mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-23 00:39:44 +02:00
43d2ad6a85
IDE: project options: more values for Win Vista DPI awarness. Issue #30170, modified patch by AlexeyT ........ IDE: Regenerated translations and updated Russian translation ........ git-svn-id: branches/fixes_1_6@53359 -
21178 lines
572 KiB
Plaintext
21178 lines
572 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Last-Translator: Dariusz Mazur <darekm@emadar.com>\n"
|
|
"PO-Revision-Date: 2015-04-10 00:05+0100\n"
|
|
"Project-Id-Version: lazaruside\n"
|
|
"Language-Team: \n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"POT-Creation-Date: \n"
|
|
"MIME-Version: 1.0\n"
|
|
"X-Poedit-SourceCharset: utf-8\n"
|
|
"Language: pl_PL\n"
|
|
"X-Generator: Poedit 1.5.4\n"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
|
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
|
msgid "Select Groups"
|
|
msgstr "Wybierz grupy"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
|
msgid "Select groups to disable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
|
msgid "Select groups to enable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
|
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr "Przywróć wszystkie ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr "Przywróć domyślne ustawienia lewego marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr "Przywróć wszystkie ustawienia tekstu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr "Menu kontekstowe"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr "Skocz do implementacji"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Wklej"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
msgid "Continue %0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr "Zaznacz tekst"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
msgid "Set free bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
#, fuzzy
|
|
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changesThis page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr "Ta strona nie przedstawia bieżących ustawień. Zobacz stronę zaawansowane. Użyj tej strony do przywrócenia zmian zaawansowanych"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Ogólne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
#, fuzzy
|
|
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr "Standardowe, wszystkie działania (pułapka, zwijanie) przy wciśnięciu klawisza myszy"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
#, fuzzy
|
|
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and moveExtended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr "Rozszerzone, działania (pułapka, zwijanie) przy puszczeniu klawisza myszy. Zaznaczenie przy wciśnieciu klawisza myszy i ruchu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr "Lewy margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right mouse includes caret move"
|
|
msgstr "Prawy klawisz myszy wywołuje przesunięcie kursora"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
#, fuzzy
|
|
#| msgid "Drag Selection (copy/paste)"
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr "Przeciągaj zaznaczenie (kopiuj/wklej)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr "Poczwórne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr "Potrójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr "Środkowy klawisz"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr "Posiadasz niezapisane zmiany. Użycie tej strony spowoduje cofnięcie zmian na stronie zaawansowane"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr "< Brak >"
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Małymi Literami, Pierwsza Duża"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Dodaj operator przypisania :="
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr "Podświetlenie nawiasów"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr "Drzewo zwijanego kodu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr "Pułapka wyłączona"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr "Pułapka włączona"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr "Wiersz błędu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr "Punkt wykonania"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
#, fuzzy
|
|
#| msgid "Folded code"
|
|
msgid "Folded code marker"
|
|
msgstr "Zwinięty kod"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Globalny"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr "Lewy margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr "Edycja Syncron"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr "Edycja szablonów"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr "Separator kolektora"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr "Podświetl bieżący wyraz"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr "Wyszukiwanie przyrostowe"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr "Nieprawidłowa pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr "Podświetlenie bieżącego wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr "Numer wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr "Wiersz zmodyfikowany"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr "Zaznaczony obszar"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktywna komórka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktywna komórka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
msgid "Text block"
|
|
msgstr "Blok tekstu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr "Nieznana pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Dodaj średnik"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Wyrównaj górną linię do komentarza z przodu"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr "Zawsze widoczny kursor"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Przy dwuznacznej nazwie pliku:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Ostrzegaj przed kompilacją"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
msgid "Ansi (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
#, fuzzy
|
|
#| msgid "Application Settings"
|
|
msgid "Application settings"
|
|
msgstr "Ustawienia aplikacji"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include assertion code"
|
|
msgstr "Dołącz asercje (-Sa)"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automatycznie twórz:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
#, fuzzy
|
|
#| msgid "When creating new forms, add them to auto-created forms"
|
|
msgid "Auto-create new forms"
|
|
msgstr "Nowe formularze dodawaj do tworzonych automatycznie"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Automatycznie usuń plik"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgctxt "lazarusidestrconsts.dlgautohidecursor"
|
|
msgid "Hide mouse when typing"
|
|
msgstr "Ukryj wskaźnik myszy podczas pisania"
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr "Automatyczne wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindenttype
|
|
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
|
msgid "Auto indent"
|
|
msgstr "Automatyczne wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr "Automatycznie usuwaj puste metody"
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Automatycznie zmień nazwę na małe litery"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Dostępne formularze:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Tło"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgctxt "lazarusidestrconsts.dlgbaknosubdirectory"
|
|
msgid "(no subdirectory)"
|
|
msgstr "(brak podkatalogu)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Taka sama nazwa (w podkatalogu)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Za metodami"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
#, fuzzy
|
|
#| msgid "Selection:"
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr "Zaznaczenie:"
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
msgctxt "lazarusidestrconsts.dlgblockindent"
|
|
msgid "Block indent (spaces)"
|
|
msgstr "Wcięcie bloku (spacjami)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr "Wcięcia blokowe"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr "(ustawianie klawiszy)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr "Spacje"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblocktabindent
|
|
msgid "Block indent (tabs)"
|
|
msgstr "Wcięcie bloku (tabulatorem)"
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr "Podświetlanie nawiasów"
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket pairs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
#, fuzzy
|
|
#| msgid "&Case Sensitive"
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr "&Uwzględnij wielkość liter"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Sprawdzanie opcji kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
msgid "orphaned file found: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Wyniki"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
msgid "using config file %s"
|
|
msgstr "używa plik konfiguracyjny %s"
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "W kolejności klas"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Na końcu"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "małymi literami"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
#, fuzzy
|
|
#| msgid "Preview (Max line length = 1)"
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Podgląd (maks. długość wiersza = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Przedrostek odczytu"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Przyrostek \"zachowany\""
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "WIELKIMI LITERAMI"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Przedrostek zmiennej"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Przedrostek zapisu"
|
|
|
|
#: lazarusidestrconsts.dlgcentercursorline
|
|
#, fuzzy
|
|
#| msgid "Center Cursor Line"
|
|
msgid "Center cursor line"
|
|
msgstr "Wyśrodkuj aktualny wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
#, fuzzy
|
|
#| msgid "Save As - auto rename pascal files lower case"
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Zapisz jako - automatyczna zmiana nazwy na małe litery"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr "Sprawdzaj i automatycznie zapisuj pliki"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Wybierz szablon źródła (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Pokaż przyciski zamykania w zakładkach"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Schemat kolorów"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
#, fuzzy
|
|
#| msgid "C Style Macros (global)"
|
|
msgid "C style macros (global)"
|
|
msgstr "Makra w stylu C (globalne)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
#, fuzzy
|
|
#| msgid "Use ansi strings"
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Używaj łańcuchów typu Ansi"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
#, fuzzy
|
|
#| msgid "Assembler style:"
|
|
msgid "Assembler style"
|
|
msgstr "Styl asemblera:"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr "Testy i asercje"
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr "Komendy kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
#, fuzzy
|
|
#| msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "Operatory w stylu języka C ( +=, -=, *= i /= )"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Utwórz Makefile"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
#, fuzzy
|
|
#| msgid "Debugging info"
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Odpluskwianie"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Dodatkowe ścieżki dla odpluskiwacza:"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Tworzenie źródła"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr "Oba"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr "zwiń"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr "Ukryj"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
#, fuzzy
|
|
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
|
|
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
|
msgstr "Twórz informację odpluskwiacza dla GDB (zwalnia kompilację)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
#, fuzzy
|
|
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Użyj modułu Heaptrc"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Katalogi dołączanych plików (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Info for GDB"
|
|
msgstr "Informacja podstawowa"
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Biblioteki (-Fl)"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
#, fuzzy
|
|
#| msgid "Load/Save"
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Załaduj/Zapisz"
|
|
|
|
#: lazarusidestrconsts.dlgcolor
|
|
msgid "Color"
|
|
msgstr "Kolor"
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr "(Edytuj kolor)"
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr "Niezmodyfikowany"
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Kolory"
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Parametry linii poleceń (bez nazwy pliku)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Make default indent for new line if comment opens at column:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr "Ogranicz wcięcia do"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
msgid "Match text after token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
msgid "Match text including token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend, if matched or not matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend, if matched or not matched (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend, if matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr "Kompilacja i łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
#, fuzzy
|
|
#| msgid "Compiler Messages"
|
|
msgid "Compiler messages"
|
|
msgstr "Komunikaty kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
#, fuzzy
|
|
#| msgid "Compiler messages language file"
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr "Plik tłumaczeń komunikatów kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Opcje kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Uzupełniaj właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
#, fuzzy
|
|
#| msgid "Config Files:"
|
|
msgid "Config files"
|
|
msgstr "Pliki konfiguracyjne:"
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr "Pozostałe informacje odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Przepełnienie"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Analiza"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr "Kopiuj/Wklej z informacją zwinięcia"
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgid "Range"
|
|
msgstr "Zakres"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoshowerr
|
|
#, fuzzy
|
|
#| msgid "Show Errors"
|
|
msgid "Show errors"
|
|
msgstr "Pokaż błędy"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
#, fuzzy
|
|
#| msgid "Show Options"
|
|
msgid "&Show Options"
|
|
msgstr "Pokaż opcje"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
#, fuzzy
|
|
#| msgid "Smart Linkable"
|
|
msgid "Smart linkable"
|
|
msgstr "Sprytne łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
#, fuzzy
|
|
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Inne źródła (pliki .pp/.pas, używane tylko przez IDE, nie przez kompilator)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Stos"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
#, fuzzy
|
|
#| msgid "Strip Symbols From Executable"
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Wyczyść z symboli plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr "Format kodu odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
msgid "Dwarf with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf3 (beta)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
#, fuzzy
|
|
#| msgid "Unit Style"
|
|
msgid "Unit style"
|
|
msgstr "Rodzaj modułu:"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Generuj kod dla valgrind"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr "Gadatliwość"
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
#, fuzzy
|
|
#| msgid "C++ Styled INLINE"
|
|
msgid "C++ styled INLINE"
|
|
msgstr "INLINE w stylu C++"
|
|
|
|
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
|
msgid "Ctrl-middle-click on tab closes all others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Kursor poza końcem linii"
|
|
|
|
#: lazarusidestrconsts.dlgcursorgroupoptions
|
|
#, fuzzy
|
|
#| msgid "Cursor:"
|
|
msgid "Cursor"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr "Kursor przeskakuje zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Cursor skips tabs"
|
|
msgstr "Kursor przeskakuje tabulację"
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Inne rozszerzenie (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Rodzaj i ścieżka do odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Domyślna czcionka edytora"
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Wartość domyślna"
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Usuń szablon "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr "Przyciski -"
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr "Podpowiedzi"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr "Menu -"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Kierunek"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Wyłącz wygładzanie"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr "Użyj koloru prawego marginesu"
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr "Kolor wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr "Sekcje modułu"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr "Klauzule Uses"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokalne)"
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "W tył"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Pogrubiony"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Podkatalog"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Szablony źródeł"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
#, fuzzy
|
|
#| msgid "Add close statement for pascal blocks"
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr "Kompletuj bloki"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Inne rozszerzenie"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
msgid "(%s sec delay)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Ekran"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
#, fuzzy
|
|
#| msgid "Editor files"
|
|
msgid "Editor Files"
|
|
msgstr "Pliki edytora"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Uzupełnianie identyfikatorów"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr "Nowa zakładka w nowym oknie"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr "Nowa zakładka w bieżącym oknie"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Pochylony"
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr "Rozmiar czcionki"
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Opcje edytora"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgid "Misc"
|
|
msgstr "Różne"
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr "Tabulacje i wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Podkreślony"
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr "Klawisz End przenosi do najbliższego końca"
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Zapytaj"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Informacja: plikami projektu są wszystkie pliki w jego katalogu"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Kopia zapasowa"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Pliki"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Siatka"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Język"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagehint
|
|
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Linie naprowadzające"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
#, fuzzy
|
|
#| msgid "Other files"
|
|
msgid "Other Files"
|
|
msgstr "Inne pliki"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
#, fuzzy
|
|
#| msgid "Project"
|
|
msgid "Tabs for project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
|
msgid "Focus messages after compilation"
|
|
msgstr "Ustaw aktywne okno komunikatów po kompilacji"
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgctxt "lazarusidestrconsts.dlgextracharspacing"
|
|
msgid "Extra char spacing"
|
|
msgstr "Odstęp między znakami"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgctxt "lazarusidestrconsts.dlgextralinespacing"
|
|
msgid "Extra line spacing"
|
|
msgstr "Odstęp między wierszami"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgctxt "lazarusidestrconsts.dlgextsymb"
|
|
msgid "Use external gdb debug symbols file"
|
|
msgstr "Użyj zewnętrznego pliku symboli odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Rozszerzenia plików"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
msgid "%s files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Wszystkie pliki"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Ustawienia pulpitu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "Pliki XML"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Wyszukaj tekst przy kursorze"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokalne)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasbeginend"
|
|
msgid "Begin/End (nested)"
|
|
msgstr "Begin/End (zagnieżdżone)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasnestedcomment"
|
|
msgid "Nested Comment"
|
|
msgstr "Zagnieżdżony komentarz"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocbeginend"
|
|
msgid "Begin/End (procedure)"
|
|
msgstr "Begin/End (procedura)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr "Nagraj"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Powtarzaj"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr "Sekcja modułu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasvartype"
|
|
msgid "Var/Type (global)"
|
|
msgstr "Var/Type (globalne)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Kolor tekstu"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Zasady wstawiania procedur"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Zachowaj kolejność procedur"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "Katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
#, fuzzy
|
|
#| msgid "Frame color"
|
|
msgid "Text-mark"
|
|
msgstr "Kolor ramki"
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Edytor formularza"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
#, fuzzy
|
|
#| msgid "&From Cursor"
|
|
msgid "&From cursor"
|
|
msgstr "&Od kursora"
|
|
|
|
#: lazarusidestrconsts.dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Pobierz pozycję"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Globalnie"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Twórz kod dla gprof"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Kolor paska ikon"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Kolor siatki"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Rozmiar siatki X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Odstępy poziome siatki"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Rozmiar siatki Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Odstępy pionowe siatki"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Edytor"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Środowisko"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Pokaż linie naprowadzające"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr "Margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Kolor marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr "Kolor krawędzi marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr "Indeks separatora kolektora"
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Przewijaj pół strony"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr "Rozmiar sterty i stosu"
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
#, fuzzy
|
|
#| msgid "Heap Size"
|
|
msgid "Heap size"
|
|
msgstr "Rozmiar sterty"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Wysokość"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Ukryj okna IDE przy uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr "Ukryj zakładkę w pojedynczym oknie."
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Kolor podświetlenia"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Kolor czcionki podświetlenia"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Cursor"
|
|
msgstr "Po lewej stronie kursora"
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Cursor"
|
|
msgstr "Po prawej stronie kursora"
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Wzmianka - nieużywany parametr \"Sender\""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for unused units in main source"
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Wzmianka - nieużywany moduł w gł. źródle"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Klawisz Home przenosi do najbliższego początku."
