 \"" msgstr "" #: lazarusidestrconsts.srkmconflic msgid "Conflict " msgstr "" #: lazarusidestrconsts.srkmconflicw msgid " conflicts with " msgstr "" #: lazarusidestrconsts.srkmecabortbuild msgid "abort build" msgstr "keskeytä käännös" #: lazarusidestrconsts.srkmecabstractmethods msgid "Abstract methods ..." msgstr "Abstraktit metodit ..." #: lazarusidestrconsts.srkmecaddbpaddress msgid "add address breakpoint" msgstr "lisää keskeytyskohta osoitteeseen" #: lazarusidestrconsts.srkmecaddbpsource msgid "add source breakpoint" msgstr "lisää keskeytyskohta lähdekoodiin" #: lazarusidestrconsts.srkmecaddbpwatchpoint msgid "add data/watchpoint" msgstr "" #: lazarusidestrconsts.srkmecaddjumppoint msgid "Add jump point" msgstr "Lisää hyppypiste" #: lazarusidestrconsts.srkmecaddwatch msgid "add watch" msgstr "lisää vahti" #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" msgstr "" #: lazarusidestrconsts.srkmecblockcopy msgid "Copy Block" msgstr "Kopioi lohko" #: lazarusidestrconsts.srkmecblockdelete msgid "Delete Block" msgstr "Poista lohko" #: lazarusidestrconsts.srkmecblockgotobegin msgid "Goto Block begin" msgstr "Mene lohkon alkuun" #: lazarusidestrconsts.srkmecblockgotoend msgid "Goto Block end" msgstr "Mene lohkon loppuun" #: lazarusidestrconsts.srkmecblockhide msgid "Hide Block" msgstr "Piilota lohko" #: lazarusidestrconsts.srkmecblockindent msgid "Indent block" msgstr "Sisennä lohko" #: lazarusidestrconsts.srkmecblockmove msgid "Move Block" msgstr "Siirrä lohkoa" #: lazarusidestrconsts.srkmecblocksetbegin msgid "Set block begin" msgstr "Aseta lohkon alku" #: lazarusidestrconsts.srkmecblocksetend msgid "Set block end" msgstr "Aseta lohkon loppu" #: lazarusidestrconsts.srkmecblockshow msgid "Show Block" msgstr "Näytä lohko" #: lazarusidestrconsts.srkmecblocktogglehide msgid "Toggle block" msgstr "Vaihda lohko" #: lazarusidestrconsts.srkmecblockunindent msgid "Unindent block" msgstr "Poista lohkon sisennys" #: lazarusidestrconsts.srkmecbuild msgid "build program/project" msgstr "" #: lazarusidestrconsts.srkmecbuildfile msgid "build file" msgstr "" #: lazarusidestrconsts.srkmecbuildlazarus msgid "Build lazarus" msgstr "Käännä Lazarus" #: lazarusidestrconsts.srkmecchar msgid "Char" msgstr "Merkki" #: lazarusidestrconsts.srkmeccleanupcompiled msgid "clean up build files" msgstr "" #: lazarusidestrconsts.srkmecclearall msgid "Delete whole text" msgstr "Poista koko teksti" #: lazarusidestrconsts.srkmeccodetoolsdefinesed msgid "Codetools defines editor" msgstr "" #: lazarusidestrconsts.srkmeccodetoolsoptions msgid "Codetools options" msgstr "Codetools asetukset" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" msgstr "Sarake valinta alas" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" msgstr "Sarake valinta aivan loppuun" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" msgstr "Sarake valinta aivan alkuun" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" msgstr "Sarake valinta vasemmalle" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" msgstr "Sarake valinta rivin loppuun" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" msgstr "Sarake valinta rivin alkuun" #: lazarusidestrconsts.srkmeccolsellinetextstart msgid "Column Select to text start in line" msgstr "Sarake valinta rivin alussa olevaan tekstiin" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" msgstr "Sarake valinta viimeinen sivu" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" msgstr "Sarake valinta sivu alas" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" msgstr "Sarake valinta ensimmäinen sivu" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" msgstr "Sarake valinta sivu ylös" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" msgstr "Sarake valinta oikealle" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" msgstr "Sarake valinta ylös" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" msgstr "Sarake valinta sana