mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-17 08:09:26 +02:00
1fd0fb7e36
IDE: regenerated translations and updated Russian translation ........ git-svn-id: branches/fixes_1_8@57222 -
22334 lines
624 KiB
Plaintext
22334 lines
624 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: lazaruside\n"
|
|
"Report-Msgid-Bugs-To: \n"
|
|
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
|
|
"PO-Revision-Date: 2008-11-16 19:20+0100\n"
|
|
"Last-Translator: Slavko <slavino@slavino.sk>\n"
|
|
"Language-Team: Slovenský <sk@li.org>\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"X-Generator: KBabel 1.11.4\n"
|
|
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
|
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
|
msgid "Select Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
|
msgid "Select groups to disable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
|
msgid "Select groups to enable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
|
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Vložiť"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
msgid "Continue %0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
msgid "Set free bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Všeobecné"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right mouse includes caret move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "šípka vpravo"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Len na čítanie"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Malé písmená, prvé veľké"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Pridať operátor priradenia (:=)"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Globálne"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Riadok"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
|
msgid "Outline Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
|
|
msgid "Level 10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
|
|
msgid "Level 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
|
|
msgid "Level 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
|
|
msgid "Level 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
|
|
msgid "Level 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
|
|
msgid "Level 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
|
|
msgid "Level 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
|
|
msgid "Level 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
|
|
msgid "Level 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
|
|
msgid "Level 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
msgid "Text block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Pridať bodkočiarku"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Prispôsobiť horný riadok pre komentár vpredu"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Podľa abecedy"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr "Kurozr vždy viditeľný"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Nejednoznačná akcia súboru:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Upozorniť pri preklade"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
msgid "Ansi (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
#, fuzzy
|
|
#| msgid "Application Settings"
|
|
msgid "Application settings"
|
|
msgstr "Nastavenia aplikácie"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
#, fuzzy
|
|
#| msgid "Include Assertion Code"
|
|
msgid "Include assertion code"
|
|
msgstr "Zahrnúť kód asertion"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automaticky vytvárané formuláre:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
#, fuzzy
|
|
#| msgid "When creating new forms, add them to auto-created forms"
|
|
msgid "Auto-create new forms"
|
|
msgstr "Nový formulár pridať k automaticky vytváraným formulárom"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Auto zmazanie súboru"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgid "Hide mouse when typing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindenttype
|
|
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
|
msgid "Auto indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Automaticky na malé písmená"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Dostupné formuláre:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Pozadie"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(bez podadresárov)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Rovnaké meno (v podadresári)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Za metódy"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
#, fuzzy
|
|
#| msgid "Block indent"
|
|
msgid "Block indent (spaces)"
|
|
msgstr "Odsadenie bloku"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblocktabindent
|
|
msgid "Block indent (tabs)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket pairs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
#, fuzzy
|
|
#| msgid "&Case Sensitive"
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr "&Citlivé na veľkosť"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Skontrolovať voľby prekladača"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
msgid "orphaned file found: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Výsledky"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Test: Kontrola prekladača ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Test: Kontrola nastavenia prekladača ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Test: Kontrola dát prekladača ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Test: Preklad prázdneho súboru ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr "Test: Kontrola chýbajúcich ppu fpc"
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu"
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Test: Preklad prázdneho súboru"
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
msgid "using config file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Poradie tried"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Posledný"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "malé písmená"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
#, fuzzy
|
|
#| msgid "Preview (Max line length = 1)"
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Ukážka (Maximálna dĺžka riadka = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Predpona čítania"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Prípona pre uložené"
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "VEĽKÉ PÍSMENÁ"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Predpona premennej"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Predpona zápisu"
|
|
|
|
#: lazarusidestrconsts.dlgcentercursorline
|
|
#, fuzzy
|
|
#| msgid "Center Cursor Line"
|
|
msgid "Center cursor line"
|
|
msgstr "Kurzor do stredu riadka"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
#, fuzzy
|
|
#| msgid "Save As - auto rename pascal files lower case"
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Uložiť ako - automaticky na malé písmená"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Zvoľte súbor šablón kódu (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Zobraziť zatváracie tlačítka v poznámkovom bloku"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Farebná schéma"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
#, fuzzy
|
|
#| msgid "C Style Macros (global)"
|
|
msgid "C style macros (global)"
|
|
msgstr "Makrá v štýle C (všeobevné)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
#, fuzzy
|
|
#| msgid "Use ansi strings"
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Použiť ANSI reťazce"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
#, fuzzy
|
|
#| msgid "Assembler style:"
|
|
msgid "Assembler style"
|
|
msgstr "Štýl Assembleru:"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Správy"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
#, fuzzy
|
|
#| msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "Operátory v štýle C (*=, +=, /= and -=)"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Vytvoriť Makefile"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
#, fuzzy
|
|
#| msgid "Debugging info"
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Ladenie:"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Ďalšie cesty debugera (žiadne):"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Tvorba kódu"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
#, fuzzy
|
|
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
|
|
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
|
msgstr "Generovať ladiace informácie pre GDB (Pomalší preklad)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
#, fuzzy
|
|
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Použiť jednotku Heaptrc"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
#, fuzzy
|
|
#| msgid "Include Files (-Fi):"
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Súbory include (-Fi)"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Info for GDB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Knižnice (-Fl):"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Linkovanie"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
#, fuzzy
|
|
#| msgid "Load/Save"
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Otvoriť/Uložiť"
|
|
|
|
#: lazarusidestrconsts.dlgcolor
|
|
msgid "Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Farby"
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Parametre príkazového riadka (bez mena aplikácie)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Make default indent for new line if comment opens at column:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
msgid "Match text after token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
msgid "Match text including token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend, if matched or not matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend, if matched or not matched (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend, if matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Voľby prekladača"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Dokončovanie vlastností"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
#, fuzzy
|
|
#| msgid "Config Files:"
|
|
msgid "Config files"
|
|
msgstr "Konfiguračné súbory"
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Pretečenie"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Analýza"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Rozsah"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoshowerr
|
|
#, fuzzy
|
|
#| msgid "Show Errors"
|
|
msgid "Show errors"
|
|
msgstr "Zobraziť chyby"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
#, fuzzy
|
|
#| msgid "Show Options"
|
|
msgid "&Show Options"
|
|
msgstr "Zobraziť voľby"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