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Główna aplikacja"
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
#, fuzzy
|
|
#| msgid "Identifier completion"
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Uzupełniaj identyfikatory"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Identyfikatorów"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr "Opcje IDE"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Dołącz zmienne systemowe"
|
|
|
|
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
|
msgid "Indent"
|
|
msgstr "Wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
#, fuzzy
|
|
#| msgid "Indent and Tabs"
|
|
msgid "Tabs"
|
|
msgstr "Wcięcia i tabulatory:"
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Przed metodami"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Konstruktor musi nazywać się 'init' (destruktor - 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Wstaw odstęp po"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Wstaw odstęp przed"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Odstęp w sekundach"
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Skoki (np. skoki do metod)"
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr "Zachowaj pozycję X kursora"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr "(ustawianie klawisza)"
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Klawisze skrótów"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Błędne klawisze skrótu"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Słów kluczowych"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Pozwalaj na instrukcje LABEL i GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Język"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Na końcu (np. na końcu źródła)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Katalog Lazarusa (domyślny dla wszystkich projektów)"
|
|
|
|
#: lazarusidestrconsts.dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Od lewej:"
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
#, fuzzy
|
|
#| msgid "Guid lines Left,Top"
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "Kolor lewej i górnej"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
#, fuzzy
|
|
#| msgid "Level 1 (quick and debugger friendly)"
|
|
msgid "1 (quick, debugger friendly)"
|
|
msgstr "Poziom 1 (szybki i przyjazny dla debugowania)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
#, fuzzy
|
|
#| msgid "2 (quick optimizations)"
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr "Poziom 2 (Poziom 1 + szybkie optymalizacje)"
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
#, fuzzy
|
|
#| msgid "3 (slow optimizations)"
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "Poziom 3 (Poziom 2 + wolne optymalizacje)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
#, fuzzy
|
|
#| msgid "Level 0 (no extra optimizations)"
|
|
msgid "0 (no optimization)"
|
|
msgstr "Poziom 0 (bez dodatkowej optymalizacji)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Dzielenie linii"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
#, fuzzy
|
|
#| msgid "Link Smart"
|
|
msgid "Link smart"
|
|
msgstr "Łącz sprytnie"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
#, fuzzy
|
|
#| msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Wyświetlaj numery linii w zrzucie błędu uruchomieniowego:"
|
|
|
|
#: lazarusidestrconsts.dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Menu główne"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
#, fuzzy
|
|
#| msgid "View project forms"
|
|
msgid "View Project Forms"
|
|
msgstr "Pokaż formularze projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View Project Frames"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
#, fuzzy
|
|
#| msgid "View project units"
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Pokaż moduły projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Margines i pasek ikon"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Kolor zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
#, fuzzy
|
|
#| msgid "Word under Caret Highlight"
|
|
msgid "Highlight of Word under Caret"
|
|
msgstr "Podświetlenie słowa przy kursorze"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr "Znaczniki użytkownika"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
msgid "Add Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
msgid "Remove Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
msgid "Toggle Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Nazwa"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr "Główne ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match word boundaries for words up to this length:"
|
|
msgstr "Dopasowywuj granice słowa dla słów od długości:"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
#, fuzzy
|
|
#| msgid "Ignore Keywords"
|
|
msgid "Ignore keywords"
|
|
msgstr "Ignoruj słowa kluczowe"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
#, fuzzy
|
|
#| msgid "Disable Timer for Markup Current Word"
|
|
msgid "Disable timer for markup current word"
|
|
msgstr "Wyłącz licznik czasu dla zaznaczenia bieżącego słowa (Edytuj kolor)"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
#, fuzzy
|
|
#| msgid "Trim Spaces (when highlighting current selection)"
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr "Spacje końcowe (gdy podświetlone bieżące zaznaczenie)"
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maksymalny licznik"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maks. długość wiersza:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Liczba niedawno otwartych plików"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Liczba niedawno otwartych projektów"
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Mieszanie metod i właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr "Pojedyncze"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr "Potrójne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr "Poczwórne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr "Środkowy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr "Zduplikowany wpis"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr "Ten wpis jest w konflikcie z istniejącym"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgid "Caret"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr "W górę/W dół"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Inne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr "Mysz"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr "Zaawansowane"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr "Polecenie IDE"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr "Kolektor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr "Drzewo zwijania"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr "Zwinięte [+]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr "Rozwinięte [-]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr "Numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Wybór"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr "Inne działania przy użyciu tego samego przycisku"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.dlgmsgs
|
|
msgctxt "lazarusidestrconsts.dlgmsgs"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr "Podpowiedź"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Ostrzeżenie"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Multi-caret (column-select) move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Multi-caret move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi caret for column selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances
|
|
msgid "Multiple Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Find Editor for Jump Targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr "Ostatnio użyty edytor dla tego pliku"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr "Okno ostatnio użytego edytora (dla pliku)"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr "Strony i Okna"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
#, fuzzy
|
|
#| msgid "Notebook Tabs:"
|
|
msgid "Notebook Tabs"
|
|
msgstr "Zakładki Karty:"
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Nazewnictwo"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
#, fuzzy
|
|
#| msgid "no automatic renaming"
|
|
msgid "No automatic renaming"
|
|
msgstr "bez automatycznej zmiany nazwy"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr "Nie podświetlaj"
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
#, fuzzy
|
|
#| msgid "Do not split line after:"
|
|
msgid "Do not split line after"
|
|
msgstr "Nie dziel wiersza po:"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
#, fuzzy
|
|
#| msgid "Do not split line In front of:"
|
|
msgid "Do not split line in front of"
|
|
msgstr "Nie dziel wiersza przed:"
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor obiektów"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
msgid "Item height"
|
|
msgstr "Wysokość elementu"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr "Szybkie ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr "Użyj domyślnych ustawień Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr "Użyj domyślnych ustawień Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr "Poziom optymalizacji"
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr "Pozostałe optymalizacje"
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
#, fuzzy
|
|
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Pozostałe katalogi modułów (-Fu) (średnik jest separatorem):"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
#, fuzzy
|
|
#| msgid "Overwrite Block"
|
|
msgid "Overwrite block"
|
|
msgstr "Nadpisz blok"
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Podpowiedzi dla palety komponentów"
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
#, fuzzy
|
|
#| msgid "Default pascal extension"
|
|
msgid "Default Pascal extension"
|
|
msgstr "Domyślne rozszerzenie pascala"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
msgid "Highlight control statements as keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
|
msgid "Extended Pascal Keyword Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
#, fuzzy
|
|
#| msgid "Pass options to linker (delimiter is space)"
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Prześlij opcje do linkera (oddzielone spacją)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
msgid "Highlight \"String\" keyword(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Domyślnie"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr "Niezmienny kursor"
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Aplikacja"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr "jako wywołujący (asInvoker)"
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
#, fuzzy
|
|
#| msgid "Clear Icon"
|
|
msgid "&Clear Icon"
|
|
msgstr "Wyczyść ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Utwórz Zestaw Aplikacji"
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr "Wczytaj &domyślne"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr "Poziom wykonywania"
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formularze"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr "najwyższy możliwy (highestAvailable)"
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Ikona:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(rozmiar: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
#, fuzzy
|
|
#| msgid "Load Icon"
|
|
msgid "&Load Icon"
|
|
msgstr "Wczytaj ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr "wymaga administratora (requireAdministrator)"
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr "Zasoby"
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
#, fuzzy
|
|
#| msgid "Save Icon"
|
|
msgid "&Save Icon"
|
|
msgstr "Zapisz ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sesja"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
#, fuzzy
|
|
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Użyj Zestawu Aplikacji do uruchomienia i odpluskiwania (dot. systemu Darwin)"
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
#, fuzzy
|
|
#| msgid "Use manifest file to enable themes (Windows only)"
|
|
msgid "Use manifest file to enable themes"
|
|
msgstr "Użyj pliku manifest aby odblokować kompozycje"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr "Priorytety"
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Opcje projektu"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
msgid "Options for Project: %s"
|
|
msgstr "Opcje dla projektu: %s"
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
#, fuzzy
|
|
#| msgid "Project files"
|
|
msgid "Project Files"
|
|
msgstr "Pliki projektu"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
#, fuzzy
|
|
#| msgid "&Prompt On Replace"
|
|
msgid "&Prompt on replace"
|
|
msgstr "Za&pytaj czy zmienić"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Uzupełnianie właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Nazwa właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
#, fuzzy
|
|
#| msgid "Open last project at start"
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Otwieraj poprzedni projekt po uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgctxt "lazarusidestrconsts.dlgqshowborderspacing"
|
|
msgid "Show border spacing"
|
|
msgstr "Pokaż obramowanie odstępu"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Pokaż siatkę"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Przyciągaj do siatki"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
#, fuzzy
|
|
#| msgid "Regular E&xpressions"
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Wyrażenia regularne"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Zastąp &wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
#, fuzzy
|
|
#| msgid "&Replace With"
|
|
msgid "&Replace with"
|
|
msgstr "&Zamień na"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Raport"
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
#, fuzzy
|
|
#| msgid "color for right, bottom"
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "Kolor prawej i dolnej"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
#, fuzzy
|
|
#| msgid "Right Click selects"
|
|
msgid "Right click selects"
|
|
msgstr "Zaznaczanie prawym klawiszem"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "położenie prawego marginesu"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Katalog roboczy"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
#, fuzzy
|
|
#| msgid "Creation"
|
|
msgid "Rubberband Creation"
|
|
msgstr "Tworzenie"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
#, fuzzy
|
|
#| msgid "Selection"
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Wybór"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Ekran (nie dotyczy win32), np. 198.112.45.11:0, x.org:1, hydra:0.1"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Środowisko"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokalne"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Zmienne systemowe"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Użyj ekranu"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Nadpisanie zmiennych"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
#, fuzzy
|
|
#| msgid "Run parameters"
|
|
msgid "Run Parameters"
|
|
msgstr "Parametry uruchomienia"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Zapisuj informację edytora dla zamykanych plików"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Zapisuj informację edytora tylko dla plików projektu"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Przewiń o jeden mniej"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
#, fuzzy
|
|
#| msgid "Scrolling:"
|
|
msgid "Scrolling"
|
|
msgstr "Przewijanie:"
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Przewijaj poza końcem pliku"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
msgid "Caret past end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr "Nie znaleziono katalogu \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Wyszukiwane przerwane przez użytkownika"
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
#, fuzzy
|
|
#| msgid "Searching..."
|
|
msgid "Searching ..."
|
|
msgstr "Wyszukiwanie..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Ścieżki"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
#, fuzzy
|
|
#| msgid "&Selected Text"
|
|
msgid "&Selected text"
|
|
msgstr "&Zaznaczony tekst"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktop
|
|
msgid "Set active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Domyślny wygląd wszystkich elementów"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Domyślny wygląd elementu"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Zmienna właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of non-visual components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Pokaż kompilowane procedury"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Pokaż numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Pokaż dyrektywy warunkowe"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Pokaż informacje dla odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Pokaż informacje wykonywalne (tylko Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Pokaż ogólne informacje"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Pokaż podpowiedzi marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
#, fuzzy
|
|
#| msgid "Show Hints"
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Pokaż wzmianki"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Wyświetlaj numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr "Pokazuj ikony komunikatów"
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
#, fuzzy
|
|
#| msgid "Show Notes"
|
|
msgid "Show notes"
|
|
msgstr "Pokaż uwagi"
|
|
|
|
#: lazarusidestrconsts.dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Pokaż podsumowanie"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Pokaż sprawdzane pliki"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Pokaż pliki w użyciu"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
#, fuzzy
|
|
#| msgid "Show Warnings"
|
|
msgid "Show warnings"
|
|
msgstr "Pokaż ostrzeżenia"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr "Pojedynczy przycisk na pasku zadań"
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Sprytne zakładki"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Przyrostek (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Licznik (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Przedrostek (~.pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Przyciągaj do linii naprowadzających"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr "Wielolinijkowe zakładki"
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Odstęp"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Podpowiedzi dla głównych przycisków (otwórz, zapisz...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedit
|
|
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródła"
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Rozpocznij"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr "Rozmiar stosu"
|
|
|
|
#: lazarusidestrconsts.dlgstatickeyword
|
|
#, fuzzy
|
|
#| msgid "Static Keyword in Objects"
|
|
msgid "Static keyword in objects"
|
|
msgstr "Słowo kluczowe static w obiektach"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Zatrzymuj po liczbie błędów:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Opcje składni"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tabulator wcina blokowo"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr "Pokaż numer karty w zakładce"
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tab na spacje"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Szerokość tabulatora"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "Docelowa rodzina procesora"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Docelowy system operacyjny"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
#, fuzzy
|
|
#| msgid "Target Platform"
|
|
msgid "Target platform"
|
|
msgstr "Docelowa Platforma:"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Docelowy procesor"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Katalog do budowania testowych projektów"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
#, fuzzy
|
|
#| msgid "&Text to Find"
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "&Text to find"
|
|
msgstr "&Znajdź"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktop
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Od góry:"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
#, fuzzy
|
|
#| msgid "Trim Spaces Style"
|
|
msgid "Trim spaces style"
|
|
msgstr "Styl usuwania spacji"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr "Wiersz edytowany"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr "Opuść wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Obetnij spacje końcowe"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Cofnij po zapisaniu"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
#, fuzzy
|
|
#| msgid "Undo / Redo:"
|
|
msgid "Undo / Redo"
|
|
msgstr "Cofnij / Przywróć:"
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Limit cofania"
|
|
|
|
#: lazarusidestrconsts.dlgunitdepcaption
|
|
#, fuzzy
|
|
#| msgid "Unit dependencies"
|
|
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Zależności modułów"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Odśwież"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Katalog wyjściowy modułów (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr "Niezapisany wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
#, fuzzy
|
|
#| msgid "Code folding"
|
|
msgid "Code Folding"
|
|
msgstr "Zwijanie kodu"
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
#, fuzzy
|
|
#| msgid "Use additional Compiler Config File"
|
|
msgid "Use additional compiler config file"
|
|
msgstr "Użyj dodatkowego pliku konfiguracji kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
#, fuzzy
|
|
#| msgid "Divider drawing"
|
|
msgid "Divider Drawing"
|
|
msgstr "Kreślenie oddzielające"
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
#, fuzzy
|
|
#| msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Użyj standardowego pliku konfiguracji kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Użyj programu ładującego"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "Use (and edit) global scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
msgid "Use local scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Podświetlaj składnię"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr "Dodaj moduł do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Wartość"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Gadatliwość podczas kompilacji:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Pokazuj margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Pokazuj prawy margines"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
#, fuzzy
|
|
#| msgid "&Whole Words Only"
|
|
msgid "&Whole words only"
|
|
msgstr "Tylko całe &słowa"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Szerokość:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Aplikacja graficzna win32"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Okno"
|
|
|
|
#: lazarusidestrconsts.dlgwinpos
|
|
#, fuzzy
|
|
#| msgid "Window Positions"
|
|
msgid "Window positions"
|
|
msgstr "Pozycje okien"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Wielkość liter"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Podgląd"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write FPC logo"
|
|
msgstr "Wypisz logo FPC"
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Wybrane komponenty muszą być na tym samym formularzu"
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr "Wyrównaj ..."
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr "Usuń zaznaczone"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
#, fuzzy
|
|
#| msgid "Mirror horizontal"
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Poziome odbicie lustrzane"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
#, fuzzy
|
|
#| msgid "Mirror vertical"
|
|
msgid "Mirror Vertical"
|
|
msgstr "Pionowe odbicie lustrzane"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back One"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward One"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to Back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to Front"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
#, fuzzy
|
|
#| msgid "Save form as XML"
|
|
msgid "Save Form as XML"
|
|
msgstr "Zapisz formularz jako xml"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr "Skaluj ..."
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skala"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr "Rozmiar ..."
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Rozmiar"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Opcja: Równaj do siatki"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Opcja: Równaj do linii naprowadzających"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr "Po obu stronach"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnclearhint
|
|
msgid "Clear all snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnenablehint
|
|
msgid "Toggle view snapshot or current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
|
msgid "Take Snapshot"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnpowerhint
|
|
msgid "Switch on/off automatic snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnremovehint
|
|
msgid "Remove selected entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
|
msgid "View history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
|
msgid "View Snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumnloc
|
|
msgid "Location"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumntime
|
|
msgid "Time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgformname
|
|
msgctxt "lazarusidestrconsts.histdlgformname"
|
|
msgid "History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Dodaj pliki"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfilestopackage
|
|
#, fuzzy
|
|
#| msgid "Add files to package"
|
|
msgid "Add Files to Package"
|
|
msgstr "Dodaj pliki do pakietu"
|
|
|
|
#: lazarusidestrconsts.lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Dodaj do pakietu"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Dwuznaczny typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Dwuznaczna nazwa klasy"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Dwuznaczna nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Zerwane zależności"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Jest już klasa o tej nazwie."
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewfile
|
|
#, fuzzy
|
|
#| msgid "Create new file"
|
|
msgid "Create New File"
|
|
msgstr "Utwórz nowy plik"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewreq
|
|
msgid "Create New Requirement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Zależność"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
msgid "Existing file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Plik już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr "Nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Plik nie jest modułem"
|
|
|
|
#: lazarusidestrconsts.lisa2piconandsize
|
|
msgid "Icon (maximum 24x24):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Nieprawidłowy typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Nieprawidłowa nazwa klasy"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Nieprawidłowy plik"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Błędna nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Błędna nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid unit name."
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "%s%s%s nie jest prawidłową nazwą modułu."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Nazwa nowej klasy:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewcomponent
|
|
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nowy komponent"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Nowy plik"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, fuzzy,badformat
|
|
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Nie znalazłem pakietu dla zależności %s%s%s.%sWybierz _istniejący_ pakiet."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Nazwa zakładki jest zbyt długa"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
#, fuzzy
|
|
msgid "Palette Page:"
|
|
msgstr "Zakładka palet:"
|
|
|
|
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Moduły pascala muszą mieć rozszerzenie .pp lub .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Przełącz ścieżki"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Typ przodka %s%s%s ma taką samą nazwę jak%smoduł %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Typ przodka %s%s%s nie jest poprawnym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Nazwa klasy %s%s%s i typ przodka %s%s%s są jednakowe."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Klasa o nazwie %s%s%s istnieje już w%spakiecie %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Klasa %s%s%s ma taką samą nazwę jak%smoduł %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nazwa klasy %s%s%s nie jest prawidłowym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Plik %s%s%s należy już do bieżącego projektu.%sDzielenie pliku pomiędzy projektami i pakietami to nie jest dobry pomysł."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, fuzzy,badformat
|
|
#| msgid "The package already has a dependency on the package %s%s%s."
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Pakiet ma już zależność od pakietu %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
|
msgid "The package name \"%s\" is invalid.%sPlease choose an existing package."
|
|
msgstr "Nazwa pakietu %s%s%s jest nieprawidłowa.%sProszę wybrać istniejący pakiet."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, fuzzy,badformat
|
|
#| msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Nazwa zakładki %s%s%s jest zbyt długa (maks. 100 znaków)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Moduł o nazwie %s%s%s już należy do pakietu %s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in this package."
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "W tym pakiecie jest już moduł o nazwie %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgid "The unit name \"%s\" does not correspond to the filename."
|
|
msgstr "Nazwa modułu %s%s%s nie odpowiada nazwie pliku."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Nazwa modułu %s%s%s jest taka sama jak nazwa zainstalowanego komponentu.%sUżywanie jej może spowodować dziwne błędy."
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Nazwa pliku modułu:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Nazwa modułu:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Moduł o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Nieprawidłowa nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Porzucić zmiany?"
|
|
|
|
#: lazarusidestrconsts.lisabort
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisabort"
|
|
msgid "Abort"
|
|
msgstr "Przerwij"
|
|
|
|
#: lazarusidestrconsts.lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Przerwij wszystko"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr "Przerwany"
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Przerwij ładowanie projektu"
|
|
|
|
#: lazarusidestrconsts.lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
msgid "About %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentacja:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr "O IDE"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "O programie Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Nie można znaleźć listy współautorów."
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr "Akcja:"
|
|
|
|
#: lazarusidestrconsts.lisactions
|
|
msgid "Actions:"
|
|
msgstr "Działania:"
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr "Aktywuj"
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr "Aktywuj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktywny filtr"
|
|
|
|
#: lazarusidestrconsts.lisadd
|
|
msgctxt "lazarusidestrconsts.lisadd"
|
|
msgid "Add"
|
|
msgstr "Dodaj"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilesindirectory
|
|
msgid "Add Files in Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr "Dodaj filtr"
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr "Dodaj słowo kluczowe \"do\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr "Dodaj nowy tryb budowania, kopia ustawień z \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr "Dodaj nowe makro"
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject
|
|
msgid "Add package %s to project?"
|
|
msgstr "Dodać pakiet %s do projektu?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr "Dodanie pakietu do projektu"
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr "Dodaj nawiasy parametrów funkcji"
|
|
|
|
#: lazarusidestrconsts.lisaddress
|
|
msgid "Address:"
|
|
msgstr "Adres:"
|
|
|
|
#: lazarusidestrconsts.lisaddressbreakpoint
|
|
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
|
msgid "&Address Breakpoint ..."
|
|
msgstr "Pułapka adresu ..."
|
|
|
|
#: lazarusidestrconsts.lisaddsub
|
|
msgid "Add >>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "Chcesz dodać %s do projektu?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Dodać do katalogów modułów?"
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
msgid "Add value to macro %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
#, fuzzy
|
|
#| msgid "Add file to a package"
|
|
msgid "Add File to Package"
|
|
msgstr "Dodaj plik do pakietu"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
#, fuzzy
|
|
#| msgid "Destination Package"
|
|
msgid "Destination package"
|
|
msgstr "Pakiet docelowy"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
#, fuzzy
|
|
#| msgid "File Type"
|
|
msgid "File type"
|
|
msgstr "Typ pliku"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Błędny pakiet"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, fuzzy,badformat
|
|
#| msgid "Invalid package ID: %s%s%s"
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Błędny identyfikator pakietu: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Pakiet jest dostępny tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s not found."
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Nie znalazłem pakietu %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
#, fuzzy
|
|
#| msgid "Show All"
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Pokaż wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Pakiet %s jest dostępny tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
#, fuzzy,badformat
|
|
#| msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgid "A file \"%s\" already exists.%sReplace it?"
|
|
msgstr "Plik %s%s%s już istnieje.%sChcesz go zastąpić?"
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Wyrównanie"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
#, fuzzy
|
|
#| msgid "All blocks looks ok."
|
|
msgid "All blocks look ok."
|
|
msgstr "Wszystkie bloki wyglądają dobrze."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr "Wszystkie dziedziczone opcje"
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
msgid "All Options"
|
|
msgstr "Wszystkie opcje"
|
|
|
|
#: lazarusidestrconsts.lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalways
|
|
msgid "Always"
|
|
msgstr "Zawsze"
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
#, fuzzy
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr "Zawsze konwertuj domyślną nazwę pliku do małych liter"
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr "Makro o tej nazwie już istnieje."