vasemmalla" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" msgstr "Sarake valinta sana oikealla" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" msgstr "Sarake valintatila" #: lazarusidestrconsts.srkmeccompile msgid "compile program/project" msgstr "käännä ohjelma/projekti" #: lazarusidestrconsts.srkmeccompileroptions msgid "compiler options" msgstr "kääntäjän asetukset" #: lazarusidestrconsts.srkmeccompletecode msgid "Complete code" msgstr "Täydennä koodi" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" msgstr "" #: lazarusidestrconsts.srkmeccopy msgid "Copy selection to clipboard" msgstr "Kopio valittu lohko leikepöydälle" #: lazarusidestrconsts.srkmeccopyeditornewwindow msgid "Copy editor to new window" msgstr "Kopioi editori uuteen ikkunaan" #: lazarusidestrconsts.srkmeccopyeditornextwindow msgid "Copy editor to next free window" msgstr "Kopioi editori seuraavaan vapaaseen ikkunaan" #: lazarusidestrconsts.srkmeccopyeditorprevwindow msgid "Copy editor to prior free window" msgstr "Kopioi editori edelliseen vapaaseen ikkunaan" #: lazarusidestrconsts.srkmeccustomtool msgid "Custom tool %d" msgstr "Erikoistyökalu %d" #: lazarusidestrconsts.srkmeccut msgid "Cut selection to clipboard" msgstr "Leikkaa valittu lohko leikepöydälle" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" msgstr "Poista rivin alkuun" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" msgstr "Poista kirjain kursorin kohdasta" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" msgstr "Poista kursorin kohdasta rivin loppuun" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" msgstr "Poista edellinen kirjain" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" msgstr "Poista edellinen sana" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" msgstr "Poista tämä rivi" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" msgstr "Poista seuraava sana" #: lazarusidestrconsts.srkmecdiff msgctxt "lazarusidestrconsts.srkmecdiff" msgid "Diff" msgstr "Eroavuudet" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "Siirrä kursori aivan loppuun" #: lazarusidestrconsts.srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "Siirrä kursori aivan alkuun" #: lazarusidestrconsts.srkmecemptymethods msgid "Empty methods ..." msgstr "Tyhjät metodit ..." #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" msgstr "IDE asetukset" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" msgstr "arvioi/muuta" #: lazarusidestrconsts.srkmecextractproc msgid "Extract procedure" msgstr "Erota aliohjelma" #: lazarusidestrconsts.srkmecexttool msgid "External tool %d" msgstr "Ulkoinen työkalu %d" #: lazarusidestrconsts.srkmecexttoolsettings msgid "External tools settings" msgstr "Ulkoisten työkalujen asetukset" #: lazarusidestrconsts.srkmecfind msgid "Find text" msgstr "Etsi tekstiä" #: lazarusidestrconsts.srkmecfindblockotherend msgid "Find block other end" msgstr "Etsi lohkon toinen pää" #: lazarusidestrconsts.srkmecfindblockstart msgid "Find block start" msgstr "Etsi lohkon alku" #: lazarusidestrconsts.srkmecfinddeclaration msgid "Find declaration" msgstr "Etsi määrittely" #: lazarusidestrconsts.srkmecfindidentifierrefs msgid "Find identifier references" msgstr "Etsi viittauksia tunnisteisiin" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in files" msgstr "Etsi tiedostoista" #: lazarusidestrconsts.srkmecfindnext msgid "Find next" msgstr "Etsi seuraava" #: lazarusidestrconsts.srkmecfindnextwordoccurrence msgid "Find next word occurrence" msgstr "Etsi sanan seuraava esiintymiskohta" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find overloads" msgstr "" #: lazarusidestrconsts.srkmecfindoverloadscapt msgid "Find overloads ..." msgstr "" #: lazarusidestrconsts.srkmecfindprevious msgid "Find previous" msgstr "Etsi edellinen" #: lazarusidestrconsts.srkmecfindprevwordoccurrence msgid "Find previous word occurrence" msgstr "Etsi sanan edellinen esiintymiskohta" #: lazarusidestrconsts.srkmecfindproceduredefinition