#, fuzzy
|
|
#| msgid "Smart Linkable"
|
|
msgid "Smart linkable"
|
|
msgstr "Smart linkvteľné"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
#, fuzzy
|
|
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Ostatné zdrojové kódy (súbory .pp/.pas, použité len IDE, nie prekladačom)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Zásobník"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
#, fuzzy
|
|
#| msgid "Strip Symbols From Executable"
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Odstrániť symboly zo spustiteľného súboru"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
msgid "Dwarf with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf3 (beta)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
#, fuzzy
|
|
#| msgid "Unit Style"
|
|
msgid "Unit style"
|
|
msgstr "Štýl jednotky:"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Generovať kód pre valgrind"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
#, fuzzy
|
|
#| msgid "C++ Styled INLINE"
|
|
msgid "C++ styled INLINE"
|
|
msgstr "INLINE v štýle C++"
|
|
|
|
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
|
msgid "Ctrl-middle-click on tab closes all others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Kurzor za EOL"
|
|
|
|
#: lazarusidestrconsts.dlgcursorgroupoptions
|
|
msgid "Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr "Kurzor preskakuje výber"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Cursor skips tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Používateľská prípona (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Editor ciest"
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Typ a cesta debugera"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Predvolený font editora"
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Predvolená hodnota"
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Zmazať šablónu"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
msgid "Different values background"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Smer"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Vypnúť anti-aliasing"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Späť"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Tučné"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Podadresár"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Šablóny kódu"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Používateľom definovaná prípona"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
msgid "(%s sec delay)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Zobraziť"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
#, fuzzy
|
|
#| msgid "Editor files"
|
|
msgid "Editor Files"
|
|
msgstr "Súbory editora"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Dokončovanie identifikátora"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr "Otočiť"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Šikmé"
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Voľby editora"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgid "Misc"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr "Off"
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr "On"
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Podčiarknuté"
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Spýtať sa"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Poznámka: Projektové súbory sú všetky súbory v adresáre projektu"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Záloha"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Súbory"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Mriežka"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Jazyk"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagehint
|
|
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Pomocné čiary"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Rôzne"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Nič"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
#, fuzzy
|
|
#| msgid "Other files"
|
|
msgid "Other Files"
|
|
msgstr "Ostatné súbory"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
#, fuzzy
|
|
#| msgid "Project"
|
|
msgid "Tabs for project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra char spacing"
|
|
msgstr "Dodatočná medzera medzi znakmi"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Dodatočná medzera medzi riadkami"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgid "Use external gdb debug symbols file"
|
|
msgstr "Použiť externý súbor ladiacich symbolov gdb"
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Prípony súborov"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
msgid "%s files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Všetky súbory"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Nastavenia plochy Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
#, fuzzy
|
|
#| msgid "Lazarus File"
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr "Súbor Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr "Formulár Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr "Include súbor Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr "Balíček Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr "Projekt Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr "Zdrojový kód Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr "Jednotka Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr "Programy"
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "Súbory XML"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Nájsť text na kurzore"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
msgid "For/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedúra"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Jednotka"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr "Uses"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
msgid "While/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
msgid "With/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Farba popredia"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Pravidlá vkladania procedúr"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Zachovať poradie procedúr"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "Adresár zdrojových kódov FPC"
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Text-mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Editor formulára"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
#, fuzzy
|
|
#| msgid "&From Cursor"
|
|
msgid "&From cursor"
|
|
msgstr "&Od kurzora"
|
|
|
|
#: lazarusidestrconsts.dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Získať pozíciu"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Globálne"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Generovať kód pre gprof"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Farba zachytávača"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Farba mriežky"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Veľkosť mriežky X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Vodorovná veľkosť kroku mriežky"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Veľkosť mriežky Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Zvislá veľkosť kroku mriežky"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr "Codetools"
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Prostredie"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Skupinové späť"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Zobraziť pomocné čiary"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Farba guttera"
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Polovičný posun stránky"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
#, fuzzy
|
|
#| msgid "Heap Size"
|
|
msgid "Heap size"
|
|
msgstr "Veľkosť haldy"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Výška:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Pri spustení skryť okno IDE"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Zvýrazniť"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Font zvýraznenia"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Zobraziť rady pre nepoužitý parameter \"Sender\""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for unused units in main source"
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Zobraziť rady pre nepoužité jednotky v základnom zdrojovom súbore"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Home posúva na najbližší začiatok"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Hosťovská aplikácia"
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
#, fuzzy
|
|
#| msgid "Identifier completion"
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Dokončovanie identifikátorov"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Pravidlá identifikátora"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Vrátane systémových premenných"
|
|
|
|
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
|
msgid "Indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
msgid "Tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Pred metódy"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Meno konštruktora musí byť 'init' (deštruktor musí byť 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Vložiť medzeru za"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Vložiť medzeru pred"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Interval v sekundách"
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Skákanie (tj. Skákanie na metódy)"
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr "Ponechať X pozíciu kurzora"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Mapovanie klávesov"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Chyba mapovania klávesov"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Pravidlá kľúčových slov"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Povoliť LABEL a GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Jazyk"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Posledný (tj. na konci kódu)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Adresár Lazarus (predvolený pre všetky projekty)"
|
|
|
|
#: lazarusidestrconsts.dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Vľavo:"
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
#, fuzzy
|
|
#| msgid "Guid lines Left,Top"
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "farba ľavej a hornej"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
#, fuzzy
|
|
#| msgid "Level 1 (quick and debugger friendly)"
|
|
msgid "1 (quick, debugger friendly)"
|
|
msgstr "Úroveň 1 (rýchle a priateľské debugeru)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
#, fuzzy
|
|
#| msgid "3 (slow optimizations)"
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "Úroveň 3 (Úroveň 2 + pomalé optimalizácie)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