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Znalazłem dwuznaczny plik"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, fuzzy,badformat
|
|
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Znalazłem dwuznaczną nazwę pliku: %s%s%s%sTen plik może być pomylony z %s%s%s%s%sUsunąć dwuznaczy plik?"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Znalazłem dwuznaczny plik"
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
msgid "Ambiguous unit found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Zastosuj"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr "Pytaj przed zapisem sesji projektu"
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr "Pytaj o nazwę pliku gdy nowy"
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
|
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr "Automatyczne wypełnienie: wyłączone"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr "Automatyczne wypełnienie: włączone"
|
|
|
|
#: lazarusidestrconsts.lisautocontinueafter
|
|
msgid "Auto continue after:"
|
|
msgstr "Automatycznie kontynuuj po:"
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr "Zaznaczenie i dopasowania"
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr "Automatycznie wywołaj po kropce"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "spacja"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "koniec słowa"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
#, fuzzy
|
|
#| msgid "Automatic features"
|
|
msgid "Completion and Hints"
|
|
msgstr "Funkcje automatyzacji"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Automatycznie pokaż"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Nie można utworzyć kopii zapasowej pliku"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Zmiana nazwy pakietu lub wersji łamie zależności. Czy te zależności powinny także zostać zmienione? %sWybierz Tak aby zmienić wszystkie podane zależności.%sWybierz Ignoruj aby złamać zależności i kontynuować."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "rozpoczyna"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr "Za spokrewnionym"
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "be less verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "be more verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
#, fuzzy
|
|
#| msgid "Always Build before Run"
|
|
msgid "Always build before run"
|
|
msgstr "Zawsze buduj przed uruchomieniem"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Polecenie budowania"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Pogrub wartości nie domyślne"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "Border space"
|
|
msgstr "Odstęp "
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dół"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Dolne umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbreak
|
|
msgctxt "lazarusidestrconsts.lisbreak"
|
|
msgid "Break"
|
|
msgstr "Przerwij"
|
|
|
|
#: lazarusidestrconsts.lisbreakpointproperties
|
|
msgid "Breakpoint Properties"
|
|
msgstr "Ustawienia pułapki"
|
|
|
|
#: lazarusidestrconsts.lisbtnadd
|
|
msgctxt "lazarusidestrconsts.lisbtnadd"
|
|
msgid "&Add"
|
|
msgstr "&Dodaj"
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Zamknij"
|
|
|
|
#: lazarusidestrconsts.lisbtndelete
|
|
msgctxt "lazarusidestrconsts.lisbtndelete"
|
|
msgid "&Delete"
|
|
msgstr "&Usuń"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgadd
|
|
msgid "&Add ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "Z&amień..."
|
|
|
|
#: lazarusidestrconsts.lisbtnenabled
|
|
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
|
msgid "&Enabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
#, fuzzy
|
|
#| msgid "Quit"
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "Zakończ"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Usuń"
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr "Zamień"
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbuildfollowingmodes
|
|
msgid "Build the following modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr "Budowanie Lazarusa nie powiodło się"
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
msgid "Build Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
|
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build modes"
|
|
msgstr "Buduj tryby"
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Utwórz nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
msgid "%s byte"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscallstacknotevaluated
|
|
msgid "Stack not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancel
|
|
msgctxt "lazarusidestrconsts.liscancel"
|
|
msgid "Cancel"
|
|
msgstr "Anuluj"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Pomiń ładowanie tego komponentu"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Pomiń ładowanie modułu"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Cannot copy top level component."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Cannot create file %s%s%s"
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Nie można utworzyć pliku %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
msgid "cannot execute \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
msgid "Cannot find %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindunit
|
|
msgid "Cannot find unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
msgid "%s (%s files)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "zawiera"
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Brakujące moduły"
|
|
|
|
#: lazarusidestrconsts.lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgid "Skip"
|
|
msgstr "pomiń"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Wszystkie testy pozytywne"
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Ostrzeżenie"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Kategorie"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr "Złożoność"
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
#, fuzzy
|
|
#| msgid "(Filter)"
|
|
msgid "(filter)"
|
|
msgstr "(Filtr)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
msgctxt "lazarusidestrconsts.liscein"
|
|
msgid "%s in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr "Liczba parametrów traktowana jako \"dużo\""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr "Długie procedury"
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr "Zbyt dużo poziomów zagnieżdżeń procedur"
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr "Zbyt duża liczba parametrów"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr "Wyśrodkuj zagubione okno"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr "Wyśrodkuj formularz"
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Wyśrodkuj w oknie"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
#, fuzzy
|
|
#| msgid "Preferred Exhibition Mode"
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Preferowany tryp pokazywania"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr "Kategoria"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Nigdy, tylko ręcznie"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Podczas działania"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Automatycznie odświeżaj"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Inne"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Aktualizacja"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Przy przełączeniu pliku w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
#, fuzzy
|
|
#| msgid "Show observerations about"
|
|
msgid "Show observations about"
|
|
msgstr "Pokaż obserwacje o"
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Styl"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr "Nienazwane stałe"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr "Nieposortowane składowe klas"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr "Nieposortowane sekcje widoczności klas"
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Zmienne"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr "Błędne wcięcia"
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
|
msgid "Cancel loading this resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeclassnotfound
|
|
msgid "%s%sClass \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponent
|
|
msgid "%s%sComponent: %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponentclass
|
|
msgid "%s%sComponent Class: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecontinueloading
|
|
msgid "Continue loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorreading
|
|
msgid "Error reading %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
msgid "In file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscferoot
|
|
msgid "%sRoot=%s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestopallloading
|
|
msgid "Stop all loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestream
|
|
msgid "%sStream=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestreamposition
|
|
msgid "%s%sStream position: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Zmień"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Zmień klasę"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Zmień kodowanie"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
#, fuzzy
|
|
#| msgid "Change Parent..."
|
|
msgid "Change Parent"
|
|
msgstr "Zmień rodzica..."
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr "konwertuj do formatu Unix /"
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr "konwertuj do formatu Windows \\"
|
|
|
|
#: lazarusidestrconsts.lischaracter
|
|
msgid "Character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Tablica znaków"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr "Zaznacz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr "Sprawdzanie zmian pliku na dysku na podstawie zawartości a nie znacznika czasu"
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Wybierz inną nazwę"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr "Wybierz nazwę komponentu"
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr "Wybierz przykładowy plik"
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr "Wybierz plik z komunikatami dla FPC"
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr "Wybierz plik Pascala dla przykładu wcięć "
|
|
|
|
#: lazarusidestrconsts.lischooseclasssectiondlgformethodcaption
|
|
msgid "Insert new method to section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr "Wybierz plik z komunikatami kompilatora"
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Wybierz pakiet Delphi (*.dpk)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Wybierz projekt Delphi (*.dpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Wybierz moduł Delphi (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Wybierz katalog"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Wybierz katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Wybierz katalog Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosename
|
|
msgid "Choose name"
|
|
msgstr "Wybierz nazwę"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Wybierz źródło programu (*.pp,*.pas,*.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Wybierz strukturę do otoczenia"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr "Wykryto cykliczną zależność"
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr "Wypełnianie klas"
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Klasa nie została znaleziona."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Czyść podkatalogi"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Zachowaj wszystkie pliki tekstowe"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Zachowaj wybrane pliki"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Usuń wyselekcjonowane pliki"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Uproszczona składnia (np. * zamiast .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleancommonfiles
|
|
msgid "Clean common files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Czyść źródła Lazarusa (clean)"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Czyść i buduj"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr "Czyść i buduj projekt"
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Czyść"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr "Klonuj"
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
#, fuzzy
|
|
#| msgid "&Close"
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "&Zamknij"
|
|
|
|
#: lazarusidestrconsts.liscloseall
|
|
msgctxt "lazarusidestrconsts.liscloseall"
|
|
msgid "Close All"
|
|
msgstr "Zamknij wszystko"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr "Zamknij zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr "Zamknij pliki"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgid "Hide window"
|
|
msgstr "Ukryj okno"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr "Zamknij okno edytora"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Opcje interfejsu LCL:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponenty"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paleta"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr "Strony"
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Wykonaj:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Polecenie:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr "Kod"
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Inspektor kodu"
|
|
|
|
#: lazarusidestrconsts.liscodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Dodaj ścieżkę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Przeglądaj"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Potwierdź zamianę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Usuń ścieżkę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr "Opis"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Błędy"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Przykład"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Edytor FPDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<brak>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Zobacz także"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Krótki opis"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr "Obserwator kodu"
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
#, fuzzy
|
|
#| msgid "Add"
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Dodaj"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Dodaj szablon kodu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
#, fuzzy,badformat
|
|
#| msgid " A token %s%s%s already exists! "
|
|
msgid " A token \"%s\" already exists! "
|
|
msgstr " Token %s%s%s już istnieje! "
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr "Autouzupełnianie gdy"
|
|
|
|
#: lazarusidestrconsts.liscodetemplchange
|
|
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
|
msgid "Change"
|
|
msgstr "Zmień"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentarz:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Edytuj szablon kodu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Akcja: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, fuzzy
|
|
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes.Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Węzły utworzone automatycznie nie mogą być zmieniane %si nie można dodawać ręcznie węzłów potomnych"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, utworzony automatycznie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
#, fuzzy
|
|
#| msgid "Auto generated nodes can not be edited."
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Węzły utworzone automatycznie nie mogą być zmieniane"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Edytor symboli CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
#, fuzzy
|
|
#| msgid "compiler path"
|
|
msgid "Compiler path"
|
|
msgstr "ścieżka do kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Konwertuj"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Utwórz Symbole dla %s katalogu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Utwórz Symbole dla Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Utwórz Symbole dla projektu %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Utwórz makra FPC i ścieżki dla katalogu z projektem fpc"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Rekursywne \"Define\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Usuń element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Katalog główny %s,%sgdzie Borland instalował wszystkie źródła %s.%sNa przykład: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Główny katalog %s,%sgdzie Borland instalował %s wszystkie źródła,%sktóre są używane przez projekt %s.%sNa przykład: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Opis:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "%s katalog"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Wyjdź bez zapisywania"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Katalog"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Kompilator Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Katalog Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Projekt Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Kompilator Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Katalog Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Projekt Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Wstaw szablon kompilatora dla Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Wstaw szablon katalogów dla Delhi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Wstaw szablon projektu Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Projekt Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Wstaw szablon kompilatora dla Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Wstaw szablon katalogu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Wstaw szablon projektu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Wstaw jako potomny"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Wstaw poniżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Wstaw szablon"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Błędny rodzic"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Błędny element rodzica"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Błądny poprzedni element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s katalog główny,%sgdzie Borland Zainstalował wszystkie %s źródła.%sNp: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s główny katalog ,%sgdzie Borland zainstalował %s wszystkie źródła,%sktóre są używane przez projekt %s.%snp: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Przesuń w dół"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Przesuń o poziom niżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Przesuń o poziom wyżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Przesuń w górę"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Nowy element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Element tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "nie wybrano elementu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
#, fuzzy
|
|
#| msgid "Parent node can not contain child nodes."
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Rodzic nie może zawierać elementów"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Poprzedni element nie może zawierać potomnych"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Katalog projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "katalog projektu %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Błąd odczytu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Zapisz i wyjdź"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Wybrany element:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Katalog projektu Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "%s katalog projektu,%sktóry zawiera plik .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "\"Undefine\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "\"Undefine All\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Rekursywne \"Undefine\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Wartość jako tekst"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Zmienna:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Błąd zapisu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Na"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr "Nawias"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Dwukropek"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Przecinek"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identyfikator"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Słowo kluczowe"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nowa linia"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Liczba"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Kropka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Średnik"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Odstęp"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Stała łańcuchowa"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Wykonaj po"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Wykonaj przed"
|
|
|
|
#: lazarusidestrconsts.liscoladdress
|
|
msgid "Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolclass
|
|
msgid "Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
msgid "Collapse All (/)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolreturns
|
|
msgid "Returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolvisibility
|
|
msgid "Visibility"
|
|
msgstr "Widoczność"
|
|
|
|
#: lazarusidestrconsts.liscommandafter
|
|
msgid "Command after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Polecenie po module publikacji"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Parametry linii poleceń"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Parametry wiersza poleceń programu"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Kompiluj"
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Kompilator"
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Błąd: nieprawidłowy kompilator: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Nazwa pliku kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
#, fuzzy
|
|
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler PathHint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Porada: możesz ustawić ścieżkę kompilatora w Środowisko->Opcje środowiska->Pliki->Ścieżka kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "UWAGA: brak plik konfiguracji codetools - użyję opcji domyślnych"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "UWAGA: ładuję stary plik opcji codetools"
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Kompiluj"
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (kompilacja...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr "Nigdy"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
|
msgid "Component name \"%s\" is a Pascal keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is keyword"
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Jako nazwy komponentu %s%s%s próbujesz użyć słowa kluczowego"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is not a valid identifier"
|
|
msgid "Component name \"%s\" is not a valid identifier"
|
|
msgstr "Nazwa komponentu %s%s%s nie jest prawidłowym identyfikatorem"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Otwórz pakiet..."
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Otwórz moduł"
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
#, fuzzy
|
|
#| msgid "Test"
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Warunek"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
#, fuzzy
|
|
#| msgid "Conditionals:"
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr "Warunki:"
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Katalog z konfiguracją Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "Configure %sBuild Lazarus%s"
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr "Konfiguracja %sBuduj Lazarusa%s"
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr "Wykryty konflikt"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "zawiera"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinue
|
|
msgctxt "lazarusidestrconsts.liscontinue"
|
|
msgid "Continue"
|
|
msgstr "Kontynuuj"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Współautorzy"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddedunittousessection
|
|
msgid "Added unit %s to uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
msgid " { *Converted from %s* }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
msgid "Deleted file %s"
|
|
msgstr "Skasowano plik %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
msgid "Added defines %s in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
msgid "Conversion took: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfile
|
|
msgid "* Converting file %s *"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
msgid "Error=\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr "Błąd podczas konwersji modułu"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixingusedunits
|
|
msgid "* Fixing used units for file %s *"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr "Nazwa pakietu istnieje"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
msgid "Omitted unit %s from project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
|
|
msgid "Removed unit \"%s\" in uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfile
|
|
msgid "* Repairing form file %s *"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
msgid "Units to replace in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Konwertuj"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
#, fuzzy
|
|
#| msgid "Convert encoding"
|
|
msgid "Convert Encoding"
|
|
msgstr "Konwertuj kodowanie"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Konwertuj projekt lub pakiet"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
msgid "Replaced call %s with %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
msgid "This log was saved to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr "Moduł do zamiany"
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr "Pojedyncze"
|
|
|
|
#: lazarusidestrconsts.liscoolbarclearselection
|
|
msgid "Clear selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Szablony źródeł"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródła"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopy
|
|
msgctxt "lazarusidestrconsts.liscopy"
|
|
msgid "Copy"
|
|
msgstr "Kopiuj"
|
|
|
|
#: lazarusidestrconsts.liscopyall
|
|
msgid "Copy All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr "Kopiuj wszystkie elementy do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyalloutputclipboard
|
|
msgid "Copy all output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr "Kopiuj wszystkie komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr "Kopiuj opis do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Błąd kopiowania"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
msgid "Copy Filename %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Kopiuj wybrane komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Przeszukuj komunikaty z FPC"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Przeszukuj komunikaty z Make"
|
|
|
|
#: lazarusidestrconsts.liscoscanformessages
|
|
msgid "Scan for messages:"
|
|
msgstr "Przeszukuj komunikaty:"
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
#, fuzzy
|
|
#| msgid "Skip calling Compiler"
|
|
msgid "Skip calling compiler"
|
|
msgstr "Pomiń wywołanie kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscouldnotadditomainsource
|
|
msgid "Could not add \"{$I %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
|
msgid "Could not add \"{$R %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
|
msgid "Could not add \"%s\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
|
msgid "Could not remove \"%s\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
|
msgid "Could not remove \"{$I %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
|
msgid "Could not remove \"{$R %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Otwórz pakiet %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Otwórz moduł %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
msgid ", CPU: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Najpierw utwórz projekt!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
msgid "Create local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr "(Utwórz nowy pakiet)"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr "Utwórz/aktualizuj pliki .po podczas zapisu plików lfm"
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscsbottom
|
|
msgctxt "lazarusidestrconsts.liscsbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dół"
|
|
|
|
#: lazarusidestrconsts.liscstop
|
|
msgctxt "lazarusidestrconsts.liscstop"
|
|
msgid "Top"
|
|
msgstr "Góra"
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Wybierz katalog"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Wartości katalogu Code Tools"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definiuj szablon"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<nie wybrano zmiennej>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Pokaż podgląd"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Narzędzia"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Zmienna: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Nazwa zmiennej"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Szablony"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrent
|
|
msgctxt "lazarusidestrconsts.liscurrent"
|
|
msgid "Current"
|
|
msgstr "Bieżący"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Kolumna w miejscu kursora"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Wiersz w miejscu kursora"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "opcje niestandardowe"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Opcje niestandardowe"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscut
|
|
msgctxt "lazarusidestrconsts.liscut"
|
|
msgid "Cut"
|
|
msgstr "Wytnij"
|
|
|
|
#: lazarusidestrconsts.lisdadattach
|
|
msgid "Attach"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadimagename
|
|
msgid "Image Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadpid
|
|
msgid "PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadrunningprocesses
|
|
msgid "Running Processes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdelete
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
|
msgid "Delete all"
|
|
msgstr "Kasuj wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
|
msgid "Delete all"
|
|
msgstr "Usuń wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
|
msgid "Disable all"
|
|
msgstr "Wyłącz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
|
msgid "Disable all"
|
|
msgstr "Wyłącz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
|
msgid "Enable all"
|
|
msgstr "Włącz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
|
msgid "Enable all"
|
|
msgstr "Włącz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
|
msgid "Copy to Clipboard"
|
|
msgstr "Kopiuj"
|
|
|
|
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
|
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr "Właściwości pułapki"
|
|
|
|
#: lazarusidestrconsts.lisdbgemexpression
|
|
msgid "&Expression:"
|
|
msgstr "Wyrażenie"
|
|
|
|
#: lazarusidestrconsts.lisdbgemnewvalue
|
|
msgid "&New value:"
|
|
msgstr "Nowa wartość"
|
|
|
|
#: lazarusidestrconsts.lisdbgemresult
|
|
msgid "&Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr "Kolor domyślny"
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr "Rzucono wyjątkiem"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr "Ładowanie modułu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr "Porzucenie modułu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr "Koniec wątku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr "Początek wątku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
|
msgid "Delete"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
|
msgid "Enable"
|
|
msgstr "Włącz"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
|
msgid "Enable"
|
|
msgstr "Włącz"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Odpluskwiacz nie wybrany"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpower
|
|
msgid "On/Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpowerhint
|
|
msgid "Disable/Enable updates for the entire window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Błąd odpluskwiacza%sOoops, odpluskwiacz wszedł w stan błędu%sZapisz teraz swoją pracę !%sWciśnij zatrzymaj, i miejmy nadzieję że wszystko będzie dobrze."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
|
msgid "Debugger Error"
|
|
msgstr "Błąd odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
|
msgid "Debugger Information"
|
|
msgstr "Informacje odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
|
msgid "Debugger Warning"
|
|
msgstr "Ostrzeżenia odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Niewłaściwy odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (odpluskwianie...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr "Automatyczne rzutowanie dla obiektów"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr "Dodaj wyjątek"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Dodatkowa ścieżka wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Pułapka"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Czyść dziennik przy uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Główne opcje odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Specyficzne opcje odpluskiwacza (zależne od typu odpluskiwacza)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr "Wprowadź nazwę wyjątku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Dziennik zdarzeń"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Przejęty przez"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Przejęty przez odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Przejęty przez program"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Ignoruj te wyjątki"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Wyjątki językowe"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
#, fuzzy
|
|
#| msgid "Limit linecount to"
|
|
msgid "Limit line count to"
|
|
msgstr "Ogranicz ilość linii do"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Lazarus Exceptions"
|
|
msgstr "Informuj o wyjątkach Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Wyjątki systemowe"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Wyjście"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proces"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr "Zresetuj odpluskwiacz po każdym uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Wznowiony"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Pokaż komunikat przy zatrzymaniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Sygnały"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Wątek"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Nie można załadować pliku"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to load file %s%s%s."
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Nie można załadować pliku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisdecimal
|
|
msgctxt "lazarusidestrconsts.lisdecimal"
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Domyślnie"
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr "(domyślne)"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr "Opóźnienie pojawienia się ramki podpowiedzi i uzupełnień przy długich liniachOpóźnienie pojawienia się ramki podpowiedzi i uzupełnień przy długich liniach"
|
|
|
|
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
|
msgid "Delay for hints and completion box"
|
|
msgstr "Opóźnienie pojawienia się ramki podpowiedzi i uzupełnień"
|
|
|
|
#: lazarusidestrconsts.lisdelete
|
|
msgctxt "lazarusidestrconsts.lisdelete"
|
|
msgid "Delete"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr "Skasować?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "Usuń &wszystko"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr "Usunąć wszystkie pułpaki?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete all breakpoints in file %s%s%s?"
|
|
msgid "Delete all breakpoints in file \"%s\"?"
|
|
msgstr "Usunąć wszystkie pułapki w pliku %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr "Usunąć wszystkie wybrane pułapki?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Czy usunąć wszystkie pliki?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Chcesz usunąć niejasny plik?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpoint
|
|
msgid "Delete Breakpoint"
|
|
msgstr "Usuń pułapkę"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr "Usunąć pułapkę w %s\"%s\" linia %d?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
|
msgid "Delete breakpoint for address %s?"
|
|
msgstr "Usunąć pułapkę na adresie %s?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
|
msgid "Delete watchpoint for \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Nie można usunąć pliku"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
msgid "Delete mode \"%s\""
|
|
msgstr "Usuń tryb \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old file %s%s%s?"