msgid "Find procedure definiton" msgstr "" #: lazarusidestrconsts.srkmecfindproceduremethod msgid "Find procedure method" msgstr "" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" msgstr "Laskosta kursorin kohdalta" #: lazarusidestrconsts.srkmecfoldlevel msgid "Fold to Level %d" msgstr "Laskosta tasolle %d" #: lazarusidestrconsts.srkmecgotoeditor msgid "Go to editor %d" msgstr "Siirry muokkaimeen %d" #: lazarusidestrconsts.srkmecgotoincludedirective msgid "Go to to include directive of current include file" msgstr "Siirry riville, mistä tämä include-tiedosto on luettu" #: lazarusidestrconsts.srkmecgotolinenumber msgid "Go to line number" msgstr "Siirry riville" #: lazarusidestrconsts.srkmecgotomarker msgid "Go to Marker %d" msgstr "Siirry merkkiin %d" #: lazarusidestrconsts.srkmecgotoxy msgid "Goto XY" msgstr "Siirry XY" #: lazarusidestrconsts.srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" msgstr "Arvaa väärin sijoitettu $IFDEF" #: lazarusidestrconsts.srkmecimestr msgid "Ime Str" msgstr "" #: lazarusidestrconsts.srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "Lisää muutos-lokiin tapahtuma" #: lazarusidestrconsts.srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "Lisää merkkikartasta" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "Aseta CVS:n avainsana Author" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "Aseta CVS:n avainsana Date" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "Aseta CVS:n avainsana Header" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "Aseta CVS:n avainsana ID" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "Aseta CVS:n avainsana Log" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "Aseta CVS:n avainsana Name" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "Aseta CVS:n avainsana Revision" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "Aseta CVS:n avainsana Source" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" msgstr "" #: lazarusidestrconsts.srkmecinsertfilename msgid "Insert full Filename" msgstr "" #: lazarusidestrconsts.srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "Lisää GPL ilmoitus" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" msgstr "Lisää GUID" #: lazarusidestrconsts.srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "Lisää LGPL ilmoitus" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" msgstr "Rivinvaihto ilman kursorinsiirtoa" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" msgstr "" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" msgstr "" #: lazarusidestrconsts.srkmecinspect msgid "inspect" msgstr "tutki" #: lazarusidestrconsts.srkmecinvertassignment msgid "Invert assignment" msgstr "Käännä asettaminen" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" msgstr "Rivinvaihto ja siirrä kursoria" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" msgstr "Siirrä kursori rivin loppuun" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" msgstr "Rivin valintamoodi" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" msgstr "Siirrä kursori rivin alkuun" #: lazarusidestrconsts.srkmeclinetextstart msgid "Move cursor to text start in line" msgstr "Siirrä kursori rivillä olevan tekstin alkuun" #: lazarusidestrconsts.srkmeclockeditor msgid "Lock Editor" msgstr "" #: lazarusidestrconsts.srkmecmakeresourcestring msgid "Make resource string" msgstr "" #: lazarusidestrconsts.srkmecmatchbracket msgid "Go to matching bracket" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" msgstr "Siirry vasemmalla olevalle välilehdelle" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "Siirrä editori vasempaan reunaan" #: lazarusidestrconsts.srkmecmoveeditornewwindow msgid "Move editor to new window" msgstr "Siirrä editori uuteen ikkunaan" #: lazarusidestrconsts.srkmecmoveeditornextwindow msgid "Move editor to next free window" msgstr "Siirrä editori seuraavaan vapaaseen ikkunaan" #: lazarusidestrconsts.srkmecmoveeditorprevwindow