#, fuzzy
|
|
#| msgid "Level 0 (no extra optimizations)"
|
|
msgid "0 (no optimization)"
|
|
msgstr "Úroveň 0 (bez zvláštnych optimalizácií)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Rozdeľovanie riadkov"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
#, fuzzy
|
|
#| msgid "Link Smart"
|
|
msgid "Link smart"
|
|
msgstr "Smart linkovanie"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
#, fuzzy
|
|
#| msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Zobraziť čísla riadkov v behovom výpise chýb"
|
|
|
|
#: lazarusidestrconsts.dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Hlavné menu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
#, fuzzy
|
|
#| msgid "View project forms"
|
|
msgid "View Project Forms"
|
|
msgstr "Zobraziť formuláre projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
#, fuzzy
|
|
#| msgid "View project frames"
|
|
msgid "View Project Frames"
|
|
msgstr "Zobraziť rámce projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
#, fuzzy
|
|
#| msgid "View project units"
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Zobraziť jednotky projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Okraj a gutter"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Farba markera"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
msgid "Highlight of Word under Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
msgid "Outline (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Delete"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
msgid "Add Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
msgid "Remove Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
msgid "Toggle Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Meno"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Word Brackets on caret (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match word boundaries for words up to this length:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
msgid "Disable timer for markup current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maximum počítadla"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maximálna dĺžka riadka:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Maximum posledných súborov"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Maximum posledných projektov"
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Zmiešané metódy a vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "šípka vľavo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "šípka vpravo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Akcia"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgid "Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Akcia"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Poradie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr "Všetko"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
msgid "Overview Mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Výber"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.dlgmsgs
|
|
msgctxt "lazarusidestrconsts.dlgmsgs"
|
|
msgid "Messages"
|
|
msgstr "Správy"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Ladiť"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Upozorňovanie"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Multi-caret (column-select) move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Multi-caret move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi caret for column selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances
|
|
msgid "Multiple Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Viacnásobný výber"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Find Editor for Jump Targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Pomenovanie"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
#, fuzzy
|
|
#| msgid "no automatic renaming"
|
|
msgid "No automatic renaming"
|
|
msgstr "Bez automatického premenovania"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
#, fuzzy
|
|
#| msgid "Do not split line after:"
|
|
msgid "Do not split line after"
|
|
msgstr "Nerozdeľovať riadok za:"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
#, fuzzy
|
|
#| msgid "Do not split line In front of:"
|
|
msgid "Do not split line in front of"
|
|
msgstr "Nerozdeľovať riadok pred:"
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Inšpektor objektov"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
#, fuzzy
|
|
#| msgid "Item height"
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Výška položky"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Zaujímavé"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
#, fuzzy
|
|
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Ostatné súbory jednotiek (-Fu) (oddelené bodkočiarkou):"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Rady pre paletu komponentov"
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
#, fuzzy
|
|
#| msgid "Default pascal extension"
|
|
msgid "Default Pascal extension"
|
|
msgstr "Predvolená prípona Pascalu"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
msgid "Highlight control statements as keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
|
msgid "Extended Pascal Keyword Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
msgid "Markup (on caret)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
#, fuzzy
|
|
#| msgid "Pass options to linker (delimiter is space)"
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Poslať voľby linkovaču (oddeľovač je medzera)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
msgid "Highlight \"String\" keyword(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Predvolené"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Žiadne"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr "Trvylý kurzor"
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Aplikácia"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
#, fuzzy
|
|
#| msgid "Clear Icon"
|
|
msgid "&Clear Icon"
|
|
msgstr "Zmazať ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Vytvoriť zväzok aplikácií"
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formuláre"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr "i18n"
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Ikona:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(veľkosť: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr "(žiadne)"
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
#, fuzzy
|
|
#| msgid "Load Icon"
|
|
msgid "&Load Icon"
|
|
msgstr "Načítať ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Zaujímavé"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
#, fuzzy
|
|
#| msgid "Save Icon"
|
|
msgid "&Save Icon"
|
|
msgstr "Uložiť ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Relácia"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Titulok:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
#, fuzzy
|
|
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Použiť zväzok aplikácií pre spustenie a ladenie (lem darwin)"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
#, fuzzy
|
|
#| msgid "Use manifest file to enable themes"
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Použiť súbor manifestu, pre zapnutie tém (len Windows)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Voľby projektu"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
msgid "Options for Project: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
#, fuzzy
|
|
#| msgid "Project files"
|
|
msgid "Project Files"
|
|
msgstr "Súbory projektu"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
#, fuzzy
|
|
#| msgid "&Prompt On Replace"
|
|
msgid "&Prompt on replace"
|
|
msgstr "&Spýtať sa pri nahradení"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Dokončovanie vlastností"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Meno vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
#, fuzzy
|
|
#| msgid "Open last project at start"
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Pri spustení otvoriť posledný projekt"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Zobraziť border spacing"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Zobraziť mriežku"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Prichytiť k mriežke"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Odkazy"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
#, fuzzy
|
|
#| msgid "Regular E&xpressions"
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Regulárne výrazy"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "N&ahradiť všetko"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
#, fuzzy
|
|
#| msgid "&Replace With"
|
|
msgid "&Replace with"
|
|
msgstr "Na&hradiť s"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Hlásenie"
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
#, fuzzy
|
|
#| msgid "color for right, bottom"
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "farba pravej a dolnej"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
#, fuzzy
|
|
#| msgid "Right Click selects"
|
|
msgid "Right click selects"
|
|
msgstr "Kliknutie pravým vyberá"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Pravý okraj"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Pracovný adresár"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
#, fuzzy
|
|
#| msgid "Creation"
|
|
msgid "Rubberband Creation"
|
|
msgstr "Vytváranie"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
#, fuzzy
|
|
#| msgid "Selection"
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Výber"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Zobraziť (nie pre Win32, napr. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Prostredie"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokálne"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Systémové premenné"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Použiť displej"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Používateľské prepisuje"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
#, fuzzy
|
|
#| msgid "Run parameters"
|
|
msgid "Run Parameters"
|
|
msgstr "Parametre spustenia"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Uložiť informácie editora pre zatvorené súbory"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Uložiť informácie editora len pre súbory projektu"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Posunúť o jedno"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Zobraziť rady posunu"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Rolovať za koniec súboru"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
#, fuzzy
|
|
#| msgid "Scroll past end of line"
|
|
msgid "Caret past end of line"
|
|
msgstr "Rolovať za koniec riadka"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Hľadanie prerušené používateľom."