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Chcesz usunąć poprzedni plik %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr "Usunąć poprzedni plik?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr "Usuń zaznaczone pliki."
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr "Usunąć zaznaczone makro?"
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr "Usuń ten dodatek"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
msgid "Delete value %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
#, fuzzy,badformat
|
|
#| msgid "Deleting of file %s%s%s failed."
|
|
msgid "Deleting of file \"%s\" failed."
|
|
msgstr "Nie można usunąć pliku %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphi
|
|
msgid "Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Katalog docelowy"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Bez rozróżniania wielkości liter"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Ignoruj dodane lub usunięte puste linie"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Ignoruj różne znaki końca wiersza (np. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Ignoruj ilość znaków odstępu"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Ignoruj odstępy (ale nie znaki końca linii)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Ignoruj spacje na końcu wiersza"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Ignoruj spacje na początku wiersza"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Tylko zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
#, fuzzy
|
|
#| msgid "Open Diff in editor"
|
|
msgid "Open difference in editor"
|
|
msgstr "Otwórz Diff w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdigits
|
|
msgid "Digits:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr "Katalog:"
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
msgid "directory %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotwritable
|
|
msgid "Directory not writable"
|
|
msgstr "Brak prawa zapisu w katalogu"
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablebreakpoint
|
|
msgid "Disable Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisabled
|
|
msgid "Disabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablegroups
|
|
msgid "Disable Groups"
|
|
msgstr "Wyłącz grupy"
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassassembler
|
|
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Porzuć zmiany"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Kliknij na jeden z powyższych elementów aby zobaczyć diff"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Błąd podczas odczytu pliku: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
|
msgid "Ignore disk changes"
|
|
msgstr "Ignoruj zmiany na dysku"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffrevertall
|
|
msgid "Reload from disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Niektóre pliki na dysku uległy zmianie:"
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgadd
|
|
#, fuzzy
|
|
#| msgid "Add..."
|
|
msgctxt "lazarusidestrconsts.lisdlgadd"
|
|
msgid "Add ..."
|
|
msgstr "Dodaj..."
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
#, fuzzy
|
|
#| msgid "Edit..."
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Edytuj..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Eksportuj ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr "Importuj ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgsave
|
|
msgctxt "lazarusidestrconsts.lisdlgsave"
|
|
msgid "Save ..."
|
|
msgstr "Zapisz..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr "nie zmieniaj"
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
msgid "%sDo not check if another IDE instance is already running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr "Nie pokazuj więcej tego komunikatu"
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "W dół"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Rysuj linie siatki"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopiuj wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Wytnij wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Wklej wybrane komponenty ze schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Wybierz komponent-rodzica"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Edytuj"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr "Edytuj klucz"
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgid "Editor macros"
|
|
msgstr "Edytor makr"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Wszystkie pakiety"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Bieżący projekt"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Wszystkie projekty"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "ustaw tryb FPC na DELPHI"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "ustaw tryb FPC na GPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "ustaw tryb FPC na TP"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "włącz IOCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "włącz OVERFLOWCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "włącz RANGECHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "użyj modułu HeapTrc"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "użyj modułu LineInfo"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Poprawny wois narzędzia wymaga przynajmniej nazwy i nazwy pliku."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Edycja narzędzi"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolhidemainform
|
|
msgid "Hide main form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Klawisz"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametry:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Nazwa pliku programu:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for Free Pascal Compiler messages"
|
|
msgstr "Przeszukuj wyjście komunikatów Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for make messages"
|
|
msgstr "Przeszukuj wyjście komunikatów make"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Wymagana nazwa i nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Katalog roboczy:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableall
|
|
msgid "&Enable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablebreakpoint
|
|
msgid "Enable Breakpoint"
|
|
msgstr "Włącz pułapkę"
|
|
|
|
#: lazarusidestrconsts.lisenabled
|
|
msgctxt "lazarusidestrconsts.lisenabled"
|
|
msgid "Enabled"
|
|
msgstr "Włączone"
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablegroups
|
|
msgid "Enable Groups"
|
|
msgstr "Włącz grupy"
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Włącz makra"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = replace whole identifier, Disable = replace prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenclose
|
|
msgid "Enclose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr "Otocz w $IFDEF"
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisendlessloopinmacros
|
|
msgid "Endless loop in macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr "Wpisz nową nazwę makra \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Nie znalazłem katalogu"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Błędna nazwa pliku odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Plik odpluskwiacza \"%s\" nie jest wykonywalny."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Nie znalazłem katalogu testowego \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Błąd: "
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Błąd przy tworzeniu pliku"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Błąd podczas usuwania pliku"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
msgid "Error in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr "Błąd w \"Dodatkowe ścieżki dla odpluskwiacza\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Błąd w trakcie zmiany nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Błędy"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
msgid ", Errors: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
msgid "Error writing file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevalexpression
|
|
msgctxt "lazarusidestrconsts.lisevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr "Oblicz wyrażenie"
|
|
|
|
#: lazarusidestrconsts.lisevaluate
|
|
msgid "E&valuate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevaluatemodify
|
|
msgid "&Evaluate/Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogclear
|
|
msgid "Clear Events"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogoptions
|
|
msgid "Event Log Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogsavetofile
|
|
msgid "Save Events to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventmethodsectionlabel
|
|
msgid "Insert new event methods to section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment
|
|
msgid "Add Comment ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment2
|
|
msgid "Add Comment"
|
|
msgstr "Dodaj komentarz"
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
#, fuzzy
|
|
#| msgid "Every n-th line number:"
|
|
msgid "Every n-th line number"
|
|
msgstr "Każdy n-ty numer linii:"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesbuildallselected
|
|
msgid "Build all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
|
msgid "Open first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexceptiondialog
|
|
msgid "Debugger Exception Notification"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
msgid "%s excluded at run time"
|
|
msgstr "%s wykluczony podczas wykonywania"
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter
|
|
msgid "Exclude filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Wykonanie zatrzymane"
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
msgid "Exit code %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
msgid "Expand All (*)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Rozszerzona nazwa bieżącego pliku w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
#, fuzzy
|
|
#| msgid "Export ..."
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Eksportuj..."
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr "Eksportuj jako HTML"
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Eksportuj listę"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpression
|
|
msgid "Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
|
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
|
msgid "Extend include files search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludepath
|
|
msgid "Extend include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
|
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
|
msgid "Extend unit search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Wyodrębnij"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External Tools"
|
|
msgstr "Zewnętrzne narzędzia"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Osiągnięto maksymalną liczbę narzędzi"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Może być maksymalnie %s narzędzi."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr "Błąd podczas zapisu pliku."
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
|
|
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "Plik"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
|
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Plik %s%s%s%sdoes nie wygląda na tekstowy.%sChcesz go otworzyć go pomimo tego?"
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Filtr plików"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr "Filtry plików"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr "Dodaj wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr "Usuń wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr "Wstaw wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr "Maska pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr "Ustaw domyślne"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr "Filtry plików stosowane w oknie dialogowym \"Otwórz plik\""
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s is virtual."
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Plik %s%s%s jest wirtualny."
|
|
|
|
#: lazarusidestrconsts.lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Nie znalazłem pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%s"
|
|
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Nie znalazłem pliku %s%s%s.%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
msgid "file %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
msgid "File not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Nie znalazłem pliku %s%s%s.%sChcesz go utworzyć?%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Nazwa pliku nie jest napisana małymi literami"
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "To nie jest plik tekstowy"
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
#, fuzzy
|
|
#| msgid "File Settings ..."
|
|
msgid "File Settings"
|
|
msgstr "Ustawienia pliku ..."
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr "*** Wszystkie znalezione pliki mają już poprawne kodowanie ***"
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "Pliki z kodowaniem ASCII lub UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
msgid "File %s is converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Pliki z kodowaniem innym niż ASCII i UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filtr"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
msgid "Filter: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr "Filtruj komunikaty określonego typu"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
msgid "Filter all messages of type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
msgid "Find Declaration of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
#, fuzzy
|
|
#| msgid "Include sub directories"
|
|
msgid "Include &sub directories"
|
|
msgstr "Dodaj podkatalogi"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "Wzorzec wielolinijkowy "
|
|
|
|
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Tylko pliki tekstowe"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
msgid "search in &active file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Szukaj"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Znajdź kombinację klawiszy"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr "Na początku"
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfordarwin
|
|
msgid "For Darwin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Błąd formatowania"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
msgid "Found version %s, expected %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpccfgismissing
|
|
msgid "fpc.cfg is missing."
|
|
msgstr "Brak pliku fpc.cfg"
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
#, fuzzy
|
|
#| msgid "FPC resources"
|
|
msgid "FPC resources (.res)"
|
|
msgstr "zasoby FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr "źródła FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "Wersja FPC: "
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "Wersja FPC (np. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Edytor FPDoc"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr "Nazwa pakietu FPDoc:"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "W&yszukiwanie w górę"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascal
|
|
msgid "Free Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Freepascal source directory"
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Katalog ze źródłami Freepascala"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "Wyszu&kiwanie w dół"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Znajdź lub zmień nazwę identyfikatora"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Znajdź referencje"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Identyfikator: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "w bieżącym module"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Błędny identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "funkcja"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Ogólne"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr "Pobierz słowo z pozycji kursora"
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr "Ustawienia globalne"
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr "Idź do wiersza"
|
|
|
|
#: lazarusidestrconsts.lisgotoselected
|
|
msgid "Goto selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Grupa"
|
|
|
|
#: lazarusidestrconsts.lisgroupassignexisting
|
|
msgid "Assign to existing \"%s\" group?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydelete
|
|
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydeletemore
|
|
msgid "%sThere are %d more empty groups, delete all?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
|
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinput
|
|
msgid "Group name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinvalid
|
|
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnew
|
|
msgid "Set new group ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnone
|
|
msgid "Clear group(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Komentarz w nagłówku dla klas"
|
|
|
|
#: lazarusidestrconsts.lishelp
|
|
msgctxt "lazarusidestrconsts.lishelp"
|
|
msgid "Help"
|
|
msgstr "Pomoc"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr "Szesnastkowo"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr "Podpowiedź"
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr "Podpowiedź przy nazwie właściwości pokaże zawarty opis."
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
msgid ", Hints: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Zapisz wszystko"
|
|
|
|
#: lazarusidestrconsts.lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Wejdź do"
|
|
|
|
#: lazarusidestrconsts.lishintstepout
|
|
msgid "Run until function returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Przejdź przez"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Porada: Funkcja Make Resourcestring wymaga stałej łańcuchowej.%sWybierz wyrażenie i spróbuj ponownie."
|
|
|
|
#: lazarusidestrconsts.lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Przełącz pomiędzy formularzem i modułem"
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Pokaż formularze"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.lishitcount
|
|
msgid "Hitcount"
|
|
msgstr "Liczba trafień"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Bazy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Opcje pomocy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Właściwości:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Przeglądarki"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "Ścieżka FPC Doc HTML"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Poziomo"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
|
msgid "Creating Makefile for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
|
msgid "Error: running 'compile after' tool failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr "Informacje o IDE"
|
|
|
|
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
|
msgid "WARNING: unit name invalid %s, package=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IDE Options:"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
|
msgid "IDE title shows selected build mode"
|
|
msgstr "Tytul IDE zawiera bieżący tryb budowania"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
|
msgid "IDE title shows project directory"
|
|
msgstr "Tytuł IDE zawiera katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
msgid "IDE title starts with project name"
|
|
msgstr "Nazwa projektu na początek tytułu okna IDE"
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr "Wszystkie tryby budowania"
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Odczytaj z pliku"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "Poprzednie pliki"
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Zapisz do pliku"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignore
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisignore"
|
|
msgid "Ignore"
|
|
msgstr "Ignoruj"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreexceptiontype
|
|
msgid "Ignore this exception type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Importuj listę"
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludeallsubdirectories
|
|
msgid "Include all subdirectories"
|
|
msgstr "Uwzględniaj wszystkie podkatalogi"
|
|
|
|
#: lazarusidestrconsts.lisincludefilter
|
|
msgid "Include filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludesubdirectories
|
|
msgid "Include subdirectories"
|
|
msgstr "Uwzględniaj podkatalogi"
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr "Wcięcia źródeł Pascala"
|
|
|
|
#: lazarusidestrconsts.lisindex
|
|
msgid "Index"
|
|
msgstr "Indeks"
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr "Informacje"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Informacja o %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr "Informacje o używanym FPC"
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr "Przed spokrewnionym"
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Insert"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr "wstaw datę"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr "wstaw datę i godzinę"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag
|
|
msgid "Insert PrintShort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspect
|
|
msgid "&Inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectclassinherit
|
|
msgid "%s : Class %s inherits from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdata
|
|
msgid "Data"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdialog
|
|
msgid "Debug Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectmethods
|
|
msgid "Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectpointerto
|
|
msgid "Pointer to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectproperties
|
|
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolclass
|
|
msgid "Show class column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcoltype
|
|
msgid "Show type column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
|
msgid "Show visibility column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectunavailable
|
|
msgid "%s : unavailable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstance
|
|
msgid "Instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstancehint
|
|
msgid "Use instance class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Instaluj wybrane"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr "Instaluj/Odinstaluj pakiety"
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compile package create a simple Makefile."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
msgid "internal error: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Błędne polecenie"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Błędne wyrażenie.%sWskazówka: funkcja Utwórz łańcuch zasobów oczekuje stałej łańcuchowej w pojedyńczym pliku. Wybierz wyrażenie i spróbuj ponownie."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Błędny filtr"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
msgid "Invalid mode %s"
|
|
msgstr "Błędny tryb %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Nieprawidłowy identyfikator pascala"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
|
#, fuzzy
|
|
#| msgid "The name \"%s\" is not a valid pascal identifier."
|
|
msgid "The name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nazwa \"%s\" nie jest prawid?owym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Błędny nazwa pliku projektu."
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
msgid "invalid version in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s należy już do projektu."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "%s%s%s jest błędną nazwą projektu.%sProszę wybrać inną (np. project1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr "Katalogu nie znaleziono"
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historia skoków"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
msgid "Jump to procedure %s"
|
|
msgstr "Przejdź do procedury %s"
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
msgid "%s KB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepininstalllist
|
|
msgid "Keep in install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Zachowaj nazwę"
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep relative indentation of multi line template"
|
|
msgstr "Zachowaj względne wcięcia wielo-linijkowych szablonów"
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Keep indentation"
|
|
msgstr "Zachowaj wcięcia"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Klawisz"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Polecenia użytkownika"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Polecenia projektanta"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr "Dodaj pułapkę w adresie"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr "Dodaj czujkę"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Czyść i buduj"
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Zamknij projekt"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config \"Build File\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
#, fuzzy
|
|
#| msgid "Configure custom components"
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfiguruj komponenty użytkownika"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Konwertuj pakiet Delphi do pakietu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project"
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Konwertuj projekt Delphi do projektu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit"
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Konwertuj moduł Delphi do modułu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
#, fuzzy
|
|
#| msgid "Convert DFM file to LFM"
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Konwertuj plik DFM do LFM"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected Components to clipboard"
|
|
msgstr "Kopiuj wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected Components to clipboard"
|
|
msgstr "Wytnij wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Usuń ostatni znak"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff Editor Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Otoczenie zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmexampleprojects
|
|
msgid "Example Projects"
|
|
msgstr "Przykładowe projekty"
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Ustawienia zewnętrznych narzędzi"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
#, fuzzy
|
|
#| msgid "Find incremental"
|
|
msgid "Find Incremental"
|
|
msgstr "Szukaj przyrostowo"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
msgid "Go to marker 0"
|
|
msgstr "Przejdź do znacznika 0"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
msgid "Go to marker 1"
|
|
msgstr "Przejdź do znacznika 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
msgid "Go to marker 2"
|
|
msgstr "Przejdź do znacznika 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
msgid "Go to marker 3"
|
|
msgstr "Przejdź do znacznika 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
msgid "Go to marker 4"
|
|
msgstr "Przejdź do znacznika 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
msgid "Go to marker 5"
|
|
msgstr "Przejdź do znacznika 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
msgid "Go to marker 6"
|
|
msgstr "Przejdź do znacznika 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
msgid "Go to marker 7"
|
|
msgstr "Przejdź do znacznika 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
msgid "Go to marker 8"
|
|
msgstr "Przejdź do znacznika 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
msgid "Go to marker 9"
|
|
msgstr "Przejdź do znacznika 9"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Wstaw bieżącą datę i czas"
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus (default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "Mac OS X (Apple style)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "Mac OS X (Lazarus style)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr "Nowy pakiet"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Nowy projekt"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Nowy projekt z pliku"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Publikuj projekt"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Uruchom program"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Zapisz projekt"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
|
msgid "Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
|
msgid "Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
|
msgid "Select Word Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Ustaw wolną zakładkę"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
msgid "Set marker 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
msgid "Set marker 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
msgid "Set marker 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
msgid "Set marker 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
msgid "Set marker 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
msgid "Set marker 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
msgid "Set marker 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
msgid "Set marker 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
msgid "Set marker 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
msgid "Set marker 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
#, fuzzy
|
|
#| msgid "Stop program"
|
|
msgid "Stop Program"
|
|
msgstr "Zatrzymaj program"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle marker 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle marker 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle marker 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle marker 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle marker 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle marker 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle marker 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle marker 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle marker 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle marker 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "View Breakpoints"
|
|
msgstr "Pokaż pułapki"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle View Component Palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr "Pokaż log zdarzeń odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "View Debugger Output"
|
|
msgstr "Pokaż wyjście odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "View Local Variables"
|
|
msgstr "Pokaż zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr "Pokaż rejestry"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Pokaż wątki"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "View Watches"
|
|
msgstr "Pokaż czujki"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Pokaż historię skoków"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Pokaż opcje projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View Project Source"
|
|
msgstr "Pokaż źródło projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Informacje o module"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Linia poleceń uruchamianego programu"
|
|
|
|
#: lazarusidestrconsts.lislazarus
|
|
msgctxt "lazarusidestrconsts.lislazarus"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Katalog Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
msgid "directory, to be used as a basedirectory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [options] <project-filename>"
|
|
|
|
#: lazarusidestrconsts.lislazbuildaboaction
|
|
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr "Buduj wiele"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr "Ustawienia wspólne"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
#, fuzzy
|
|
#| msgid "Confirm before rebuilding Lazarus"
|
|
msgid "Confirm before build"
|
|
msgstr "Potwierdź zanim przebudujesz"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr "Symbole"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr "Edytuj Symbole"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Błąd podczas zapisu do pliku"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr "Zarządzaj profilami budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr "Zarządzaj profilami"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr "Dodaj nowy profil"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Opcje:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr "Profil budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
#, fuzzy
|
|
#| msgid "Restart after building the IDE"
|
|
msgid "Restart after building IDE"
|
|
msgstr "Uruchom ponownie po pomyślnym budowaniu"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr "Zaznacz profile do budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Docelowy procesor:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Docelowy katalog:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Docelowy system operacyjny:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Zapis pliku \"%s\":%s nie powiódł się "
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr "Zaktualizuj revision.inc"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Czyść + Buduj wszystko"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
#, fuzzy
|
|
#| msgid "LCL Widget Type"
|
|
msgid "LCL widget type"
|
|
msgstr "Typ widżetu LCL"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Lewy odstęp obramowania. Wartość dodawana do odstępu podstawowego."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Lewe umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgid "Levels"
|
|
msgstr "Poziomy"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "plik LFM"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "Plik LFM uszkodzony"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisline
|
|
msgid "Line:"
|
|
msgstr "Wiersz:"
|
|
|
|
#: lazarusidestrconsts.lislinelength
|
|
msgid "Line/Length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr "Załaduj makro z"
|
|
|
|
#: lazarusidestrconsts.lislocals
|
|
msgid "Locals"
|
|
msgstr "Lokalne"
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyname
|
|
msgid "&Copy Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
|
msgid "C&opy Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsnotevaluated
|
|
msgid "Locals not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogcallstack
|
|
msgid "Log Call Stack"
|
|
msgstr "Rej. stos wywołań"
|
|
|
|
#: lazarusidestrconsts.lislogcallstacklimit
|
|
msgid "(frames limit. 0 - no limits)"
|
|
msgstr "(ramek. 0 - bez ograniczeń)"
|
|
|
|
#: lazarusidestrconsts.lislogevalexpression
|
|
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr "Oblicz wyrażenie"
|
|
|
|
#: lazarusidestrconsts.lislogmessage
|
|
msgid "Log Message"
|
|
msgstr "Rej. komunikaty"
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
#, fuzzy
|
|
#| msgid "lrs include files"
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr "dołączane pliki lrs"
|
|
|
|
#: lazarusidestrconsts.lismacpascal
|
|
msgid "Mac Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
msgid "Macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Wprowadź dane"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Wprowadź pwarametry uruchomieniowe"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Application.CreateForm statements"
|
|
msgid "Main unit has Application.CreateForm statements"
|
|
msgstr "Główny moduł posiada deklarację Application.CreateForm"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Application.Title statements"
|
|
msgid "Main unit has Application.Title statements"
|
|
msgstr "Główny moduł posiada deklarację Application.Title"
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Główny moduł posiada sekcję Uses zawierającą wszystkie moduły projektu"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
#, fuzzy
|
|
#| msgid "Main Unit is Pascal Source"
|
|
msgid "Main unit is Pascal source"
|
|
msgstr "Główny moduł jest Źródłem Pascala"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Utwórz plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Utwórz ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Dodaj do sekcji"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, fuzzy,badformat
|
|
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resourcestring %s%s%s już istnieje.%sWybierz inną nazwą.%sUżyj Ignoruj aby dodać ją pomimo tego."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Opcje konwersji"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Identyfikator użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identyfikator"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Długość identyfikatora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Przedrostek identyfikatora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Wstaw alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Wstaw z uwzględnieniem kontekstu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Błędna sekcja Resourcestring"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resourcestring już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Sekcja Resourcestring:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Podgląd źródła"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Stała łańcuchowa w źródle"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Stałe łańcuchowe o tej samej wartości:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr "Zarządzaj oknami kodu źródłowego ..."