msgid "Move editor to prior free window" msgstr "Siirrä editori edelliseen vapaaseen ikkunaan" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" msgstr "Siirry oikealla olevalle välilehdelle" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "Siirrä editori oikeaan reunaan" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" msgstr "Seuraava kirjanmerkki" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" msgstr "Mene seuraavalle välilehdelle" #: lazarusidestrconsts.srkmecnextsharededitor msgid "Go to next editor with same Source" msgstr "Siirry seuraavaan samansisältöiseen editoriin" #: lazarusidestrconsts.srkmecnextwindow msgid "Go to next window" msgstr "Siirry seuraavaan ikkunaan" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" msgstr "Normaali valintamoodi" #: lazarusidestrconsts.srkmecopenfileatcursor msgid "Open file at cursor" msgstr "Avaa kursorin osoittama tiedosto" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" msgstr "Ylikirjoitusmoodi" #: lazarusidestrconsts.srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "Siirrä kursori sivun loppuun" #: lazarusidestrconsts.srkmecpagedown msgid "Move cursor down one page" msgstr "Siirrä kursori sivu alas" #: lazarusidestrconsts.srkmecpageleft msgid "Move cursor left one page" msgstr "Siirrä kursori sivu vasemmalle" #: lazarusidestrconsts.srkmecpageright msgid "Move cursor right one page" msgstr "Siirrä kursori sivu oikealle" #: lazarusidestrconsts.srkmecpagetop msgid "Move cursor to top of page" msgstr "Siirrä kursori sivun alkuun" #: lazarusidestrconsts.srkmecpageup msgid "Move cursor up one page" msgstr "Siirrä kursori sivu ylös" #: lazarusidestrconsts.srkmecpaste msgid "Paste clipboard to current position" msgstr "Liitä leikepöydältä" #: lazarusidestrconsts.srkmecpause msgid "pause program" msgstr "keskeytä ohjelma" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" msgstr "Edellinen kirjanmerkki" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" msgstr "Mene edelliselle välilehdelle" #: lazarusidestrconsts.srkmecprevsharededitor msgid "Go to prior editor with same Source" msgstr "Siirry edelliseen samansisältöiseen editoriin" #: lazarusidestrconsts.srkmecprevwindow msgid "Go to prior window" msgstr "Siirry edelliseen ikkunaan" #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" msgstr "nopea käännös, ei linkkausta" #: lazarusidestrconsts.srkmecquit msgid "Quit" msgstr "Poistu" #: lazarusidestrconsts.srkmecremovebreakpoint msgid "remove break point" msgstr "Poista keskeytyskohta" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove empty methods" msgstr "Poista tyhjät metodit" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove unused units" msgstr "Poista käyttämättömät käännösyksiköt" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename identifier" msgstr "Vaihda tunnisteiden nimiä" #: lazarusidestrconsts.srkmecreplace msgid "Replace text" msgstr "Etsi ja korvaa" #: lazarusidestrconsts.srkmecreportingbug msgctxt "lazarusidestrconsts.srkmecreportingbug" msgid "Reporting a bug" msgstr "Ohjelmavirheen raportointi" #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" msgstr "nollaa virheenjäljitin" #: lazarusidestrconsts.srkmecrun msgid "run program" msgstr "suorita ohjelma" #: lazarusidestrconsts.srkmecrunfile msgid "run file" msgstr "suorita tiedosto" #: lazarusidestrconsts.srkmecrunparameters msgid "run parameters" msgstr "suoritusparametrit" #: lazarusidestrconsts.srkmecsave msgctxt "lazarusidestrconsts.srkmecsave" msgid "Save" msgstr "Tallenna" #: lazarusidestrconsts.srkmecscrolldown msgid "Scroll down one line" msgstr "Rullaa alas yksi rivi" #: lazarusidestrconsts.srkmecscrollleft msgid "Scroll left one char" msgstr "Rullaa vasemmalle yksi merkki" #: lazarusidestrconsts.srkmecscrollright msgid "Scroll right one char" msgstr "Rullaa oikealle yksi merkki" #: lazarusidestrconsts.srkmecscrollup msgid "Scroll up one line" msgstr "Rullaa ylös yksi