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
#, fuzzy
|
|
#| msgid "Searching..."
|
|
msgid "Searching ..."
|
|
msgstr "Hľadanie ..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Cesty"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
#, fuzzy
|
|
#| msgid "&Selected Text"
|
|
msgid "&Selected text"
|
|
msgstr "&Vybratý text"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktop
|
|
msgid "Set active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Nastaviť všetky prvky na predvolené"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Nastaviť prvok na predvolené"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Premenná nastavenia vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of non-visual components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Zobraziť preložené procedúry"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Zobraziť čísla riadkov"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Zobraziť podmienky"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Zobraziť ladiace informácie"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Zobraziť všetko"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Zobraziť informácie o spustiteľnom súbore (len Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Zobraziť všeobecné informácie"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Zobraziť panel pokynov"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
#, fuzzy
|
|
#| msgid "Show Hints"
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Zobraziť rady"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Zobraziť čísla riadkov"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
#, fuzzy
|
|
#| msgid "Show Notes"
|
|
msgid "Show notes"
|
|
msgstr "Zobraziť poznámky"
|
|
|
|
#: lazarusidestrconsts.dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Zobraziť súhrn"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Zobraziť spracovávané súbory"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Zobraziť použité jednotky"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
#, fuzzy
|
|
#| msgid "Show Warnings"
|
|
msgid "Show warnings"
|
|
msgstr "Zobraziť upozornenia"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Symbol za (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Počítadlo (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Symbol pred (.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Prichytiť k pomocným čiaram"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Medzera"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Rady pre základné tlačítka (Otvoriť, Uložiť, ...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedit
|
|
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
|
msgid "Source Editor"
|
|
msgstr "Editor kódu"
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Originál"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstatickeyword
|
|
#, fuzzy
|
|
#| msgid "Static Keyword in Objects"
|
|
msgid "Static keyword in objects"
|
|
msgstr "V objektoch kľúčové slovo Static"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Zastaviť po počte chýb:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr "Podvlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Voľby syntaxe"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tabulátor odsadzuje blok"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tabulátory na medzery"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Šírka tabulátora"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "Cieľová rodina CPU"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Cieľový OS"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
#, fuzzy
|
|
#| msgid "Target Platform"
|
|
msgid "Target platform"
|
|
msgstr "Cieľová platforma:"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Cieľový procesor"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Adresár pre vybudovanie testovacích projektov"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
#, fuzzy
|
|
#| msgid "&Text to Find"
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "&Text to find"
|
|
msgstr "&Hľadaný text"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktop
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Hore:"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Odstrániť zvyšné medzery"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Späť po uložení"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Limit vrátenia"
|
|
|
|
#: lazarusidestrconsts.dlgunitdepcaption
|
|
#, fuzzy
|
|
#| msgid "Unit dependencies"
|
|
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Závislosti jednotky"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Obnoviť"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Výstupný adresár jednotky (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
#, fuzzy
|
|
#| msgid "Code folding"
|
|
msgid "Code Folding"
|
|
msgstr "Skladanie kódu"
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
#, fuzzy
|
|
#| msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Použiť štandardný konfiguračný súbor prekladača (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Použiť spúšťaciu aplikáciu"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "Use (and edit) global scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
msgid "Use local scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Použiť zvýrazňovanie syntaxe"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Hodnota"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Výrečnosť počas prekladu"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Viditeľný gutter"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Viditeľný pravý okraj"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
#, fuzzy
|
|
#| msgid "&Whole Words Only"
|
|
msgid "&Whole words only"
|
|
msgstr "Len &celé slová"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Šírka:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Aplikácia Win32 GUI"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Okno"
|
|
|
|
#: lazarusidestrconsts.dlgwinpos
|
|
#, fuzzy
|
|
#| msgid "Window Positions"
|
|
msgid "Window positions"
|
|
msgstr "Pozície okna"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Slová"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Ukážka"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
#, fuzzy
|
|
#| msgid "Write an FPC logo"
|
|
msgid "Write FPC logo"
|
|
msgstr "Zapísať logo FPC"
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Viacnásobný výber komponentov musí byť na jednom formulári."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
#, fuzzy
|
|
#| msgid "Delete selection"
|
|
msgid "Delete Selection"
|
|
msgstr "Zmazať výber"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
#, fuzzy
|
|
#| msgid "Mirror horizontal"
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Preklopiť vodorovne"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
#, fuzzy
|
|
#| msgid "Mirror vertical"
|
|
msgid "Mirror Vertical"
|
|
msgstr "Preklopiť zvislo"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
#, fuzzy
|
|
#| msgid "Back one"
|
|
msgid "Back One"
|
|
msgstr "Späť o jedna"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
#, fuzzy
|
|
#| msgid "Forward one"
|
|
msgid "Forward One"
|
|
msgstr "Dopredu o jedno"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
#, fuzzy
|
|
#| msgid "Move to back"
|
|
msgid "Move to Back"
|
|
msgstr "Posunúť na koniec"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
#, fuzzy
|
|
#| msgid "Move to front"
|
|
msgid "Move to Front"
|
|
msgstr "Posunúť na začiatok"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
#, fuzzy
|
|
#| msgid "Save form as XML"
|
|
msgid "Save Form as XML"
|
|
msgstr "Uložiť formulár ako XML"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Mierka"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrať všetky"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Veľkosť"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Voľba: Prichytiť k mriežke"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Voľba: Prichytiť k pomocným čiaram"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnclearhint
|
|
msgid "Clear all snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnenablehint
|
|
msgid "Toggle view snapshot or current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
|
msgid "Take Snapshot"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnpowerhint
|
|
msgid "Switch on/off automatic snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnremovehint
|
|
msgid "Remove selected entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
|
msgid "View history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
|
msgid "View Snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumnloc
|
|
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
|
|
msgid "Location"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumntime
|
|
msgid "Time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgformname
|
|
msgctxt "lazarusidestrconsts.histdlgformname"
|
|
msgid "History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Pridať súbory"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfilestopackage
|
|
#, fuzzy
|
|
#| msgid "Add files to package"
|
|
msgid "Add Files to Package"
|
|
msgstr "Pridať súbory do balíčka"
|
|
|
|
#: lazarusidestrconsts.lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Pridať do balíčka"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Nejednoznačný typ predka"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Nejednoznačné meno triedy"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Nejednoznačné meno jednotky"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Typ predka"
|
|
|
|
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
|
#, fuzzy
|
|
#| msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Porušené závislosti"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Meno triedy už existuje"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewfile
|
|
#, fuzzy
|
|
#| msgid "Create new file"
|
|
msgid "Create New File"
|
|
msgstr "Vytvoriť nový súbor"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewreq
|
|
msgid "Create New Requirement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Závislosť"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
msgid "Existing file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Súbor už existuje"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Súbor je používaný"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr "Meno súboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Súbor nie je jednotka"
|
|
|
|
#: lazarusidestrconsts.lisa2piconandsize
|
|
msgid "Icon (maximum 24x24):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Neplatný typ predka"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Neplatné meno triedy"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Neplatný súbor"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Neplatné meno súboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Neplatné meno jednotky"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid unit name."