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaxs
|
|
msgid "Max %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
msgid "%s MB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismeaction
|
|
msgctxt "lazarusidestrconsts.lismeaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr "O FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
#, fuzzy
|
|
#| msgid "Add breakpoint"
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Dodaj pułapkę"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr "Dodaj aktywny plik do pakietu ..."
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
#, fuzzy
|
|
#| msgid "Add jump point to history"
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Dodaj punkt skoku do historii"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add editor file to Project"
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Dodaj plik do projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
#, fuzzy
|
|
#| msgid "Add watch ..."
|
|
msgid "Add &Watch ..."
|
|
msgstr "Dodaj czujkę ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr "Łam linie w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Zbuduj plik"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build Lazarus with current profile"
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Buduj Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr "Buduj Lazarusa z profilu : %s"
|
|
|
|
#: lazarusidestrconsts.lismenubuildmanymodes
|
|
msgid "Build many Modes ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
#, fuzzy
|
|
#| msgid "Check LFM file in editor"
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Sprawdź plik formularz w edytorze"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
#, fuzzy
|
|
#| msgid "Clean directory ..."
|
|
msgid "Clean Directory ..."
|
|
msgstr "Czyść katalogi..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
#, fuzzy
|
|
#| msgid "Close A&ll Editor Files"
|
|
msgid "Close A&ll"
|
|
msgstr "Zamknij wszystko"
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr "Zamknij edytowany plik"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Zamknij projekt"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
#, fuzzy
|
|
#| msgid "CodeTools defines editor ..."
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Edytor symboli CodeTools..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
#, fuzzy
|
|
#| msgid "Comment selection"
|
|
msgid "Comment Selection"
|
|
msgstr "Zakomentuj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Uzupełnij kod"
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Konfiguruj plik \"Buduj+Uruchom\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
#, fuzzy
|
|
#| msgid "Configure custom components ..."
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfiguruj dodatkowe komponenty..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
#, fuzzy
|
|
#| msgid "Configure external tools ..."
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Konfiguruj zewnętrzne narzędzia..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Konfiguruj \"Buduj Lazarusa\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi package to Lazarus package ..."
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Konwertuj pakiet Delphi do pakietu Lazarusa..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project ..."
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Konwertuj projekt Delphi do projektu Lazarusa..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Importuj moduł Delphi..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
#, fuzzy
|
|
#| msgid "Convert binary DFM to text LFM + check syntax ..."
|
|
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgstr "Importuj formularz Delphi..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
#, fuzzy
|
|
#| msgid "Convert encoding of projects/packages ..."
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Konwertuj kodowanie projektów/pakietów ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
#, fuzzy
|
|
#| msgid "Debug windows"
|
|
msgid "Debug Windows"
|
|
msgstr "Okno odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Edycja"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Szablony źródeł..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
#, fuzzy
|
|
#| msgid "Install/Uninstall packages ..."
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Konfiguruj zainstalowane pakiety ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditor
|
|
msgid "Menu Editor ..."
|
|
msgstr "Edytor menu..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
|
msgid "Create Submenu"
|
|
msgstr "Utwórz podmenu"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
|
#, fuzzy
|
|
#| msgid "Delete From Template..."
|
|
msgid "Delete From Template ..."
|
|
msgstr "Skasuj z szablonu..."
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "Delete Item"
|
|
msgstr "Skasuj element"
|
|
|
|
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
|
msgid "Handle OnClick Event"
|
|
msgstr "Ustaw zdarzenie OnClick"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
|
#, fuzzy
|
|
#| msgid "Insert From Template..."
|
|
msgid "Insert From Template ..."
|
|
msgstr "Wstaw z szablonu..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
|
msgid "Insert New Item (after)"
|
|
msgstr "Wstaw nowy element (poniżej)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
|
msgid "Insert New Item (before)"
|
|
msgstr "Wstaw nowy element (powyżej)"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Edytor Menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Przenieś w dół (lub w prawo)"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Przenieś w górę (lub w lewo)"
|
|
|
|
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
|
msgid "New Template Description ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
|
#, fuzzy
|
|
#| msgid "Save As Template..."
|
|
msgid "Save As Template ..."
|
|
msgstr "Zapisz jako szablon ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorselectmenu
|
|
msgid "Select Menu:"
|
|
msgstr "Wybierz menu:"
|
|
|
|
#: lazarusidestrconsts.lismenueditorselecttemplate
|
|
msgid "Select Template:"
|
|
msgstr "Wybierz szablon:"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatepreview
|
|
msgid "Template Preview"
|
|
msgstr "Podgląd szablonu"
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr "Otocz w $IFDEF ..."
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
#, fuzzy
|
|
#| msgid "Enclose selection ..."
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Otocz zaznaczenie ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
#, fuzzy
|
|
#| msgid "Evaluate/Modify ..."
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Sprawdź/Modyfikuj ..."
|
|
|
|
#: lazarusidestrconsts.lismenuexampleprojects
|
|
msgid "Example Projects ..."
|
|
msgstr "Przykładowe projekty ..."
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure ..."
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Wyodrębnij procedurę ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Plik"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Znajdź"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Znajdź..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
#, fuzzy
|
|
#| msgid "Find other end of code block"
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Znajdź przeciwny koniec bloku"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
#, fuzzy
|
|
#| msgid "Find code block start"
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Znajdź początek bloku"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
#, fuzzy
|
|
#| msgid "Find Declaration at cursor"
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Znajdź deklarację przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Znajdź referencje do identyfikatora..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find &in files ..."
|
|
msgid "Find &in Files ..."
|
|
msgstr "Znajdź w pl&ikach..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Znajdź &następny"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Znajdź &poprzedni"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Opcje..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Goto include directive"
|
|
msgid "Goto Include Directive"
|
|
msgstr "Idź do dyrektywy include"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line ..."
|
|
msgid "Goto Line ..."
|
|
msgstr "Idź do wiersza..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Znajdź błędne IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
#, fuzzy
|
|
#| msgid "Guess unclosed block"
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Znajdź niedomknięty blok"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "Pomo&c"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
#, fuzzy
|
|
#| msgid "IDE internals"
|
|
msgid "IDE Internals"
|
|
msgstr "Środowisko wewnętrzne"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Szukaj przyrostowo"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
#, fuzzy
|
|
#| msgid "Indent selection"
|
|
msgid "Indent Selection"
|
|
msgstr "Zwiększ wcięcie zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
#, fuzzy
|
|
#| msgid "ChangeLog entry"
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Pozycja dziennika zmian"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
#, fuzzy
|
|
#| msgid "Insert from Character Map"
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Wstaw z tablicy znaków..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
#, fuzzy
|
|
#| msgid "Insert CVS keyword"
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "Słowo kluczowe CVS"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
#, fuzzy
|
|
#| msgid "Current date and time"
|
|
msgid "Current Date and Time"
|
|
msgstr "Bieżąca data i czas"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr "Wstaw pełną nazwę pliku ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
#, fuzzy
|
|
#| msgid "General"
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Wstaw ogólne"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
#, fuzzy
|
|
#| msgid "GPL notice"
|
|
msgid "GPL Notice"
|
|
msgstr "Informacja o licencji GPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
#, fuzzy
|
|
#| msgid "LGPL notice"
|
|
msgid "LGPL Notice"
|
|
msgstr "Informacja o licencji LGPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr "Informacja o licencji MIT"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr "Zmodyfikowana licencja LGPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
#, fuzzy
|
|
#| msgid "Current username"
|
|
msgid "Current Username"
|
|
msgstr "Nazwa użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
#, fuzzy
|
|
#| msgid "Inspect ..."
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Badaj..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
#, fuzzy
|
|
#| msgid "Jump back"
|
|
msgid "Jump Back"
|
|
msgstr "Przeskocz do tyłu"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
#, fuzzy
|
|
#| msgid "Jump forward"
|
|
msgid "Jump Forward"
|
|
msgstr "Przeskocz do przodu"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Skocz do"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to next bookmark"
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Przejdź do następnej zakładki"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
#, fuzzy
|
|
#| msgid "Jump to next error"
|
|
msgid "Jump to Next Error"
|
|
msgstr "Przejdź do następnego błędu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to previous bookmark"
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Przejdź do poprzedniej zakładki"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
#, fuzzy
|
|
#| msgid "Jump to previous error"
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Przejdź do poprzedniego błędu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
#, fuzzy
|
|
#| msgid "Lowercase selection"
|
|
msgid "Lowercase Selection"
|
|
msgstr "Zaznaczenie małymi literami"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
msgid "Editor Macros ..."
|
|
msgstr "Edytor makr ..."
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Utwórz łańcuch w zasobach..."
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
#, fuzzy
|
|
#| msgid "New component"
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nowy komponent"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
msgid "New %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nowy formularz"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Nowy..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
#, fuzzy
|
|
#| msgid "New package ..."
|
|
msgid "New Package ..."
|
|
msgstr "Nowy pakiet..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Nowy projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
#, fuzzy
|
|
#| msgid "New Project from file ..."
|
|
msgid "New Project from File ..."
|
|
msgstr "Nowy projekt z pliku..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nowy moduł"
|
|
|
|
#: lazarusidestrconsts.lismenuok
|
|
#, fuzzy
|
|
#| msgid "&Ok"
|
|
msgctxt "lazarusidestrconsts.lismenuok"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Pomoc online"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
#, fuzzy
|
|
#| msgid "Open ..."
|
|
msgid "&Open ..."
|
|
msgstr "Otwórz..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
#, fuzzy
|
|
#| msgid "Open filename at cursor"
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Otwórz plik przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package ..."
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Otwórz załadowany pakiet ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
#, fuzzy
|
|
#| msgid "Open package file (.lpk) ..."
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Otwórz plik pakietu (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
#, fuzzy
|
|
#| msgid "Open package of current unit"
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Otwórz pakiet aktualnego modułu"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Otwórz projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
#, fuzzy
|
|
#| msgid "Open &Recent ..."
|
|
msgid "Open &Recent"
|
|
msgstr "Otwórz poprzedni..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
#, fuzzy
|
|
#| msgid "Open recent package"
|
|
msgid "Open Recent Package"
|
|
msgstr "Otwórz poprzedni pakiet"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project ..."
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Otwórz poprzedni projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
#, fuzzy
|
|
#| msgid "&Package"
|
|
msgid "Pa&ckage"
|
|
msgstr "P&akiet"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
#, fuzzy
|
|
#| msgid "Package Graph ..."
|
|
msgid "Package Graph"
|
|
msgstr "Lista pakietów"
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
#, fuzzy
|
|
#| msgid "Package links ..."
|
|
msgid "Package Links ..."
|
|
msgstr "Odnośniki pakietów..."
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr "Lista procedur..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "P&rojekt"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Inspektor projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Opcje projektu..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
#, fuzzy
|
|
#| msgid "Run"
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Publikuj projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
#, fuzzy
|
|
#| msgid "Quick compile"
|
|
msgid "Quick Compile"
|
|
msgstr "Szybka kompilacja"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Quick syntax check"
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Szybkie sprawdzanie składni"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Usuń z projektu..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Zmień nazwę identyfikatora..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
#, fuzzy
|
|
#| msgid "Reporting a bug"
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Zgłaszanie błędu..."
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Rescan FPC source directory"
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Przeskanuj katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
#, fuzzy
|
|
#| msgid "Reset debugger"
|
|
msgid "Reset Debugger"
|
|
msgstr "Zresetuj odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Przywróć"
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "&Uruchom"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Uruchom plik"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
#, fuzzy
|
|
#| msgid "Run Parameters ..."
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Parametry uruchamiania"
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
#, fuzzy
|
|
#| msgid "Run to &Cursor"
|
|
msgid "Step over to &Cursor"
|
|
msgstr "Dojdź do kursora"
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
#, fuzzy
|
|
#| msgid "Save"
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Zapisz"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
#, fuzzy
|
|
#| msgid "Save As ..."
|
|
msgid "Save &As ..."
|
|
msgstr "Zapisz jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Zapisz projekt"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Zapisz projekt jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Szukaj"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Zaznacz"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
#, fuzzy
|
|
#| msgid "Select all"
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
#, fuzzy
|
|
#| msgid "Select code block"
|
|
msgid "Select Code Block"
|
|
msgstr "Zaznacz blok"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
#, fuzzy
|
|
#| msgid "Select line"
|
|
msgid "Select Line"
|
|
msgstr "Zaznacz wiersz"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
#, fuzzy
|
|
#| msgid "Select paragraph"
|
|
msgid "Select Paragraph"
|
|
msgstr "Zaznacz akapit"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
#, fuzzy
|
|
#| msgid "Select to brace"
|
|
msgid "Select to Brace"
|
|
msgstr "Zaznacz do nawiasu"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select Word"
|
|
msgstr "Zaznacz słowo"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free bookmark"
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Ustaw wolną zakładkę"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr "Pokaż punkt wykonywania"
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
#, fuzzy
|
|
#| msgid "Sort selection ..."
|
|
msgid "Sort Selection ..."
|
|
msgstr "Posortuj zaznaczenie..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.lismenustepinto
|
|
#, fuzzy
|
|
#| msgid "Step in&to"
|
|
msgid "Step In&to"
|
|
msgstr "Wejdź do"
|
|
|
|
#: lazarusidestrconsts.lismenustepintocontext
|
|
msgid "Step Into (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepout
|
|
msgid "Step O&ut"
|
|
msgstr "Wyjdź z"
|
|
|
|
#: lazarusidestrconsts.lismenustepover
|
|
#, fuzzy
|
|
#| msgid "&Step over"
|
|
msgid "&Step Over"
|
|
msgstr "Przejdź przez"
|
|
|
|
#: lazarusidestrconsts.lismenustepovercontext
|
|
msgid "Step Over (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr "Zamień wielkość liter w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
#, fuzzy
|
|
#| msgid "Tabs to spaces in selection"
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Tabulacje->odstępy w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "Informacja"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Zawartość"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Standardowe menu Edycja"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Standardowe menu PLIK"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Standardowe menu Pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefind
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
|
msgid "Find"
|
|
msgstr "Znajdź"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefindnext
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
|
msgid "Find Next"
|
|
msgstr "Znajdź następny"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopenrecent
|
|
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr "Otwórz poprzedni"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Tutorial"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
#, fuzzy
|
|
#| msgid "Toggle comment"
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr "Ustaw komentarz wiersza"
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Narzędzia"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
#, fuzzy
|
|
#| msgid "Uncomment selection"
|
|
msgid "Uncomment Selection"
|
|
msgstr "Usuń oznaczenie komentarza"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
#, fuzzy
|
|
#| msgid "Unindent selection"
|
|
msgid "Unindent Selection"
|
|
msgstr "Zmniejsz wcięcie zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
#, fuzzy
|
|
#| msgid "Uppercase selection"
|
|
msgid "Uppercase Selection"
|
|
msgstr "Zaznaczenie wielkimi literami"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr "Dodaj moduł do sekcji Uses ..."
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Widok"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr "Edytor zakotwiczeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewassembler
|
|
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "Pułapki"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Stos wywołań"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Inspektor kodu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr "Paleta komponentów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponenty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Dziennik zdarzeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
#, fuzzy
|
|
#| msgid "Debug output"
|
|
msgid "Debug Output"
|
|
msgstr "Wyjście odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
#, fuzzy
|
|
#| msgid "Forms..."
|
|
msgid "Forms ..."
|
|
msgstr "Lista formularzy"
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr "Historia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
#, fuzzy
|
|
#| msgid "Jump History ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historia skoków"
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor obiektów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr "Pokaż źródło projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgid "Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Przeglądarka ograniczeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Wyniki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr "Kolejność kontrolek"
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr "Wątki"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
#, fuzzy
|
|
#| msgid "Toggle form/unit view"
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Przełącz moduł/formularz"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
#, fuzzy
|
|
#| msgid "Unit Dependencies ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Zależności modułów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
#, fuzzy
|
|
#| msgid "Unit Information"
|
|
msgid "Unit Information ..."
|
|
msgstr "Informacje o module"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
#, fuzzy
|
|
#| msgid "Units..."
|
|
msgid "Units ..."
|
|
msgstr "Lista modułów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Czujki"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr "Wymagające budowania"
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Okno"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
#, fuzzy
|
|
#| msgid "Other"
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Inne"
|
|
|
|
#: lazarusidestrconsts.lismeprojects
|
|
msgid "Projects"
|
|
msgstr "Projekty"
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Edytor komunikatów"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr "Okno komunikatów"
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Nie znaleziono metody klasy"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
msgid "missing directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Brakujące zdarzenia"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
msgid "missing executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Brakujące identyfikatory"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Brakujące pakiety"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Abort now, install packages or fix paths and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
msgid "Skip this Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
msgid "expected \":=\" after macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
msgid "expected macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
msgid "From %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgid "Move selected item down"
|
|
msgstr "Przesuń zaznaczony element w dół"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgid "Move selected item up"
|
|
msgstr "Przesuń zaznaczony element w górę"
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
msgid "Set \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencoding
|
|
msgid "Use system encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencodinghint
|
|
msgid "Disable support for UTF-8 default string encoding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
msgid "Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
msgid "(was \"%s\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
msgid ", Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodify
|
|
msgid "&Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Więcej"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
#, fuzzy
|
|
#| msgid "More ..."