rivi" #: lazarusidestrconsts.srkmecseldown msgid "Select Down" msgstr "Valitse alas" #: lazarusidestrconsts.srkmecselectall msgctxt "lazarusidestrconsts.srkmecselectall" msgid "Select All" msgstr "Valitse kaikki" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Muunna valinnan tabulaattorit välilyönneiksi" #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" msgstr "Valitse aivan loppuun asti" #: lazarusidestrconsts.srkmecseleditortop msgid "Select to absolute beginning" msgstr "Valitse aivan alkuun asti" #: lazarusidestrconsts.srkmecselgotoxy msgid "Select Goto XY" msgstr "" #: lazarusidestrconsts.srkmecselleft msgid "SelLeft" msgstr "" #: lazarusidestrconsts.srkmecsellineend msgid "Select Line End" msgstr "Valitse rivin loppu" #: lazarusidestrconsts.srkmecsellinestart msgid "Select Line Start" msgstr "Valitse rivin alku" #: lazarusidestrconsts.srkmecsellinetextstart msgid "Select to text start in line" msgstr "Valitse rivillä tekstin alkuun" #: lazarusidestrconsts.srkmecselpagebottom msgid "Select Page Bottom" msgstr "Valitse alimmainen sivu" #: lazarusidestrconsts.srkmecselpagedown msgid "Select Page Down" msgstr "Valitse sivu alas" #: lazarusidestrconsts.srkmecselpageleft msgid "Select Page Left" msgstr "Valitse sivu vasemmalle" #: lazarusidestrconsts.srkmecselpageright msgid "Select Page Right" msgstr "Valitse sivu oikealle" #: lazarusidestrconsts.srkmecselpagetop msgid "Select Page Top" msgstr "Valitse ylimmäinen sivu" #: lazarusidestrconsts.srkmecselpageup msgid "Select Page Up" msgstr "Valitse sivu ylös" #: lazarusidestrconsts.srkmecselright msgid "SelRight" msgstr "" #: lazarusidestrconsts.srkmecselup msgid "Select Up" msgstr "Valitse ylös" #: lazarusidestrconsts.srkmecselwordleft msgid "Select Word Left" msgstr "Valitse sana vasemmalle" #: lazarusidestrconsts.srkmecselwordright msgid "Select Word Right" msgstr "Valitse sana oikealle" #: lazarusidestrconsts.srkmecsetfreebookmark msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" msgid "Set a free Bookmark" msgstr "Aseta vapaa kirjanmerkki" #: lazarusidestrconsts.srkmecsetmarker msgid "Set Marker %d" msgstr "" #: lazarusidestrconsts.srkmecshifttab msgid "Shift Tab" msgstr "" #: lazarusidestrconsts.srkmecshowabstractmethods msgid "Show abstract methods" msgstr "Näytä abstraktit metodit" #: lazarusidestrconsts.srkmecshowcodecontext msgid "Show code context" msgstr "Näytä koodin konteksti" #: lazarusidestrconsts.srkmecshowexecutionpoint msgid "show execution point" msgstr "näytä suorituskohta" #: lazarusidestrconsts.srkmecstopprogram msgid "stop program" msgstr "Pysäytä ohjelma" #: lazarusidestrconsts.srkmecsynpsyncroedcellend msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" msgid "Goto last pos in cell" msgstr "Siirry solun viimeiseen asemaan" #: lazarusidestrconsts.srkmecsynpsyncroedcellhome msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" msgid "Goto first pos in cell" msgstr "Siirry solun ensimmäiseen asemaan" #: lazarusidestrconsts.srkmecsynpsyncroedcellselect msgid "Select Cell" msgstr "Valitse solu" #: lazarusidestrconsts.srkmecsynpsyncroedescape msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynpsyncroednextcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" msgid "Next Cell" msgstr "Seuraava solu" #: lazarusidestrconsts.srkmecsynpsyncroednextcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" msgid "Next Cell (all selected)" msgstr "Seuraava solu (kaikki valittu)" #: lazarusidestrconsts.srkmecsynpsyncroedprevcell msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" msgid "Previous Cell" msgstr "Edellinen solu" #: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" msgid "Previous Cell (all selected)" msgstr "Edellinen solu (kaikki valittu)" #: lazarusidestrconsts.srkmecsynpsyncroedstart msgid "Start Syncro edit" msgstr "Aloita Syncro editointi" #: lazarusidestrconsts.srkmecsynptmpledcellend msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" msgid "Goto last pos in cell" msgstr "Mene solun viimeiseen paikkaan" #: lazarusidestrconsts.srkmecsynptmpledcellhome msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" msgid "Goto first pos in cell" msgstr "Mene solun ensimmäiseen paikkaan" #: lazarusidestrconsts.srkmecsynptmpledcellselect msgid "Select cell" msgstr "Valitse solu" #: lazarusidestrconsts.srkmecsynptmpledescape msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" msgid "Escape" msgstr "" #: lazarusidestrconsts.srkmecsynptmpledfinish msgid "Finish" msgstr "Loppu" #: lazarusidestrconsts.srkmecsynptmplednextcell msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" msgid "Next Cell" msgstr "Seuraava solu" #: lazarusidestrconsts.srkmecsynptmplednextcellrotate msgid "Next Cell (rotate)" msgstr "Seuraava solu (kierrätä)" #: lazarusidestrconsts.srkmecsynptmplednextcellsel msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" msgid "Next Cell (all selected)" msgstr "Seuraava solu (kaikki valittu)" #: lazarusidestrconsts.srkmecsynptmplednextcellselrotate msgid "Next Cell (rotate / all selected)" msgstr "Seuraava solu" #: lazarusidestrconsts.srkmecsynptmpledprevcell msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" msgid "Previous Cell" msgstr "Edellinen solu" #: lazarusidestrconsts.srkmecsynptmpledprevcellsel msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" msgid "Previous Cell (all selected)" msgstr "Edellinen solu (kaikki valittu)" #: lazarusidestrconsts.srkmecsyntaxcheck msgid "Syntax check" msgstr "Syntaksin tarkistus" #: lazarusidestrconsts.srkmectoggleassembler msgid "View assembler" msgstr "Näytä assembler" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle break point" msgstr "Keskeytyskohta päälle/pois" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" msgstr "Näytä keskeytyskohdat" #: lazarusidestrconsts.srkmectogglecallstack msgid "View call stack" msgstr "Näytä kutsupino" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" msgstr "Näytä koodin selain" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Naytä koodin tutkija" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" msgstr "Naytä komponenttipaletti" #: lazarusidestrconsts.srkmectoggledebuggerout msgid "View debugger output" msgstr "Naytä virheenjäljittimen tuloste" #: lazarusidestrconsts.srkmectoggleformunit msgid "Switch between form and unit" msgstr "Siirry lomakkeen ja käännösyksikön välillä" #: lazarusidestrconsts.srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "Naytä dokumentointi-editori" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" msgid "View IDE speed buttons" msgstr "Naytä IDEn pikakuvakkeet" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" msgstr "Näytä paikalliset muuttujat" #: lazarusidestrconsts.srkmectogglemarker msgid "Toggle Marker %d" msgstr "Vaihda merkki %d" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" msgstr "Vaihda aktiivisen sanan korostus" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" msgstr "Näytä viestit" #: lazarusidestrconsts.srkmectogglemode msgid "Toggle Mode" msgstr "Vaihda moodi" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Näytä komponenttimuokkain" #: lazarusidestrconsts.srkmectoggleregisters msgid "View registers" msgstr "Näytä rekisterit" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "Näytä rajoitukset" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" msgstr "Näytä etsinnän tulokset" #: lazarusidestrconsts.srkmectogglesourceeditor msgid "View Source Editor" msgstr "Näytä lähdekoodieditori" #: lazarusidestrconsts.srkmectogglewatches msgid "View watches" msgstr "Näytä vahdit" #: lazarusidestrconsts.srkmecunfoldall msgid "Unfold all" msgstr "Poista laskostus kaikkialta" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" msgstr "Poista laskostus kursorin kohdalta" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" msgstr "Tuntematon editorin komento" #: lazarusidestrconsts.srkmecunusedunits msgid "Unused