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "%s%s%s nie je platné meno jednotky."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Meno novej triedy:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewcomponent
|
|
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nový komponent"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Nový súbor"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, fuzzy,badformat
|
|
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Nenájdený balíček pre závislosť %s%s%s.%sProsím zvoľte existujúci balíček."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Meno balíčka veľmi dlhé"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr "Stránky palety:"
|
|
|
|
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Jednotka pascalu musí mať príponu .pp alebo .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr "Dialóg uloženia súboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Skrátené alebo úplné meno súboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Zobraziť všetko"
|
|
|
|
#: lazarusidestrconsts.lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Prepnúť cesty"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Typ predka %s%s%s má rovnaké meno ako %sjednotka %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Typ predka %s%s%s nie je platný identifikátor Pascalu."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Meno triedy %s%s%s a typ predka %s%s%s sú rovnaké."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Meno triedy %s%s%s už existuje v %sBalíčku %s%sSúbor: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Meno triedy %s%s%s má rovnaké meno triedy ako %sjednotka %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Meno triedy %s%s%s nie je platný identifikátor Pascalu."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Súbor %s%s%s je časťou aktuálneho projektu.%sNie je dobrý nápad zdieľať súbory medzi projektmi a balíčkami."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
#, fuzzy,badformat
|
|
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Meno súboru %s%s%s je neplatné, pretože balíček zatiaľ nemá predvolený adresár.%sProsím zadajte meno súboru s úplnou cestou."
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
|
#, fuzzy,badformat
|
|
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maximálna verzia %s%s%s je neplatná.%sProsím použite formát major.minor.release.build%sNapríklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximálna verzia je menšia ako Minimálna verzia."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
|
#, fuzzy,badformat
|
|
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimálna verzia %s%s%s je neplatná.%sProsím použite formát major.minor.release.build%sNapríklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, fuzzy,badformat
|
|
#| msgid "The package already has a dependency on the package %s%s%s."
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Balíček už má závislosť na balíčku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, fuzzy,badformat
|
|
#| msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Meno strany %s%s%s je príliš dlhé (max 100 znakov)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Meno jednotky %s%s%s už existuje v balíčku:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in this package."
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "Meno jednotky %s%s%s už v tomto balíčku existuje."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Meno jednotky %s%s%s%sa meno súboru %s%s%s sú rôzne."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgid "The unit name \"%s\" does not correspond to the filename."
|
|
msgstr "Meno jednotky %s%s%s nezodpovedá menu súboru."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Meno jednotky %s%s%s je rovnaké ako meno registrovaného komponentu.%sTakéto použitie môže spôsobiť nezvyklé chybové správy."
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Meno súboru jednotky:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Meno jednotky:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Meno jednotky už v existuje"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Neplatné meno jednotky"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Zahodiť zmeny?"
|
|
|
|
#: lazarusidestrconsts.lisabort
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisabort"
|
|
msgid "Abort"
|
|
msgstr "Zrušiť"
|
|
|
|
#: lazarusidestrconsts.lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Zrušiť všetko"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Zrušiť všetky načítania"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Zrušiť načítanie projektu"
|
|
|
|
#: lazarusidestrconsts.lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr "Zrušiť celé načítanie"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
msgid "About %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentácia:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "O Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
#, fuzzy
|
|
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr "Licencia: GPL/LGPL%sLazarus je IDE pre tvorbu (grafických a konzolových) aplikácií pomocou Free Pascal. Free Pascal je (L)GPL Pascal a Object Pascal prekladač, ktorý beží vo Windows, Linux, Mac OS X, FreeBSD a iných.%sLazarus je chýbajúca časť skladačky, ktorá umožní vyvýjať programy pre všetky vyššie spomínané platformy v prostredí podobnom Delphi. IDE je RAD nástroj, ktorý zahŕňa návrhára formulárov.%sKeďže Lazarus narastá, potrebujeme viac vývojárov."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Nemôžem nájsť zoznam spolupracovníkov."
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr "Oficiálne:"
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
#, fuzzy
|
|
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
|
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
|
msgstr "%s nemôže uchovávať TControls.%sMôžete do nej vložiť len nevizuálne komponenty."
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Poďakovanie"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactions
|
|
msgid "Actions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Aktivuje syntax regulárnych výrazov pre text a nahradzovanie (presne ako perl)"
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktívny filter"
|
|
|
|
#: lazarusidestrconsts.lisadd
|
|
msgctxt "lazarusidestrconsts.lisadd"
|
|
msgid "Add"
|
|
msgstr "Pridať"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilesindirectory
|
|
msgid "Add Files in Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr "Pridať novú množinu"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject
|
|
msgid "Add package %s to project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddress
|
|
msgid "Address:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddressbreakpoint
|
|
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
|
msgid "&Address Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "Pridať %s do projektu?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
msgid "Add value to macro %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
#, fuzzy
|
|
#| msgid "Add file to a package"
|
|
msgid "Add File to Package"
|
|
msgstr "Pridať súbor do balíčka"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
#, fuzzy
|
|
#| msgid "Destination Package"
|
|
msgid "Destination package"
|
|
msgstr "Cieľový balíček"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
#, fuzzy
|
|
#| msgid "File Type"
|
|
msgid "File type"
|
|
msgstr "Typ súboru"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Neplatný balíček"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, fuzzy,badformat
|
|
#| msgid "Invalid package ID: %s%s%s"
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Neplatný ID balíčka: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Balíček je len na čítanie"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s not found."
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Balíček %s%s%s nenájdený."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
#, fuzzy
|
|
#| msgid "Show All"
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Zobraziť všetko"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Balíček %s je len na čítanie."
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
#, fuzzy,badformat
|
|
#| msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgid "A file \"%s\" already exists.%sReplace it?"
|
|
msgstr "Súbor %s%s%s už existuje.%sNahradiť ho?"