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More >>"
|
|
msgstr "Więcej ..."
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr "Przesuń \"%s\" w dół"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr "Przesuń \"%s\" w górę"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
#, fuzzy
|
|
#| msgid "Move Page ..."
|
|
msgid "Move Page"
|
|
msgstr "Przenieś stronę ..."
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr "Przesuń zaznaczony element w dół (Ctrl+Down)"
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr "Przesuń zaznaczony element w górę (Ctrl+Up)"
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr "Przenieś do:"
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisms
|
|
msgid "(ms)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Zapisz komunikaty do pliku (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Nazwa"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Konflikt nazw"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Nazwa nowej procedury"
|
|
|
|
#: lazarusidestrconsts.lisnever
|
|
msgctxt "lazarusidestrconsts.lisnever"
|
|
msgid "Never"
|
|
msgstr "Nigdy"
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Nowy"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nowa klasa"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Utwórz nowy plik edytora.%sWybierz typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Utwórz nowy pusty plik tekstowy."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Utwórz nowy projekt.%sWybierz typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Utwórz standardowy pakiet.%sPakiet jest zbiorem modułów i komponentów."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Utwórz nowy moduł z modułem danych."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
#, fuzzy
|
|
#| msgid "Create a new unit with a frame"
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Utwórz nowy moduł z ramką"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Utwórz nowy moduł z formularzem LCL."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Nie wybrano elementu"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Najpierw wybierz element."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Nowe kodowanie:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
msgid "Macro %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr "Nowa nazwa makra"
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
#, fuzzy
|
|
#| msgid "%s - (new project)"
|
|
msgid "(new project)"
|
|
msgstr "(nowy projekt)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
#, fuzzy
|
|
#| msgid "New units are added to uses sections:"
|
|
msgid "New units are added to uses sections"
|
|
msgstr "Dodawanie nowych modułów do sekcji uses:"
|
|
|
|
#: lazarusidestrconsts.lisno
|
|
msgid "No"
|
|
msgstr "Nie"
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Bez kopii zapasowej"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr "Brak wybranego makra"
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "nienazwany"
|
|
|
|
#: lazarusidestrconsts.lisnone
|
|
msgid "%snone"
|
|
msgstr "%sżaden"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
msgid "No program file \"%s\" found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Nie znalazłem sekcji ResourceString."
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Nie znalazłem stałej łańcuchowej"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
|
msgid "Not a valid Pascal identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dół"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Góra"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "UWAGA: Nie mogłem utworzyć szablonu define dla źródeł Free Pascala"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "UWAGA: Nie mogłem utworzyć szablonu define dla źródeł Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
|
|
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
|
|
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Nie teraz"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreate
|
|
msgid "Create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
msgid "Number of files to convert: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoff
|
|
msgid "? (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
msgid " of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
msgid "Class \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "auto zainstalowany dynamicznie"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "auto zainstalowany statycznie"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Opis: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sOpis: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Nazwa pliku: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "zainstalowany dynamicznie"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "zainstalowany statycznie"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
msgid "%sLicense: %s"
|
|
msgstr "%sLicencja: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "brakujący"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package"
|
|
msgid "Open Loaded Package"
|
|
msgstr "Otwórz załadowany pakiet"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "[wybierz pakiet]"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Stan"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sTen pakiet jest zainstalowany, ale nie znalazłem jego pliku lpk"
|
|
|
|
#: lazarusidestrconsts.lisok
|
|
msgctxt "lazarusidestrconsts.lisok"
|
|
msgid "OK"
|
|
msgstr "OK"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lison
|
|
msgid "? (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Otwórz"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Otwórz plik"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Otwórz plik"
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Otwórz %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Chcesz otworzyć pakiet?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Chcesz otworzyć projekt?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Otwórz projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Otwórz plik projektu"
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
|
msgid "Options changed, recompiling clean with -B"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
msgid ", OS: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
msgid "%soverride the project or IDE build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Zastąpić plik?"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Zastąpić plik na dysku"
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Pakiet"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
msgid "package %s"
|
|
msgstr "pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
msgid ", package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
#, fuzzy
|
|
#| msgid "Package Info"
|
|
msgid "Package info"
|
|
msgstr "Informacje o pakiecie"
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Nazwa pakietu zaczyna się na..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Nazwa pakietu zawiera..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr "Pakiet wymaga katalogu wyjściowego"
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Pakiet wymaga zainstalowania"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
msgid "Package \"%s\" Option"
|
|
msgstr "Opcje pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr "Katalogi wyjściowe pakietów"
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr "Katalogi źródeł pakietów"
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr "Moduł pakietu"
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgid "Page"
|
|
msgstr "Strona"
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr "Nazwa zakładki"
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr "Nazwa zakładki \"%s\" już istnieje. Nie dodano."
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
msgid "parser \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasscount
|
|
msgid "Pass Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispaste
|
|
msgctxt "lazarusidestrconsts.lispaste"
|
|
msgid "Paste"
|
|
msgstr "Wklej"
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgid "Paste from clipboard"
|
|
msgstr "Wklej ze schowka"
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Przeglądaj"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
#, fuzzy
|
|
#| msgid "Move path down"
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Przesuń ścieżkę w dół"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
#, fuzzy
|
|
#| msgid "Move path up"
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Przesuń ścieżkę w górę"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr "Dodaj nowy katalog do listy"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr "Usuń zaznaczone ścieżki"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr "Usuń niestniejące (szare) ścieżki z listy"
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Szablony ścieżek"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Ścieżki poszukiwań"
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Wstrzymaj"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddotheritems
|
|
msgid "Add other items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add to project"
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Dodaj do projektu"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Zastosuj zmiany"
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Wywołaj procedurę %sRegister%s bieżącego modułu"
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Chcesz kompilować wszystko?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Kompiluj pakiet"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Opcje kompilatora dla pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Utwórz Makefile"
|
|
|
|
#: lazarusidestrconsts.lispckeditdefault
|
|
msgid "%s, default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
#, fuzzy
|
|
#| msgid "Edit General Options"
|
|
msgid "Edit general options"
|
|
msgstr "Zmień ogólne opcje"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Właściwości plku"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Zainstaluj"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Błędny maksymalny numer wersji"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Błędny minimalny numer wersji"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maksymalny nr wersji:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimalny nr wersji:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Zmieniony: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Przesuń zależność w dół"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Przesuń zależność w górę"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Pakiet %s%s%s został zmieniony.%sChcesz go zapisać?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "pakiet %s nie jest zapisany"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Zakładka: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Powtórnie dodaj zależność"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Dodaj powtórnie plik"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Tylko do odczytu: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
#, fuzzy
|
|
#| msgid "Recompile all required"
|
|
msgid "Recompile All Required"
|
|
msgstr "Przekompiluj wszystkie wymagane"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
#, fuzzy
|
|
#| msgid "Recompile clean"
|
|
msgid "Recompile Clean"
|
|
msgstr "Przekompiluj po wyczyszczeniu"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Czy prrzekompilować ten i wszystkie wymagane pakiety?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Zarejestrowane wtyczki"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Zarejestruj moduł"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Usuń zależność"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Chcesz usunąć zależność?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "chcesz usunąć zależność %s%s%s%sz pakietu %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr "Usunięte pliki"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Usunięte wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Usuń plik"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Chcesz usunąć plik?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Chcesz usunąć plik %s%s%s%sz pakietu %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Usuń wybrany element"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save package"
|
|
msgid "Save Package"
|
|
msgstr "Zapisz pakiet"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr "Traktuj nazwę pliku jako domyślną dla tej zależności"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maksymalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przykład poprawnego: 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Minimalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przykład poprawnego: 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Odinstaluj"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Pokaż źródło pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Zainstalowany"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Zainstaluj przy następnym uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sStan: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
#, fuzzy
|
|
#| msgid "Uninstall on next start"
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Odinstaluj przy następnym uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "dodaj opcje do zależnych pakietów i projektów"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Dodaj ścieżki do zależnych pakietów/projektów"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
#, fuzzy
|
|
#| msgid "Author:"
|
|
msgid "Author"
|
|
msgstr "Autor:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automatycznie przebuduj gdy trzeba"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automatycznie przebuduj przy Przebuduj wszystkie"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Dodatkowe"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
#, fuzzy
|
|
#| msgid "Description/Abstract"
|
|
msgid "Description / Abstract"
|
|
msgstr "Opis"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr "Tryb projektowy"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
#, fuzzy
|
|
#| msgid "Designtime and Runtime"
|
|
msgid "Designtime and runtime"
|
|
msgstr "Projektowy i uruchomieniowy"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "Integracja z IDE"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Dołącz"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Nieprawidłowy typ pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Biblioteka"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
#, fuzzy
|
|
#| msgid "License:"
|
|
msgid "License"
|
|
msgstr "Licencja:"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linker"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
#, fuzzy
|
|
msgid "Major"
|
|
msgstr "Major"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Ręczna kompilacja (nigdy automatyczna)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
#, fuzzy
|
|
msgid "Minor"
|
|
msgstr "Minor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Obiekt"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Opcje pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
#, fuzzy
|
|
#| msgid "PackageType"
|
|
msgid "Package type"
|
|
msgstr "Typ pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Release"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Pakiet %s%s%s ma flagę auto instalacji.%sTo oznacza, że będzie ona automatycznie instalowany przez IDE. Instalowane pakiety%smuszą być pakietami projektowymi."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
#, fuzzy
|
|
#| msgid "Update/Rebuild"
|
|
msgid "Update / Rebuild"
|
|
msgstr "Odśwież/przebuduj"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Użycie"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Przerwij"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Postęp"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Nazwa pliku:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
msgid "Missing files of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
#, fuzzy
|
|
#| msgid "Sort Files"
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Sortuj pliki"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr "Sortuj pliki alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "dodatek ŚcieżkaŹródłowaKompilatora"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Katalog wyjściowy"
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Znacznik katalogu źródeł pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Ścieżka modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Czy naprawdę chcesz anulować wszystkie zmiany do pakietu %s ponownie wczytać go z pliku?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Nowy modułu jest poza ścieżką do modułów"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Publikuj pakiet..."
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Chcesz przywrócić pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Plik %s%s%s%sis jest poza ścieżką do modułów .%s%sCzy dodać %s%s%s do ścieżki do modułów?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
|
msgid "Binary"
|
|
msgstr "Binarny"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Plik dołączany (include)"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - formularz Lazarusa jako tekst"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - zasoby Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypemainunit
|
|
msgid "Main Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Wirtualny moduł"
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
|
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
|
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
|
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
|
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
|
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
|
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Znaleziono moduły o dwuznacznej nazwie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automatycznie zainstalowane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sPakiety są powiązane, tzn. jeden z nich jest używany przez drugi, albo obydwa są używane przez inny pakiet."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Zerwane zależność"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr "Znaleziono cykliczne zależności"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcompilepackage
|
|
msgid "Compile package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Błąd podczas usuwania"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Chcesz usunąć stary plik pakietu?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old package file %s%s%s?"
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Chcesz usunąć stary plik pakietu %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Zależność bez właściciela: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Błąd odczytu pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Błąd przy odczycie pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
|
msgid "Error: updating po files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Błąd podczas zapisu do pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Błąd przy zapisywaniu pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Plik należy do pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Plik należy do projektu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Nazwa pliku różni się od nazwy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Plik jest używany przez inny pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Plik o tej nazwie jest już używany w projekcie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found."
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Nie znalazłem pliku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Plik nie zapisany"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Błędne rozszerzenie pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Nieprawidłowe rozszerzenie nazwy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Błędna nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Nieprawidłowa nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Nieprawidłowa nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Załadowanie pakietu %s spowoduje zastąpienie pakietu %s%sz pliku %s.%sPoprzedni pakiet był zmieniany.%s%sZapisać poprzedni pakiet %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr "Nowy Pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Pakiet: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Pakiet jest w konflikcie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
#, fuzzy
|
|
#| msgid "Package is no designtime package"
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Paskiet nie jest typu projektowego"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Pakiet jest wymagany"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "główny plik źródłowy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Pakiet o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Pakiety muszą mieć rozszerzenie .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Zapisz plik przed dodaniem go do pakietu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Czy przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Zmienić litery na małe w nazwie pliku?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace existing file %s%s%s?"
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Chcesz nadpisać istniejący plik %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Nadpisz plik"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save Package?"
|
|
msgid "Save package?"
|
|
msgstr "Chcesz zapisać pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Zapisz pakiet %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, fuzzy,badformat
|
|
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Czy litery w nazwie pliku mają być zmienione na małe: %s%s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "plik konfiguracji statycznych pakietów"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "Plik kompilatora dla pakietu %s nie jest wykonywalny:%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis already in the package %s."
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Plik %s%s%s%sis już należy do pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is not a Lazarus package."
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Plik %s%s%s nie jest pakietem Lazarusa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Nazwa pliku %s%s%s nie odpowiada nazwie pakietu %s%s%s w tym pliku.%sChcesz zmienić nazwę pakietu na %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Plik o nazwie %s%s%s jest już częścią bieżącego projektu.%sProjekt i pakiety nie powinny współdzielić plików."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Plik %s%s%s jest używany przez%spakiet %s%s%s%sw pliku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
|
msgid "The file \"%s\" of package %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, fuzzy,badformat
|
|
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Nazwa pliku pakietu %s%s%s w%s%s%s%s nie jest prawidłową nazwą pakietu Lazarusa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, fuzzy
|
|
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE.The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Pakiet %s jest tylko pakietem uruchomieniowym.%sTego typu pakiety nie mogą być instalowane w IDE"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Pakiet %s%s%s zosta zaznaczony do instalacji, ale nie można go odnaleźć.%sCzy usunąć zależność z listy pakietów do instalacji?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Pakiet %s Jest wymagany przez %s, który został zaznaczony do instalacji.%sSpójrz na listę pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Nazwa pakietu %s%s%s jest nieprawidłowa%sProszę wybrać inną nazwę (np. package1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Nazwa pakietu %s%s%s z%spliku %s%s%s jest nieprawidłowa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Pakiet %s%s%s został zaznaczony.%sAktualnie Lazarus obsługuje tylko statyczne łączenie pakietów. Pełna instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Pakiet %s%s%s został zaznaczony do instalacji.%sAktualnie Lazarus obsługuje tylko statyczne łączenie pakietów. Pełna instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Projekt wymaga pakkietu,%s%s%s.%sktóry nie został znaleziony. Spójrz na Projekt->Inspektor projektu. "
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, fuzzy,badformat
|
|
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Istnieją dwa moduły z tą samą nazwą:%s%s1 - %s%s%s w %s%s2 oraz %s%s%s w %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Istnieje moduł w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Istnieje moduł w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s w %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Istnieje już inny pakiet o nazwie %s%s%s.%sKonfklikt w: %s%s%s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Jest już pakiet %s%s%s załadowany%sz pliku %s%s%s.%sSpójrz na Komponenty -> Lista pakietów.%sNadpisanie jest niemożliwe."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Znalazłem wśród wymaganych pakietów niezapisany pakiet. Spójrz na listę pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Istnieje moduł o nazwie takiej samej jak pakiet:%s%s1. %s%s%s w %s%s2. %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Nie można utworzyć katalogu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
|
msgstr "Nie można utworzyć kaalogu wyjściowego %s%s%s%s dla pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
|
msgstr "Nie można utworzyć katalogu ze źródłami %s%s%s%sdla pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Nie można utworzyć katalogu docelowego dla Lazarusa:%s%s%s%s.%sTen katalog jest wymagany przez nowe zmienione IDE z dodatkowymi pakietami."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete file %s%s%s."
|
|
msgid "Unable to delete file \"%s\"."
|
|
msgstr "Nie można usunąć pliku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Nie można usunąć pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
|
msgstr "Nie można usunąć starego pliku statusu %s%s%s%spakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nie można odczytać pliku statusu %s%s%s%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Nie można zapisać pakietu %s%s%s%sdo pliku %s%s%s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nie można zapisać pliku statusu %s%s%s%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Chcesz odinstalować pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Chcesz odinstalować pakiet %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Niezapisany pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Użyj modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Uwaga: Plik %s%s%s%snależy do bieżącego projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsinstalled
|
|
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
|
msgid "Installed"
|
|
msgstr "Zainstalowany"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
#, fuzzy
|
|
#| msgid "Can not register components without unit"
|
|
msgid "Cannot register components without unit"
|
|
msgstr "Nie można rejestrować komponentów bez modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
#, fuzzy,badformat
|
|
#| msgid "Component Class %s%s%s already defined"
|
|
msgid "Component Class \"%s\" already defined"
|
|
msgstr "Klasa komponentu %s%s%s już została zdefiniowana"
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sFile Name: %s%s%s"
|
|
msgid "%s%sFile Name: \"%s\""
|
|
msgstr "%s%sNazwa pliku: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Nieprawidłowa klasa komponentu"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Błędna nazwa modułu: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgsyslpkfilename
|
|
msgid "%s%slpk file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Nie znalazłem pliku pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
|
msgid "Package registration error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "procedura rejestracji jest pusta"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "RejestrujModuł było wzywane, ale żaden pakiet nie jest rejestrowany."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
|
msgid "%s%sThe lpk file was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "To jest domyślny pakiet, używany tylko dla komponentów które nie mają pakietu. Te komponenty są już przedawnione."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sUnit Name: %s%s%s"
|
|
msgid "%s%sUnit Name: \"%s\""
|
|
msgstr "%s%sNazwa modułu: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
|
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
|
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
|
msgid "Unit \"%s\" was removed from package (lpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgtransitivity
|
|
msgid "Transitivity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr "Odtwórz"
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Globalny"
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Odnośniki Pakietów"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Użytkownika"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Proszę otworzyć moduł przed uruchomieniem."
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<wszystkie>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Zmień czcionkę"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<brak>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Obiekty"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr "Lista procedur"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Nie zapisuj żadnych informacji o sesji"
|
|
|
|
#: lazarusidestrconsts.lispointer
|
|
msgid "Pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
#, fuzzy
|
|
#| msgid "Save in IDE config directory"
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Zapisz w katalogu konfiguracyjnym IDE"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Zapisz w pliku .lpi"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Zapisz w pliku .lps w katalogu projektu"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Zapisz informacje o sesji w"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
msgid "%s (position outside of source)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
msgid "prior %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Metody prywatne"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Wykryłem program"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
#, fuzzy
|
|
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Plik źródłowy powinien mieć odpowiednie rozszerzenie, jak .pas, .pp lub .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
|
msgid "Add Files to Project"
|
|
msgstr "Dodaj pliki do projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Zależność już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add Editor Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Błędna wersja Min-Max"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
|
msgid "Invalid packagename"
|
|
msgstr "Błędna nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
|
#, fuzzy
|
|
#| msgid "Invalid pascal unit name"
|
|
msgid "Invalid Pascal unit name"
|
|
msgstr "Błędna nazwa modułu pascala"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Nieodpowiednia wersja"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maksymalny numer wersji (opcjonalny):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimalny numer wersji (opcjonalny):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nowy wymóg"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Nazwa pakietu:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Nie znalazłem pakiet"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Nie znalazłem zależności %s%s%s.%sWybierz istniejący pakiet."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maksymalny numer wersji %s%s%s jest nieprawidłowy.%sUżyj formatu: major.minor.release.build%sNp.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maksymalny numer wersji jest mniejszy niż minimalny."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimalny numer wersji %s%s%s jest nieprawidłowy.%sUżyj formatu: major.minor.release.build%sNp.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
|
msgid "The package name \"%s\" is invalid.%sPlase choose an existing package."
|
|
msgstr "Pakiet %s%s%s jest nieprawidłowy.%sWybierz istniejący pakiet."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, fuzzy,badformat
|
|
#| msgid "The project has already a dependency for the package %s%s%s."