units ..." msgstr "Käyttämättömät käännösyksiköt ..." #: lazarusidestrconsts.srkmecuserfirst msgid "User First" msgstr "Käyttäjä ensin" #: lazarusidestrconsts.srkmecviewanchoreditor msgid "View anchor editor" msgstr "Näytä ankkurointi-editori" #: lazarusidestrconsts.srkmecviewcomponents msgid "View components" msgstr "Näytä komponentit" #: lazarusidestrconsts.srkmecviewforms msgid "View forms" msgstr "Näytä lomakkeet" #: lazarusidestrconsts.srkmecviewhistory msgid "View History" msgstr "Näytä historia" #: lazarusidestrconsts.srkmecviewpseudoterminal msgid "View Terminal Output" msgstr "Näytä komentorivin tuloste" #: lazarusidestrconsts.srkmecviewtaborder msgid "View Tab Order" msgstr "Näytä tabulointijärjestys" #: lazarusidestrconsts.srkmecviewthreads msgid "View Threads" msgstr "Näytä Säikeet" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Näytä käännösyksiköiden riippuvuudet" #: lazarusidestrconsts.srkmecviewunitinfo msgid "View unit information" msgstr "Näytä käännösyksiköiden tiedot" #: lazarusidestrconsts.srkmecviewunits msgid "View units" msgstr "Näytä käännösyksiköt" #: lazarusidestrconsts.srkmecwordcompletion msgid "Word completion" msgstr "Sanan täydennys" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" msgstr "Siirrä kursori sanan vasemmalle puolelle (eteen)" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" msgstr "Siirrä kursori sanan oikealle puolelle (loppuun)" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" msgstr "" #: lazarusidestrconsts.srkmeditkeys msgid "Edit Keys" msgstr "Muokkaa näppäinten toimintoja" #: lazarusidestrconsts.srkmgrabkey msgid "Grab key" msgstr "Valitse 1. painamalla näppäintä" #: lazarusidestrconsts.srkmgrabsecondkey msgid "Grab second key" msgstr "Valitse 2. painamalla näppäintä" #: lazarusidestrconsts.srkmkey msgid "Key (or 2 keys combination)" msgstr "Näppäin (tai näppäinpainallusten yhdistelmä)" #: lazarusidestrconsts.srkmpresskey msgid "Please press a key ..." msgstr "Paina jotain näppäintä ..." #: lazarusidestrconsts.synffoldcommentsinselection msgid "Fold comments in selection" msgstr "Laskosta valitun lohkon kommentit" #: lazarusidestrconsts.synfhidecommentsinselection msgid "Hide comments in selection" msgstr "Piilota valitun lohkon kommentit" #: lazarusidestrconsts.synfunfoldallinselection msgid "Unfold all in Selection" msgstr "Poista laskostus valitusta lohkosta" #: lazarusidestrconsts.synfunfoldcommentsinselection msgid "Unfold comments in Selection" msgstr "Poista kommenttien laskostus valitusta lohkosta" #: lazarusidestrconsts.uefilerocap msgid "File is readonly" msgstr "Tiedosto on vain luettavissa" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" msgstr "Tiedosto \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." msgstr "\" ei voida tallentaa." #: lazarusidestrconsts.uelocked msgid "Locked" msgstr "Lukittu" #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Lisää vahti kursorin kohdalta" #: lazarusidestrconsts.uembookmarkn msgid "Bookmark" msgstr "Kirjanmerkki" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" msgstr "Sulje kaikki muut välilehdet" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" msgstr "Sulje välilehti" #: lazarusidestrconsts.uemcopy msgctxt "lazarusidestrconsts.uemcopy" msgid "Copy" msgstr "Kopioi" #: lazarusidestrconsts.uemcopyfilename msgid "Copy Filename" msgstr "Kopio tiedoston nimi" #: lazarusidestrconsts.uemcopytonewwindow msgid "Clone to new Window" msgstr "Tee uusi näkymä uuteen ikkunaan" #: lazarusidestrconsts.uemcopytootherwindow msgid "Clone to other Window" msgstr "Tee uusi näkymä toiseen ikkunaan" #: lazarusidestrconsts.uemcopytootherwindownew msgctxt "lazarusidestrconsts.uemcopytootherwindownew" msgid "New Window" msgstr "Uusi ikkuna" #: lazarusidestrconsts.uemcut msgctxt "lazarusidestrconsts.uemcut" msgid "Cut" msgstr "Leikkaa" #: lazarusidestrconsts.uemdebugword msgid "Debug" msgstr "Virheenjäljitys" #: lazarusidestrconsts.uemeditorproperties