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Zarovnanie"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
#, fuzzy
|
|
#| msgid "All blocks looks ok."
|
|
msgid "All blocks look ok."
|
|
msgstr "Všetky bloky vyzerajú OK."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
msgid "All Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr "Povoliť Function Calls"
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Dovoliť hľadanie na viacerých riadkoch"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
#, fuzzy,badformat
|
|
#| msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr "Všetky úpravy v %s%s%s%sbudú stratené a súbor bude znova otvorený."
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr "Alternatívny kláves"
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr "Alternatívny kláves (ale postupnosť dvoch)"
|
|
|
|
#: lazarusidestrconsts.lisalways
|
|
msgid "Always"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Nájdený nejednoznačný súbor"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, fuzzy,badformat
|
|
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Nájdený nejednoznačný súbor: %s%s%s%sTento súbor môže byť poškodený %s%s%s%s%sZmazať nejednoznačný súbor?"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Nájdený nejednoznačný súbor"
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
#, fuzzy
|
|
#| msgid "Ambiguous Unit found"
|
|
msgid "Ambiguous unit found"
|
|
msgstr "Nájdená nejednoznačná jednotka"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Editor ukotvenia - nevybratý prvok"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
msgid "Anchors of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Ukotvenia vybratých prvkov"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
#, fuzzy,badformat
|
|
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr "Pri poslednom štarte nastala chyba pri otváraní %s!%s%sOtvoriť projekt znova?"
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr "Meno triedy &Aplikácie"
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Použiť"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr "použiť príznaky budovania (-B) aj pre závislosti"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Okraj okolo prvku. Ostatné štyri okraje sú pridané k tejto hodnote."
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Spýtať sa pred nahradením nájdeného textu"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
|
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocheckmodifiedfiles
|
|
msgid "Automatically check (select) modified files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocontinueafter
|
|
msgid "Auto continue after:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr "koniec riadka"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "medzera"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "koniec slova"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
#, fuzzy
|
|
#| msgid "Automatic features"
|
|
msgid "Completion and Hints"
|
|
msgstr "Automatické vlastnosti"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Automaticky zobratiť Inšpektor objektov"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Záložný súbor zlyhal"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Zmena mena alebo verzie balíčka poruší závislosti. Majú byť zmenené aj tieto závislosti?%sZvoľte Áno pre zmenu všetkých zobrazených závislostí.%sZvoľte Ignorovať pre zrušenie závislostí a pokračovanie."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "začína"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "be less verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "be more verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
#, fuzzy
|
|
#| msgid "Always Build before Run"
|
|
msgid "Always build before run"
|
|
msgstr "Pred spustením vždy vybudovať"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Príkaz Vybudovať"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Na vybudovanie projektu spusťte príkaz Vybudovať súbor"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Na spustenie projektu spusťte príkaz Spustiť súbor"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Príkaz spustiť"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
#, fuzzy
|
|
#| msgid "When this file is active in source editor ..."
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Keď je tento súbor aktívny v editore ..."
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
#, fuzzy
|
|
#| msgid "Working directory (Leave empty for file path)"
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Pracovný adresár (prázdne pre cestu súboru)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Zmenené hodnoty tučne"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
#, fuzzy
|
|
#| msgid "BorderSpace"
|
|
msgid "Border space"
|
|
msgstr "Medzera okraja"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dole"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Spodný okraj. Táto hodnota je pridaná k základnému okraju a použitá pre medzeru pod prvkom."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Spodné ukotvenie"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Spodné okraje"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto je súrodenec prvku, ku ktorého spodnej strane je ukotvený. Ponechajte prázdne pre rodiča."
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Rovnaká spodná medzera"
|
|
|
|
#: lazarusidestrconsts.lisbreak
|
|
msgctxt "lazarusidestrconsts.lisbreak"
|
|
msgid "Break"
|
|
msgstr "Zalomiť"
|
|
|
|
#: lazarusidestrconsts.lisbreakpointproperties
|
|
msgid "Breakpoint Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnadd
|
|
msgctxt "lazarusidestrconsts.lisbtnadd"
|
|
msgid "&Add"
|
|
msgstr "&Pridať"
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Zatvoriť"
|
|
|
|
#: lazarusidestrconsts.lisbtndelete
|
|
msgctxt "lazarusidestrconsts.lisbtndelete"
|
|
msgid "&Delete"
|
|
msgstr "&Zmazať"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgadd
|
|
msgid "&Add ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "Na&hradiť ..."
|
|
|
|
#: lazarusidestrconsts.lisbtnenabled
|
|
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
|
msgid "&Enabled"
|
|
msgstr "&Povolené"
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
#, fuzzy
|
|
#| msgid "Quit"
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "Skončiť"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Odstrániť"
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Vybudovať"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr "vybudovať všetky súbory projektu/balíčka/IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Vybudovať"
|
|
|
|
#: lazarusidestrconsts.lisbuildfollowingmodes
|
|
msgid "Build the following modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr "vybudovať IDE aj s balíčkami"
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
msgid "Build Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
|
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Vybudovať nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
#, fuzzy
|
|
#| msgid "Build Number"
|
|
msgid "Build number"
|
|
msgstr "Číslo vybudovania"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Vybudovať"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
msgid "%s byte"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr "Volanie %s na vytvorenie Makefile z %s zlyhalo."
|
|
|
|
#: lazarusidestrconsts.liscallstacknotevaluated
|
|
msgid "Stack not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancel
|
|
msgctxt "lazarusidestrconsts.liscancel"
|
|
msgid "Cancel"
|
|
msgstr "Zrušiť"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Zrušiť načítanie tohoto komponentu"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Zrušiť načítanie jednotky"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Zrušiť premenovanie"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
#, fuzzy
|
|
#| msgid "Can not copy top level component."