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Projekt ma już zależność od pakietu %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Moduł o nazwie %s%s%s już istnieje w projekcie%sw pliku: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Nazwa modułu %s%s%s już istnieje w zaznaczeniu%sw pliku: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The unit name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nazwa modułu %s%s%s nie jest prawidłowym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add to project"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Dodaj do projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Moduł o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
msgid "Project %s"
|
|
msgstr "Projekt %s"
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr "projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekt zmieniony"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectcount
|
|
msgid "%d projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
|
msgid "Title in taskbar shows also directory path of the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Nazwa pliku projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Ścieżka dołączanych plików projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Wykryłem plik z informacją o projekcie"
|
|
|
|
#: lazarusidestrconsts.lisprojectinformation
|
|
msgid "Project information"
|
|
msgstr "Informacje o projekcie"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekt jest wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr "Katalog wyjściowy projektu (tzn. katalog plików *.ppu)"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr "Katalog wyjściowy projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr "Katalogi źródeł projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Ścieżka źródeł projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Ścieżka do modułów projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojfiles
|
|
msgid "Files:"
|
|
msgstr "Pliki:"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Potwierdź usunięcie zależności"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Potwierdź usunięcie pliku"
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Chcesz usunąć zależność od %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Inspektor projektu - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Usunięte wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Chcesz usunąć plik %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
msgid "Remove %s items from project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Zawsze buduj (nawet jeśli nic nie zostało zmienione)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Spytaj o wartość"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Publikuj katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr "Publikuj projekt"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Exclude filter"
|
|
msgid "Invalid exclude filter"
|
|
msgstr "Błędny filtr Exclude"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Include filter"
|
|
msgid "Invalid include filter"
|
|
msgstr "Błędny filtr Include"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr "Zapisz pliki .lrs w katalogu wyjściowym"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
#, fuzzy
|
|
#| msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Moduł pascala powinien mieć rozszerzenie .pp lub .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
|
msgid "The unitname is used when the IDE extends uses clauses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi Project"
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "Konwertuj projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
#, fuzzy
|
|
#| msgid "New Project"
|
|
msgid "&New Project"
|
|
msgstr "Nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
#, fuzzy
|
|
#| msgid "Open Project"
|
|
msgid "&Open Project"
|
|
msgstr "Otwórz projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project"
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Otwórz poprzedni"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr "Pokaż przykładowe projekty"
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixremoveunit
|
|
msgid "Quick fix: Remove unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "&Quit Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Błąd odczytu"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr "Nagraj"
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr "Nagrane"
|
|
|
|
#: lazarusidestrconsts.lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Przywróć"
|
|
|
|
#: lazarusidestrconsts.lisregisters
|
|
msgctxt "lazarusidestrconsts.lisregisters"
|
|
msgid "Registers"
|
|
msgstr "Rejestry"
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr "Wyrażenia regularne"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Ścieżka względna"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr "Usunąć?"
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Usuń wszystkie nieprawidłowe właściwości"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
msgid "Removed property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefrominstalllist
|
|
msgid "Remove from install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
#, fuzzy
|
|
#| msgid "Remove from project"
|
|
msgid "Remove from Project"
|
|
msgstr "Usuń z projektu"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr "Usuń ze ścieżki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr "Usunąć ścieżkę dołączania?"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable
|
|
msgid "Remove local variable %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr "Usuń nieistniejące pliki"
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr "Usuń wybrane moduły"
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr "Usunąć ścieżkę modułów?"
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
msgid "Remove uses \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Zmień"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr "Zmień ..."
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Chcesz zmienić nazwę pliku?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Nie można zmienić nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
msgid "Rename to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Powtarzaj"
|
|
|
|
#: lazarusidestrconsts.lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr "Liczba powtórzeń:"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Zamień"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr "Czy ustawić wszystkie filtry na domyślne?"
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr "Nazwa zasobu musi być unikalna."
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Nie można zapisać zasobów"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
#, fuzzy
|
|
#| msgid "Resource type of project:"
|
|
msgid "Resource type of project"
|
|
msgstr "Rodzaj zasobów projektu:"
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Uruchom ponownie"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid "returns list of all values of case variable in front of variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Przywrócenie nie udało się"
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Prawe umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Prawy odstęp obramowania. Ta wartość jest dodawana do podstawowego odstępu."
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisroot
|
|
msgid "Root"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrootdirectory
|
|
msgid "Root Directory"
|
|
msgstr "Katalog główny"
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunbuttonhint
|
|
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
|
msgid "Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
msgid "%s (running ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Plik nie jest wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The host application %s%s%s is not executable."
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Aplikacja hosta %s%s%s nie jest wykonywalna."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Idź-do nie zadziałało"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Kursor nie jest wewnątrz deklaracji klasy"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
#, fuzzy
|
|
#| msgid "Save ..."
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Zapisz..."
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Zapisz wszystko"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr "Zapisz zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
#, fuzzy
|
|
#| msgid "save all modified files"
|
|
msgid "Save all modified files"
|
|
msgstr "Zapisz wszystkie zmienione pliki"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Zapisz i zamknij okno"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Zapisz i przebuduj IDE"
|
|
|
|
#: lazarusidestrconsts.lissaveas
|
|
msgctxt "lazarusidestrconsts.lissaveas"
|
|
msgid "Save As"
|
|
msgstr "Zapisz jako..."
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Chcesz zapisać zmiany?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Chcesz zapisać zmiany w projekcie %s?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "Save current editor file"
|
|
msgstr "zapisz edytowany plik"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Zapisuj informację edytara dla plików z poza projektu"
|
|
|
|
#: lazarusidestrconsts.lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Zapisz plik jako"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, fuzzy,badformat
|
|
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Czy zapisać\"plik %s%s%s%sprzed zamknięciem formularza %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Zapisz informacje o zamkniętych plikach edytora"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
msgid "Save project %s (*%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
msgid "Save session changes to project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr "Zapisuj informację o zwijaniu"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr "Edytor kodu umożliwia zwijanie (tymczasowe ukrywanie) bloków kodu."
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr "Zapisuj historię skoków"
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Zapisz ustawienia"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Zapisz "
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr "Skanowanie"
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
msgid "%s. Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr "Skanuj katalog nadrzędny"
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr "Ścieżki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
msgid "Search Unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Zobacz komunikaty."
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Wybierz węzeł"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Wybierz formularze Delphi (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerebuilt
|
|
msgid "Selected %d modes were successfully built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Wybierz plik"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Zaznaczenie przekracza stałą łańcuchową."
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Narzędzie zaznaczania"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
msgid "Select path to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr "(Ustaw domyślne wcięcia)"
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr "Pokaż drzewo komponentów"
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr "Pokaż podpowiedzi deklaracji"
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr "Pokaż różnicę między trybami"
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr "pokaż puste moduły/pakiety"
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
#, fuzzy
|
|
#| msgid "Show Glyphs for:"
|
|
msgid "Show Glyphs for"
|
|
msgstr "Pokaż glify dla:"
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Pokaż margines ikon"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr "Pokaż pomoc"
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Pokaż podpowiedzi w Inspektorze Obiektów"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Pokaż identyfikatory"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr "Pokaż pole z informacją"
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Pokaż pakiety"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr "Ramka poniżej pokaże opis wybranej właściwości."
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Pokaż znaki specjalne"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
#, fuzzy
|
|
#| msgid "Show status bar"
|
|
msgid "Show statusbar"
|
|
msgstr "Pokaż pasek stanu"
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr "Pokaż podpowiedzi wartości podczas odpluskiwania"
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr "Najprostszy program w konsoli"
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple syntax"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr "Pomiń błędy"
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipthesewarnings
|
|
msgid "Skip these warnings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr "Mniejszy niż szybszy"
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Przykro mi, ten typ jeszcze nie jest obsługiwany"
|
|
|
|
#: lazarusidestrconsts.lissortforscope
|
|
msgid "Sort for scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Rosnąco"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Uwzględnij wielkość liter"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Malejąco"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Domena"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Ignoruj odstępy"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Wiersza"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Akapity"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Podgląd"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Zatwierdź"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Posortuj zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Wielkość liter"
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcebreakpoint
|
|
msgid "&Source Breakpoint ..."
|
|
msgstr "Pułapka źródła ..."
|
|
|
|
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
|
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr "Zarządzanie oknami kodu źródłowego"
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Źródło zmienione"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, fuzzy,badformat
|
|
#| msgid "Source of page %s%s%s has changed. Save?"
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Źródło zakładki %s%s%s zostało zmienione. Chcesz je zapisać?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Ścieżki do źródeł"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Zatrzymaj"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Zatrzymać odpluskwianie i przebudować projekt?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Zatrzymaj przy wyjątku"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr "Zapamiętaj separatory ścieżek \\ oraz / "
|
|
|
|
#: lazarusidestrconsts.lisstrangelpifile
|
|
msgid "Strange lpi file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Błąd strumienia"
|
|
|
|
#: lazarusidestrconsts.lisstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstyle
|
|
msgctxt "lazarusidestrconsts.lisstyle"
|
|
msgid "Style"
|
|
msgstr "Styl"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr "Sugeruj domyślną nazwę pliku małymi literami"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr "Podejrzana ścieżka do folderu modułów"
|
|
|
|
#: lazarusidestrconsts.lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "Rewizja SVN: "
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Błędna nazwa zmiennej"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid identifier."
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "%s%s%s nie jest prawidłowym identyfikatorem."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Przedefiniuj zmienną systemową"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Tryb składni"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
msgid "Tab Order of %s"
|
|
msgstr "Kolejność kontrolek dla %s"
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
msgid "Tabs for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listakesnapshot
|
|
msgid "Take a Snapshot"
|
|
msgstr "Rejestruj zrzut"
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr "Cel:"
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
msgid ", Target: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Docelowy procesor"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr "Lokalizacja pliku wynikowego: (-o, gdy pusto przyjmij katalog wyjściowy modułów)Lokalizacja pliku wynikowego: (-o, gdy pusto przyjmij katalog wyjściowy modułów)"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Docelowa nazwa projektu"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Docelowy system operacyjny"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Katalog testowy"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
msgid "The Codetools found an error:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The command after %s%s%s is not executable."
|
|
msgid "The command after \"%s\" is not executable."
|
|
msgstr "Polecenie po %s%s%s nie jest wykonywalne."
|
|
|
|
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
|
msgid "The command after publishing is invalid:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
|
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr "Tryb domyślny musi być zachowany w projekcie, nie w sesji"
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, fuzzy,badformat
|
|
#| msgid "The destination directory%s%s%s%s does not exist."
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Nie ma katalogu docelowego%s%s%s%s."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
|
msgid "The directory \"%s\" is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
|
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr "Nie znaleziono katalogu %s."
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s"
|
|
msgid "The file \"%s\""
|
|
msgstr "Plik %s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
|
msgid "The file %s does not look like a lpi file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Nie znalazłem pliku %s%s%s%s.%sCzy chcesz zlokalizować go samemu ?%s"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Nie znalazłem pliku %s%s%s%s.%sWciśnij Ignoruj aby dalej ładować projekt,%sPorzuć zatrzyma ładowanie."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
msgid "The key %s%sis already assigned to %s.%sRemove the old assignment and assign the key to the new function%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
#, fuzzy
|
|
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually.The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "Plik LFM (formularz Lazarusa) zawiera nieprawidłowe włąściwości, np. może zawierać pewne właściwości lub klasy, których nie ma obecnie w LCL. Zwyczajowo naprawia się to przezusunięcie tych właściwości z LFM i ręczne poprawienie kodu w pascalu."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Pakiet zawiera już moduł o tej samej nazwie."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
msgid "The package %s is already in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr "Ścieżka do \"make\" nie jest poprawna: \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr "Projekt nie ma głównego pliku źródłowego."
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, fuzzy,badformat
|
|
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Plik z informacją o projekcie %s%s%s%s jest taki sam jak główne źródło projektu!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, fuzzy
|
|
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Projekt musi być zapisany przed budowaniem%sJeśli zmienisz \"katalog testowy\" w ustawieniach środowiska,%sbędziesz mógł budować projekty zaraz po utworzeniu.%sChcesz zapisać projekt?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
|
|
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherearenoconflictingkeys
|
|
msgid "There are no conflicting keys."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "W katalogu są inne pliki o tej nazwie,%sktóre różnią się tylko wielkością liter:%s%s%sChcesz je usunąć?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Istnieje plik z taką samą nazwą i podobnym rozszerzeniem na dysku%sPlik: %s%sNiejednoznaczny plik: %s%s%sUsunąć niejednoznaczny plik?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a form with the name %s%s%s"
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Już jest formularz o nazwie %s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
msgid "There is already a package %s in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Moduł o nazwie %s%s%s jest już w projekcie.%sWybierz inną nazwę."
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component cannot be deleted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr "Poniższe pliki zostaną usunięte"
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
msgid "The target %s is not writable."
|
|
msgstr "Docelowy %s bez prawa zapisu."
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
msgid "The unit belongs to package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "ten komunikat pomocy"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreads
|
|
msgctxt "lazarusidestrconsts.listhreads"
|
|
msgid "Threads"
|
|
msgstr "Wątki"
|
|
|
|
#: lazarusidestrconsts.listhreadscurrent
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
|
msgid "Current"
|
|
msgstr "Bieżący"
|
|
|
|
#: lazarusidestrconsts.listhreadsfunc
|
|
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
|
msgid "Function"
|
|
msgstr "funkcja"
|
|
|
|
#: lazarusidestrconsts.listhreadsgoto
|
|
msgid "Goto"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsline
|
|
msgctxt "lazarusidestrconsts.listhreadsline"
|
|
msgid "Line"
|
|
msgstr "Wiersz"
|
|
|
|
#: lazarusidestrconsts.listhreadsnotevaluated
|
|
msgid "Threads not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadssrc
|
|
msgctxt "lazarusidestrconsts.listhreadssrc"
|
|
msgid "Source"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.listhreadsstate
|
|
msgctxt "lazarusidestrconsts.listhreadsstate"
|
|
msgid "State"
|
|
msgstr "Stan"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
|
msgid "Choose a component icon 24x24"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Funkcja: dołącz rozgranicznik ścieżki"
|
|
|
|
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
|
#, fuzzy
|
|
#| msgid "Function: chomp path delimiter"
|
|
msgid "Function: remove trailing path delimiter"
|
|
msgstr "Funkcja: wytnij rozgranicznik ścieżki"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Funkcja: wyodrębnij rozszerzenie pliku"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Funkcja: wyodrębnij nazwę pliku + rozszerzenie"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Funkcja: wyodrębnij samą nazwę pliku"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Funkcja: wyodrębnij ścieżkę pliku"
|
|
|
|
#: lazarusidestrconsts.listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(nieznane makro: %s)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Ścieżka:"
|
|
|
|
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptions
|
|
msgid "Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionshighlight
|
|
msgid "Highlight toolbars buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionsraise
|
|
msgid "Raise toolbars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Góra"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Górne umocowanie"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
msgid "Total Pages: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listurbopascal
|
|
msgid "Turbo Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr "Wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
msgid "File: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr "(filtr)"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
msgid "Implementation Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
msgid "implementation uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
msgid "Interface Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
msgid "interface uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr "Skanowanie ..."
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
msgid "Scanning: %s units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
msgid "Units: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
msgid "Used by Implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
msgid "used by implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
msgid "used by interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Nie pokazuj więcej tego komunikatu."
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Błąd w wyrażeniu regularnym"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line :"
|
|
msgid "Goto line:"
|
|
msgstr "Idź do wiersza :"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nie znalazłem"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Zastąpić to wystąpienie %s%s%s%s przez %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Szukanie: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Nie znalazłem wyrażenia '%s' !"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Wyczyść pamięć podręczną"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s bajtów"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Dołączane przez:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
#, fuzzy
|
|
#| msgid "in Project:"
|
|
msgid "In project:"
|
|
msgstr "w projekcie:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Linii:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "nie"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Rozmiar:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "tak"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Pokaż wartości CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nie można dodać komentarza nagłówka zasobu do pliku zasobów %s%s%s%s.%sPrawdopodobnie błąd składniowy."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nie można dodać zasobu T%s:FORMDATA do pliku z zasobami %s%s%s%s.%sPrawdopodobnie błąd składni."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "Nie można dodać %s do projektu, ponieważ zawiera on już moduł o tej nazwie."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Nie można utworzyć kopii zapasowej pliku %s%s%s jako %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Nie można wyczyścić katalogu docelowego"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Nie można wyczyścić %s%s%s.%sSprawdź uprawnienia."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Nie można zamienić pliku %s%s%s%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Nie można skonwertować pliku z danymi w formie tekstu z pliku%s%s%s%s%sna strumień dwójkowy. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
|
msgstr "Nie można skopiować pliku %s%s%s%sdo %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create backup directory %s%s%s."
|
|
msgid "Unable to create backup directory \"%s\"."
|
|
msgstr "Nie można utworzyć katalogu z kopią zapasową %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create directory %s%s%s."
|
|
msgid "Unable to create directory \"%s\"."
|
|
msgstr "Nie można utworzyć katalogu %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Nie można utworzyć pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create file %s%s%s"
|
|
msgid "Unable to create file \"%s\""
|
|
msgstr "Nie można utworzyć pliku %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
msgid "Unable to create file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
msgid "Unable to create link \"%s\" with target \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file, because there is already a directory with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
|
msgid "Unable to create new method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodelete
|
|
msgid "Unable to delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Nie można usunąć niejednoznacznego pliku %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
msgid "unable to execute: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find file %s%s%s."
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Nie znalazłem pliku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
msgid "unable to load file %s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
msgid "Unable to load the component class \"%s\", because it depends on itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
msgid "Unable to open \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr "Nie można odczytać %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Nie można czytać pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s!"
|
|
msgid "Unable to read file \"%s\"."
|
|
msgstr "Nie można czytać pliku %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgid "Unable to read file \"%s\"%sError: %s"
|
|
msgstr "Nie można odczytać pliku %s%s%s%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadlpi
|
|
msgid "Unable to read lpi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
|
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
|
msgid "Unable to read the project info file%s\"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to remove old backup file %s%s%s!"
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Nie można usunąć starego pliku kopii zapasowej %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Nie udało się zmienić nazwy niejednoznacznego pliku %s%s%s%sna %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Nie udało się zmienić nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
|
msgstr "Nie udało się zmienić nazwy pliku %s%s%s na %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
|
msgstr "Nie udało sie zmienić nazwy pliku %s%s%s%s na %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Nie udało się zmienić nazwy formularza w źródle."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Nie można zmienić nazwy metody. Popraw błąd wypisany w oknie komunikatów."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Nie udało się zmienić nazwy zmiennej w źródle."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Nie można wysłać do strumienia %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Nie można przekształcić binarnego strumienia komponentu %s:T%s na tekst."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Nie można uaktualnić polecenia CreateForm w źródle"
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
msgid "Unable to write \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Nie można pisać do pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
msgid "Unable to write file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgid "Unable to write file \"%s\"%sError: %s"
|
|
msgstr "Nie można zapisać do pliku %s%s%s%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
|
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
|
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
msgid "Unable to write to file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Cofnij"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
msgid "Uninstall %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Odinstaluj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisunit"
|
|
msgid "Unit"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
#, fuzzy,badformat
|
|
#| msgid "Unit %s%s%s has changed. Save?"
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr "Moduł %s%s%s został zmieniony. Zapisać?"