msgid "Editor properties" msgstr "Editorin ominaisuudet" #: lazarusidestrconsts.uemencoding msgid "Encoding" msgstr "Merkistökoodaus" #: lazarusidestrconsts.uemevaluatemodify msgid "&Evaluate/Modify ..." msgstr "Arvioi/Muuta ..." #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" msgstr "&Etsi määrittely" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" msgstr "&Siirry kirjaimerkkiin" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" msgstr "Syntaksin korostus" #: lazarusidestrconsts.ueminspect msgctxt "lazarusidestrconsts.ueminspect" msgid "&Inspect ..." msgstr "Tutki ..." #: lazarusidestrconsts.ueminvertassignment msgid "Invert Assignment" msgstr "Käännä sijoitus päinvastaiseksi" #: lazarusidestrconsts.uemlineending msgid "Line ending" msgstr "Rivinloppu" #: lazarusidestrconsts.uemlockpage msgid "&Lock Page" msgstr "Lukitse sivu" #: lazarusidestrconsts.uemmovepageleft msgid "Move page left" msgstr "Siirrä välilehteä vasemmalle" #: lazarusidestrconsts.uemmovepageleftmost msgid "Move page leftmost" msgstr "Siirrä välilehti vasemmanpuolimmaiseksi" #: lazarusidestrconsts.uemmovepageright msgid "Move page right" msgstr "Siirrä välilehteä oikealle" #: lazarusidestrconsts.uemmovepagerightmost msgid "Move page rightmost" msgstr "Siirrä välilehti oikeanpuolimmaiseksi" #: lazarusidestrconsts.uemmovetonewwindow msgid "Move to new Window" msgstr "Siirrä uuteen ikkunaan" #: lazarusidestrconsts.uemmovetootherwindow msgid "Move to other Window" msgstr "Siirrä toiseen ikkunaan" #: lazarusidestrconsts.uemmovetootherwindownew msgctxt "lazarusidestrconsts.uemmovetootherwindownew" msgid "New Window" msgstr "Uusi ikkuna" #: lazarusidestrconsts.uemnextbookmark msgid "Goto next Bookmark" msgstr "Siirry seuraavaan kirjanmerkkiin" #: lazarusidestrconsts.uemodified msgid "Modified" msgstr "Muutettu" #: lazarusidestrconsts.uemopenfileatcursor msgid "&Open file at cursor" msgstr "&Avaa kursorin osoittama tiedosto" #: lazarusidestrconsts.uempaste msgctxt "lazarusidestrconsts.uempaste" msgid "Paste" msgstr "Liitä" #: lazarusidestrconsts.uemprevbookmark msgid "Goto previous Bookmark" msgstr "Mene edelliseen kirjanmerkkiin" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" msgstr "Siirry aliohjelman rajapinnan ja toteutuksen välillä" #: lazarusidestrconsts.uemreadonly msgctxt "lazarusidestrconsts.uemreadonly" msgid "Read Only" msgstr "Vain luettavissa" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" msgstr "Uudelleen järjestele" #: lazarusidestrconsts.uemruntocursor msgid "&Run to Cursor" msgstr "Jatka kursorin kohtaan" #: lazarusidestrconsts.uemsetbookmark msgid "&Set Bookmark" msgstr "&Merkitse kirjainmerkiksi" #: lazarusidestrconsts.uemsetfreebookmark msgctxt "lazarusidestrconsts.uemsetfreebookmark" msgid "Set a free Bookmark" msgstr "Aseta vapaa kirjanmerkki" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" msgstr "Näytä rivinumerot" #: lazarusidestrconsts.uemsource msgctxt "lazarusidestrconsts.uemsource" msgid "Source" msgstr "Lähdekoodi" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" msgstr "Vaihda kirjanmerkki" #: lazarusidestrconsts.uemtogglebreakpoint msgid "Toggle &Breakpoint" msgstr "Keskeytyskohta päälle/pois" #: lazarusidestrconsts.uemviewcallstack msgid "View Call Stack" msgstr "Näytä kutsupino" #: lazarusidestrconsts.uenotimplcap msgid "Not implemented yet" msgstr "Ei vielä toteutettu" #: lazarusidestrconsts.uenotimplcapagain msgid "I told You: Not implemented yet" msgstr "Usko nyt: Ei vielä toteutettu" #: lazarusidestrconsts.uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" msgstr "Jos voit auttaa tämän ominaisuuden kanssa, lähetä viesti: lazarus@miraclec.com" #: lazarusidestrconsts.uepins msgid "INS" msgstr "Lisää" #: lazarusidestrconsts.uepovr msgid "OVR" msgstr "Korvaa" #: lazarusidestrconsts.uepreadonly msgid "Readonly" msgstr "Vain luettavissa" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" msgstr "Versiotiedot"