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Namôžete kopírovať najvyšší komponent"
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Cannot create file %s%s%s"
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Nemožno vytvoriť súbor %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
msgid "cannot execute \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
msgid "Cannot find %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
#, fuzzy
|
|
#| msgid "Cannot find lazarus starter:%s%s"
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Nemožno nájsť spúšťač Lazarus: %s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotfindunit
|
|
msgid "Cannot find unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Zmeniť možno len triedu TComponents"
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
msgid "%s (%s files)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr "Zmeniť triedu %s"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "žiadna trieda"
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Nejednoznačný prekladač"
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
#, fuzzy
|
|
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr "Prosím skontrolujte testovací adresár v %sProstredie -> Voľby prostredia -> Súbory -> Adresár pre budovanie testovacích projektov"
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Prekladač \"%s\" nie je spustiteľný súbor.%sDetaily: %s"
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "obsahuje "
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Kopírovať výstup do do schránky"
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
#, fuzzy
|
|
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr "Dátumy .ppu·súborov FPC sú rozdielne o viac ako hodinu.%sTo môže znamenať, že sú z rôznych inštalácií.%sSúbor1: %s%sSúbor2: %s"
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "CHYBA:"
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr "Cesta k jednotkám FPC so zdrojovým kódom"
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "symboly nového riadka"
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "RADA:"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Neplatný prekladač"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Neplatná cesta hľadania"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Neplatný testovací adresár"
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Chýbajúca jednotka"
|
|
|
|
#: lazarusidestrconsts.lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr "Preložená jednotka FPC nenájdená: %s.ppu"
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "nájdené viaceré konfigurácie prekladača:"
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "fpc.cfg nenájdený"
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "nie je ASCII"
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu existuje dvakrát: %s, %s"
|
|
|
|
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr "Preložená jednotka FPC %s.ppu nebola nájdená.%sToto zvyčajne znamená, že Váš fpc.cfg obsahuje chybu alebo je Vaša inštalácia FPC poškodená."
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Existujúci súbor .ppu je starší ako prekladač samotný:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgid "Skip"
|
|
msgstr "Preskočiť"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "špeciálne znaky"
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Všetky testy úspešné."
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr "textového vytvoriť testovací súbor"
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
#, fuzzy
|
|
#| msgid "Unable to create Test pascal file \"%s\"."
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr "textového vytvoriť testovací pascalovský súbor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "nezvyčajné znaky"
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Upozorňovanie"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "UPOZORNENIE:"
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "zlý oddeľovač cesty"
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Kategórie"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Konštanty"
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
#, fuzzy
|
|
#| msgid "(Filter)"
|
|
msgid "(filter)"
|
|
msgstr "(Filter)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Nasledovať kurzor"
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
msgctxt "lazarusidestrconsts.liscein"
|
|
msgid "%s in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Zobraziť kategórie"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr "Zobraziť uzly zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
#, fuzzy
|
|
#| msgid "Center control horizontally relative to the given sibling"
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Centrovať prvky vodorovne, relatívne k daným súrodencom"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
#, fuzzy
|
|
#| msgid "Center control vertically relative to the given sibling"
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Centrovať·prvky·zvislo,·relatívne·k·daným·súrodencom"
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Centrovať v okne"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Stredy"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
#, fuzzy
|
|
#| msgid "Preferred Exhibition Mode"
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Preferovaný ukážkový režim"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr "Kategória"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Zdrojový kód"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Nikdy, len manuálne"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Použiteľné len v režime kategórie"
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Pri nečinnosti"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Obnoviť automaticky"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Ostatné"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Aktualizovať"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Pri prepínaní súboru v editore"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Procedúry"
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr "Vlastnosti"
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Štýl"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr "Typy"
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr "Uses"
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Premenné"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
|
msgid "Cancel loading this resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeclassnotfound
|
|
msgid "%s%sClass \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponent
|
|
msgid "%s%sComponent: %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponentclass
|
|
msgid "%s%sComponent Class: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecontinueloading
|
|
msgid "Continue loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorreading
|
|
msgid "Error reading %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
msgid "In file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscferoot
|
|
msgid "%sRoot=%s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestopallloading
|
|
msgid "Stop all loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestream
|
|
msgid "%sStream=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestreamposition
|
|
msgid "%s%sStream position: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Zmeniť"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Zmeniť triedu"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Zmeniť kódovanie"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr "Zmeniť súbor"
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
#, fuzzy
|
|
#| msgid "Change Parent..."
|
|
msgid "Change Parent"
|
|
msgstr "Zmeniť rodiča ..."
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaracter
|
|
msgid "Character"
|
|
msgstr "Znak"
|
|
|
|
#: lazarusidestrconsts.lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Mapa znakov"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr "Skontrolovať voľby"
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Zvoľte iné meno"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr "Zvoľte odkaz FPDoc"
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr "Zvoľte kláves..."
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Zvoliť jednotku Delphi (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Zvoľte adresár"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Vyberte adresár zdrojových kódov FPC"
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Vyberte adresár Lazarus"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosename
|
|
msgid "Choose name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Zvoľte položku pre vytvorenie nového súboru"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Zvoľte položku pre vytvorenie nového balíčka"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Zvoľte položku pre vytvorenie nového projektu"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr "Zvoľte jednu z týchto položiek, z ktorej bude dedené"
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Zvoľte zdrojový kód programu (*.pp, *.pas, *.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Zvoľte štruktúru pre uzavretie výberu"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
#, fuzzy,badformat
|
|
#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr "Trieda %s%s%s nie je triedou registrovaného komponenta.%sNemožno vložiť."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Trieda nenájdená"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Class %s%s%s of method %s%s%s not found."
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr "Nenájdená trieda %s%s%s metódy %s%s%s."
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Vyčistiť adresár"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Vyčistiť podadresáre"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Ponechať všetky textové súbory"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Ponechať všetky súbory vyhovujúce filtru"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Odstrániť súbory vyhovujúce filtru"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Jednoduchá syntax (napr. * namiesto .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleancommonfiles
|
|
msgid "Clean common files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Vyčistiť zdrojové kódy Lazarus"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Vyčistiť cestu jednotky?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Vymazať"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr "Vyčistiť adresár?"
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "Pre prehľadávanie súboru kliknite tu"
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
#, fuzzy
|
|
#| msgid "&Close"
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "&Zatvoriť"
|
|
|
|
#: lazarusidestrconsts.liscloseall
|
|
msgctxt "lazarusidestrconsts.liscloseall"
|
|
msgid "Close All"
|
|
msgstr "Zatvoriť všetko"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Špecifické voľby rozhrania LCL:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parameter"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponenty"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Dedičnosť"
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr "Zoznam"
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paleta"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Nejednoznačný dodatočný konfiguračný súbor prekladača"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Volať na:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
#, fuzzy
|
|
#| msgid "%s%sClick OK if you are sure to do that."