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Identyfikator modułu istnieje"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%s unit %s in package %s%s"
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s moduł %s w pakiecie %s%s"
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Moduł o tej nazwie jest już w projekcie"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
msgid "unit %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinproject
|
|
msgid "A unit not found in project %s"
|
|
msgstr "Nie znaleziono modułu w projekcie %s"
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "ścieżka modułów"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Ścieżki do modułów"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
msgid "unit %s requires package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
|
msgid "Units not found in project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunsigned
|
|
msgid "Unsigned"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
msgid "Unused units of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "W górę"
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
|
msgid "Updating PO files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseandclose
|
|
msgid "Use and close"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Używaj łańcuchów typu Ansistring"
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
msgid " used by %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseexcludefilter
|
|
msgid "Use exclude filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseincludefilter
|
|
msgid "Use include filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
msgid "Use package %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
msgid "Use package %s in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
msgid "Add to list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
msgid "Remove from list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Katalog domowy użytkownika"
|
|
|
|
#: lazarusidestrconsts.lisusesub
|
|
msgctxt "lazarusidestrconsts.lisusesub"
|
|
msgid "Use >>"
|
|
msgstr "Zastosuj >"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr "Dodaj moduł do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr "UTF-8 z BOM"
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Wartość"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
msgid "Value%s"
|
|
msgstr "Wartość%s"
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr "Wartość: "
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr "Wartości"
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Zmienna"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Badaj metodę odwołań"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Wersja"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr "Niezgodność wersji"
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Kopiuj informacje o wersji do schowka"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewbreakpointproperties
|
|
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr "Właściwości pułapki"
|
|
|
|
#: lazarusidestrconsts.lisviewsource
|
|
msgid "View Source"
|
|
msgstr "Pokaż źródło"
|
|
|
|
#: lazarusidestrconsts.lisviewsourcedisass
|
|
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
|
msgid "View Assembler"
|
|
msgstr "Pokaż okno assemblera"
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Pokaż źródło (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr "Ostrzeżenie: "
|
|
|
|
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
|
|
msgstr "Uwaga: znalazłem niejednoznaczny plik: %s%s%s. Plik źródłowy to: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
msgid ", Warnings: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatch
|
|
msgid "&Watch"
|
|
msgstr "Czujka"
|
|
|
|
#: lazarusidestrconsts.liswatchdata
|
|
msgid "Watch:"
|
|
msgstr "Czujka:"
|
|
|
|
#: lazarusidestrconsts.liswatchkind
|
|
msgid "Watch action"
|
|
msgstr "Działanie czujki"
|
|
|
|
#: lazarusidestrconsts.liswatchkindread
|
|
msgid "Read"
|
|
msgstr "Odczyt"
|
|
|
|
#: lazarusidestrconsts.liswatchkindreadwrite
|
|
msgid "Read/Write"
|
|
msgstr "Odczyt/Zapis"
|
|
|
|
#: lazarusidestrconsts.liswatchkindwrite
|
|
msgid "Write"
|
|
msgstr "Zapis"
|
|
|
|
#: lazarusidestrconsts.liswatchpoint
|
|
msgid "&Data/Watch Breakpoint ..."
|
|
msgstr "Pułapka danych/czujki ..."
|
|
|
|
#: lazarusidestrconsts.liswatchpointbreakpoint
|
|
msgid "&Data/watch Breakpoint ..."
|
|
msgstr "Pułapka danych/czujki ..."
|
|
|
|
#: lazarusidestrconsts.liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr "Właściwości czujki"
|
|
|
|
#: lazarusidestrconsts.liswatchscope
|
|
msgid "Watch scope"
|
|
msgstr "Zakres czujki"
|
|
|
|
#: lazarusidestrconsts.liswatchscopeglobal
|
|
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
|
msgid "Global"
|
|
msgstr "Globalny"
|
|
|
|
#: lazarusidestrconsts.liswatchscopelocal
|
|
msgid "Declaration"
|
|
msgstr "Deklaracja"
|
|
|
|
#: lazarusidestrconsts.liswatchtowatchpoint
|
|
msgid "Create &Data/Watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr "Wymagające budowania"
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr "Gdy zmieniana jest nazwa modułu, zmieniaj odnośniki"
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "wraz z wymaganymi pakietami"
|
|
|
|
#: lazarusidestrconsts.liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlexpression
|
|
msgid "Expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlinspectpane
|
|
msgid "Inspect pane"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Właściwości"
|
|
|
|
#: lazarusidestrconsts.liswlwatchlist
|
|
#, fuzzy
|
|
#| msgid "Watch list"
|
|
msgid "Watch List"
|
|
msgstr "Lista czujek"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Słowo przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Błąd zapisu"
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr "Błąd zapisu: %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
msgid "wrong version in %s: %s"
|
|
msgstr "zła wersja w %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr "Błąd XML"
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyes
|
|
msgid "Yes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
#, fuzzy
|
|
#| msgid "You can not build lazarus while debugging or compiling."
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Nie możesz budować lazarusa w czasie odpluskwiania lub kompilacji programu."
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<wszystkie>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr "Usuń wybrane"
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr "niepoprawne pliki lpk (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
msgid "lpk file valid (%s)"
|
|
msgstr "poprawne pliki (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgbinary
|
|
msgctxt "lazarusidestrconsts.regdlgbinary"
|
|
msgid "Binary"
|
|
msgstr "Binarny"
|
|
|
|
#: lazarusidestrconsts.regdlgdecimal
|
|
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
|
msgid "Display type for selected Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgformat
|
|
msgid "Format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlghex
|
|
msgid "Hex"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgraw
|
|
msgid "Raw"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsattachto
|
|
msgid "Attach to"
|
|
msgstr "Dołącz do"
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr "Atrybuty"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Automatycznie zwiększ numer budowania"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
#, fuzzy
|
|
#| msgid "Build:"
|
|
msgid "&Build:"
|
|
msgstr "Buduj:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page"
|
|
msgstr "Zamknij bieżącą stronę"
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Włącz i18n"
|
|
|
|
#: lazarusidestrconsts.rsenterpid
|
|
msgid "Enter PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found, but not listed here: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Opcje i18n"
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
#, fuzzy
|
|
#| msgid "Include Version Info in executable"
|
|
msgid "Include version info in executable"
|
|
msgstr "Dołącz informacje o wersji w pliku wykonywalnym"
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
|
msgid "Column Names"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
|
msgid "Strategy for saving Columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
|
msgid "Column Width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometry
|
|
msgid "Custom geometry"
|
|
msgstr "Własna geometria"
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
|
msgid "User can define window's position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
|
msgid "Fixed default geometry"
|
|
msgstr "Domyślna pozycja"
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
|
msgid "Always the same fixed position and size"
|
|
msgstr "Zawsze ta sama ustalona pozycja i rozmiar"
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
|
msgid "Let windowmanager decide"
|
|
msgstr "Niech menedżer okien zdecyduje"
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
|
msgid "System windowmanagers have different strategies for positioning windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
|
msgid "Windows that have been open. They may be closed now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Przywróć położenie okna"
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
|
msgid "Use previous position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
|
msgid "Custom Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterdefault
|
|
msgid "Default Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
|
msgid "Restore with window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
|
msgid "Restore Size"
|
|
msgstr "Przywróć rozmiar"
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "afrykanerski"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "arabski"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
#, fuzzy
|
|
#| msgid "Automatic (or english)"
|
|
msgid "Automatic (or English)"
|
|
msgstr "automatyczny (lub angielski)"
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "kataloński"
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "chiński"
|
|
|
|
#: lazarusidestrconsts.rslanguageczech
|
|
msgid "Czech"
|
|
msgstr "czeski"
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "holenderski"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "angielski"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "fiński"
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr "francuski"
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "niemiecki"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "hebrajski"
|
|
|
|
#: lazarusidestrconsts.rslanguagehungarian
|
|
msgid "Hungarian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "indonezyjski"
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "włoski"
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "japoński"
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "litewski"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Opcje językowe"
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "polski"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguese
|
|
msgid "Portuguese"
|
|
msgstr "portugalski"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguesebr
|
|
msgid "Brazilian Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "rosyjski"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Wybór języka:"
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr "słowacki"
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "hiszpański"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr "turecki"
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "ukraiński"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Inne informacje"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "Katalog wyjściowy PO:"
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgid "File name"
|
|
msgstr "Nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr "&Rewizja:"
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsstartanewsearch
|
|
msgid "Start a new search"
|
|
msgstr "Uruchom nowe wyszukiwanie"
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Numerowanie wersji"
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Menu pomoc"
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Sterowanie"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeTools"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Poruszanie kursorem"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Edycja tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Menu plik"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr "Polecenia zwijania tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
msgid "Text marker commands"
|
|
msgstr "Znaczniki"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Menu projekt"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Menu uruchom"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Wyszukiwanie i zastępowanie"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Wybieranie tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Zakładki edytora źródeł"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Menu narzędzia"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Menu widok"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Polecenie:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr "Metody abstrakcyjne ..."
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr "Dodaj pułapkę w adresie"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
#, fuzzy
|
|
#| msgid "Add jump point"
|
|
msgid "Add Jump Point"
|
|
msgstr "Dodaj punkt skoku"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "dodaj czujkę"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr "Dołącz do programu"
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Dokończenie szablonu kodu"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr "Usuń blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr "Przejdź do początku bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr "Przejdź na koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr "Ukryj blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Zwiększ wcięcie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Zmniejsz wcięcie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "buduj program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "zbuduj plik"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build lazarus"
|
|
msgid "Build Lazarus"
|
|
msgstr "Buduj lazarusa"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Znak"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Usuń cały tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr "Usuń wszystkie zakładki"
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr "Usun zakładki w aktualnym pliku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Tryb wyboru kolumn"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccompletecode
|
|
#, fuzzy
|
|
#| msgid "Complete code"
|
|
msgctxt "lazarusidestrconsts.srkmeccompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Uzupełnij kod"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "konfiguruj \"buduj plik\""
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
msgid "Copy selection to clipboard"
|
|
msgstr "Skopiuj zaznaczenie do schowka"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
msgid "Cut selection to clipboard"
|
|
msgstr "Wytnij zaznaczenie i umieść w schowku"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Usuń do początku wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Usuń znak przy kursorze"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Usuń do końca wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Usuń ostatni znak"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Usuń do początku słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Usuń bieżący wiersz"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Usuń do końca słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr "Odłącz od programu"
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Diff"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr "Przesuń kursor w dół"
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Przesuń kursor na koniec"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Przesuń kursor na początek"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr "Puste metody..."
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr "Opcje IDE"
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure"
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Wyodrębnij procedurę"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Zewnętrzne narzędzie %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Ustawienia zewnętrznych narzędzi"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
#, fuzzy
|
|
#| msgid "Find text"
|
|
msgid "Find Text"
|
|
msgstr "Znajdź tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Znajdź drugi koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Znajdź początek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
#, fuzzy
|
|
#| msgid "Find declaration"
|
|
msgid "Find Declaration"
|
|
msgstr "Znajdź deklarację"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find Identifier References"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find in files"
|
|
msgid "Find in Files"
|
|
msgstr "Znajdź w plikach"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
#, fuzzy
|
|
#| msgid "Find next"
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Znajdź następne"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find next word occurrence"
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Znajdź następne wystąpienie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
#, fuzzy
|
|
#| msgid "Find previous"
|
|
msgid "Find Previous"
|
|
msgstr "Znajdź poprzednie"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find previous word occurrence"
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Znajdź poprzednie wystąpienie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
#, fuzzy
|
|
#| msgid "Find procedure definiton"
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Znajdź definicję procedury"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
#, fuzzy
|
|
#| msgid "Find procedure method"
|
|
msgid "Find Procedure Method"
|
|
msgstr "Znajdź metodę-procedurę"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr "Zwiń przy kursorze"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
msgid "Fold to Level %d"
|
|
msgstr "Zwiń do poziomu %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Przejdź do edytora %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Go to to include directive of current include file"
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Przejdź do $include dla wstawionego pliku"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
#, fuzzy
|
|
#| msgid "Go to line number"
|
|
msgid "Go to Line Number"
|
|
msgstr "Przejdź do linii numer..."
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
msgid "Go to Marker %d"
|
|
msgstr "Przejdź do znacznika %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Idź do XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced $IFDEF"
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Znajdź błędnie umieszczone $IFDEF"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w lewo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w prawo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Wstaw element ChangeLog'u"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Wstaw z tablicy znaków"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Wstaw słowo kluczowe CVS: Author"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Wstaw słowo kluczowe CVS: Date"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Wstaw słowo kluczowe CVS: Header"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Wstaw słowo kluczowe CVS: ID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Wstaw słowo kluczowe CVS: Log"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Wstaw słowo kluczowe CVS: Name"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Wstaw słowo kluczowe CVS: Revision"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Wstaw słowo kluczowe CVS: Source"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Wstaw bieżącą datę i czas"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Wstaw informację o licencji GPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Wstaw GUID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Wstaw informację o licencji LGPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Zawiń wiersz i pozostaw kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr "Wstaw oświadczenie MIT"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Tryb wstawiania"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Wstaw zmodyfikowane ogłoszenie LGPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Wstaw bieżącą nazwę użytkownika"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr "Przesuń kursor w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Zawiń wiersz i przenieś kursor"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Przesuń kursor na koniec wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Tryb wyboru linii"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Przesuń kursor na początek wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr "Przesuń kursor na początek tekstu w wierszu"
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr "Zablokuj edytor"
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
#, fuzzy
|
|
#| msgid "Make resource string"
|
|
msgid "Make Resource String"
|
|
msgstr "Utwórz łańcuch w zasobach"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Przejdź do pasującego nawiasu"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Przesuń edytor w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Przesuń edytor najbardziej w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Przesuń edytor w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Przesuń edytor najbardziej w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Następna zakładka"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Przejdź do następnego edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr "Przejdź do następnego okna"
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normalny tryb wyboru"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "Open file at cursor"
|
|
msgid "Open File at Cursor"
|
|
msgstr "Otwórz plik przy kursorze"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Tryb nadpisywania"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Przesuń kursor na dół strony"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Przesuń kursor o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Przesuń kursor w lewo o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Przesuń kursor w prawo o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Przesuń kursor na górę strony"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Przesuń kursor o stronę wyżej"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
msgid "Paste clipboard to current position"
|
|
msgstr "Wklej tutaj"
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "przerwij działanie programu"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Poprzednia zakładka"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Przejdź do poprzedniego edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr "Przejdź do poprzedniego okna"
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "szybka kompilacja, bez łączenia"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
#, fuzzy
|
|
#| msgid "remove break point"
|
|
msgid "remove breakpoint"
|
|
msgstr "usuń pułapkę"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
#, fuzzy
|
|
#| msgid "Remove empty methods"
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Usuń puste metody"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
#, fuzzy
|
|
#| msgid "Remove unused units"
|
|
msgid "Remove Unused Units"
|
|
msgstr "Usuń nieużywane moduły"
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
#, fuzzy
|
|
#| msgid "Rename identifier"
|
|
msgid "Rename Identifier"
|
|
msgstr "Zmień nazwę identyfikatora"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
#, fuzzy
|
|
#| msgid "Replace text"
|
|
msgid "Replace Text"
|
|
msgstr "Zastąp tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Zgłaszanie błędu..."
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "zresetuj odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr "Przesuń kursor w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "uruchom program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "uruchom plik"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "parametry uruchomienia"
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Przewiń w dół o jedną linię"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Przewiń w lewo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Przewiń w prawo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Przewiń w górę o jedną linię"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Wybierz w dół"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Zamień znaki tabulacji na spacje w zaznaczonym tekście"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Wybierz do końca"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Wybierz do początku"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Wybierz do XY"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
#, fuzzy
|
|
#| msgid "SelLeft"
|
|
msgid "Select Left"
|
|
msgstr "WybWLewo"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Wybierz do końca linii"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Wybierz do początku linii"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Wybierz dół strony"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Wybierz stronę w dół"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Wybierz stronę w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Wybierz stronę w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Wybierz górę strony"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Wybierz stronę w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
#, fuzzy
|
|
#| msgid "SelRight"
|
|
msgid "Select Right"
|
|
msgstr "WybWPrawo"
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Wybierz w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Wybierz słowo po lewej"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Wybierz słowo po prawej"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Ustaw wolną zakładkę"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
msgid "Set Marker %d"
|
|
msgstr "Ustaw znacznik %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
#, fuzzy
|
|
#| msgid "Show abstract methods"
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Pokaż metody abstrakcyjne"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show Code Context"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "zatrzymaj program"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr "Odtwórz makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr "Nagraj makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr "Zaznacz komórkę"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Następna komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Poprzednia komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Następna komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Poprzednia komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Syntax check"
|
|
msgid "Syntax Check"
|
|
msgstr "Sprawdzenie składni"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr "Pokaż assembler"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr "przełącz pułapkę"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Pokaż pułapki"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Pokaż przeglądarkę kodu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Pokaż eksploratora kodu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Pokaz paletę komponentów"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Pokaż wyjście debuggera"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Przełącz pomiędzy formularzem i kodem"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Pokaż dokumentację edytora"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Pokaż zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
msgid "Toggle Marker %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Pokaż komunikaty"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Przełącz tryb"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Pokaż inspektora obiektów"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr "Pokaż rejestry"
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Pokaż przeglądarkę ograniczeń"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Pokaż wyniki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Pokaż edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Pokaż czujki"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Cofnij wszystkie zwinięcia"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr "Cofnij zwinięcia od kursora"
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "nieznane polecenie edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr "Nieużywane moduły ..."
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr "Przesuń kursor w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Pokaż zakotwiczenie edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Pokaż komponenty"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr "Pokaż makra edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Pokaż formularze"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr "Pokaż historię"
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Pokaż wątki"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Pokaż zależności modułu"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Pokaż informacje o module"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word Completion"
|
|
msgstr "Uzupełnianie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr "Przesuń kursor na początek słowa w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr "Przesuń kursor na koniec słowa w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Przesuń kursor o słowo w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Przesuń kursor o słowo w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr "Zwiń komentarze"
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr "Ukryj komentarze"
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Cofnij wszystkie zwinięcia"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Plik jest tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Plik \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" nie jest zapisywalny."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr "Zablokowane"
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Dodaj &czujkę przy kursorze"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Zakładka"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr "Zamknij wszystkie &inne strony"
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Zamknij zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
#, fuzzy
|
|
#| msgid "Copy filename"
|
|
msgid "Copy Filename"
|
|
msgstr "Kopiuj nazwę pliku"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr "Sklonuj do nowego okna"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Kodowanie"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Znajdź deklarację"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Idź do zakładki"
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Podświetlanie"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Badaj ..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Odwróć przyporządkowanie"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr "Koniec linii"
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
#, fuzzy
|
|
#| msgid "Move page left"
|
|
msgid "Move Page Left"
|
|
msgstr "Przesuń stronę w lewo"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
#, fuzzy
|
|
#| msgid "Move page leftmost"
|
|
msgid "Move Page Leftmost"
|
|
msgstr "Przesuń stronę najbardziej w lewo"
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
#, fuzzy
|
|
#| msgid "Move page right"
|
|
msgid "Move Page Right"
|
|
msgstr "Przesuń stronę w prawo"
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
#, fuzzy
|
|
#| msgid "Move page rightmost"
|
|
msgid "Move Page Rightmost"
|
|
msgstr "Przesuń stronę najbardziej w prawo"
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr "Przenieś do nowego okna"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Nowe okno"
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto next Bookmark"
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Idź do następnej zakładki"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Zmienione"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "&Open file at cursor"
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Otwórz plik przy kursorze"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto previous Bookmark"
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Idź do poprzedniej zakładki"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Skocz do procedury"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refaktoryzacja"
|
|
|
|
#: lazarusidestrconsts.uemruntocursor
|
|
msgid "&Run to Cursor"
|
|
msgstr "&Dojdź do kursora"
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free Bookmark"
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Ustaw wolną zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Pokaż numery wierszy"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr "&Ustaw zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
#, fuzzy
|
|
#| msgid "&Toggle Breakpoint"
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr "&Zastaw pułapkę"
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Jeszcze nie zaimplementowane"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
#, fuzzy
|
|
msgid "INS"
|
|
msgstr "WST"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "NAD"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Informacje o wersji"
|
|
|