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKliknite na OK, ak ste si istí vykonaním."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Príkaz:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
#, fuzzy
|
|
#| msgid "Code browser"
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
msgid "Class section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr "Voľby generovania kódu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Pridať cestu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Prezerať"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Potvrdiť nahradenie"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Vytvoriť položku pomoci"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Odstrániť cestu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr "Popis"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Chyby"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Príklad"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Vložiť formátovaciu značku pre kód"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Vložiť formátovaciu značku pre kurzívu"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Vložiť formátovaciu značku poznámky"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Vložiť formátovaciu značku pre podčiarknuté"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Vložiť formátovaciu značku var"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Zdedené"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Vložiť odkaz ..."
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Vložiť značku formátovania odseku"
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
#, fuzzy
|
|
#| msgid "FPDoc editor"
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Editor·FPCDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr "(nenájdený zdedený popis)"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<NIČ>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Pozri aj"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Krátky popis"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Krátky"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
#, fuzzy
|
|
#| msgid "Add"
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Pridať"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Pridať šablónu kódu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
#, fuzzy,badformat
|
|
#| msgid " A token %s%s%s already exists! "
|
|
msgid " A token \"%s\" already exists! "
|
|
msgstr "Token %s%s%s už existuje!"
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
#, fuzzy
|
|
#| msgid "Auto complete on ..."
|
|
msgid "Auto complete on"
|
|
msgstr "Automatické dokončovanie na ..."
|
|
|
|
#: lazarusidestrconsts.liscodetemplchange
|
|
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
|
msgid "Change"
|
|
msgstr "Zmeniť"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentár:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Upraviť šablónu kódu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Akcia: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, fuzzy
|
|
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Automaticky vytvorené uzly nemôžu byť upravované,%sani nemôžu mať neautomaticky vytvorené podriadené uzly"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, auto generované"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
#, fuzzy
|
|
#| msgid "Auto generated nodes can not be edited."
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Automaticky generované uzly nemôžu byť upravované."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Editor definícií CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
#, fuzzy
|
|
#| msgid "compiler path"
|
|
msgid "Compiler path"
|
|
msgstr "cesta prekladača"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Konvertovať uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Vytvoriť definície pre adresár %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Vytvoriť definície pre prekladač FreePascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr "Vytvoriť definície pre Vytvoriť definície pre FreePascal "
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Vytvoriť definície pre projekt %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Vytvoriť FPC makrá a cesty pre adresár projektu fpc"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Definovať"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Definovať rekurzívne"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Zmazať uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Popis:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "%s adresár"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Skončiť bez uloženia"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr "SVN Adresár zdrojových kódov FPC"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Adresár"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Vložiť šablónu prekladača Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Vložiť šablónu adresára Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Vložiť šablónu projektu Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Vložiť šablónu prekladača Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Vložiť šablónu adresára Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Vložiť šablónu projektu Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Vložiť šablónu prekladača Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Vložiť šablónu adresára Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Vložiť šablónu projektu Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Vložiť šablónu prekladača FreePascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Vložiť šablónu projektu FreePascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr "Vložiť šablónu SVN zdroja FreePascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Vložiť šablónu prekladača Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Vložiť šablónu adresára Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Vložiť šablónu projektu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Vložiť podriadený uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Vložiť uzol pod"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Vložiť šablónu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Neplatný rodič"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Neplatný rodičovský uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Neplatný predchádzajúci uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Posunúť uzol nižšie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Posunúť uzol o úroveň nižšie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Posunúť uzol o úroveň vyššie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Posunúť uzol vyššie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Meno:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Nový uzol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Uzol je len na čítanie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "nevybraté"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
#, fuzzy
|
|
#| msgid "Parent node can not contain child nodes."
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Rodičovský uzol nemôže obsahovať podriadené uzly"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Predchádzajúci uzol nemôže obsahovať vnorené uzly."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Adresár projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "%s adresár projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Chyba čítania"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Uložiť a skončiť"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Zvolený uzol:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
#, fuzzy
|
|
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr "Zdrojový adresár Free Pascal SVN. nevyžadované, ale zlepšuje hľadanie deklarácií a ladenie."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Adresár projektu Free Pascal."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr "Zdrojový adresár Free Pascal SVN."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
#, fuzzy
|
|
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Cesta k prekladaču Free Pascal.%s Napríklad %s/usr/bin/%s -n%s alebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
#, fuzzy
|
|
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr "Cesta prekladača Free Pascal pre tento projekt. Vyžadované len ak nastavíte FPC SVN zdroj nižšie. Použité pre makrá autocreate."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
#, fuzzy,badformat
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "Adresár projektu %s, ktorý obsahuje súbory .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Zrušiť definíciu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Zrušiť všetky definície"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Zrušiť definíciu rekurzívne"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Hodnota ako text"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Premenná:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Chyba zápisu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Na"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Stĺpec"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Čiarka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identifikátor"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Kľúčové slovo"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nový riadok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Žiadne"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Číslo"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Bod"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Bodkočiarka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Medzerník"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Reťazcová konšt."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Spustiť po"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Spustiť pred"
|
|
|
|
#: lazarusidestrconsts.liscoladdress
|
|
msgid "Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolclass
|
|
msgid "Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
msgid "Collapse All (/)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Zbaliť všetky triedy"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Zbaliť všetky balíčky"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Zbaliť všetky jednotky"
|
|
|
|
#: lazarusidestrconsts.liscolreturns
|
|
msgid "Returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolvisibility
|
|
msgid "Visibility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafter
|
|
msgid "Command after"
|
|
msgstr "Príkaz po"
|
|
|
|
#: lazarusidestrconsts.liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr "Príkaz za neplatným"
|
|
|
|
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Príkaz po publikovaní modulu"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Parametre príkazového riadka"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Parametre príkazového riadka programu"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Preložiť"
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Prekladač"
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Chyba: neplatný prekladač: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Meno súboru prekladača"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
#, fuzzy
|
|
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Rada: cestu prekladača môžete nastaviť v Prostredie->Voľby prostredia->Súbory->Cesta prekaldača"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "Poznámka: Nenájdený konfiguračýs úbor CodeTools - použité predvolené"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Poznámka: načítanie starého súboru volieb CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Preložiť"
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (prekladám ...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
|
msgid "Component name \"%s\" is a Pascal keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is keyword"
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Meno komponentu %s%s%s je kľúčové slovo"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is not a valid identifier"
|
|
msgid "Component name \"%s\" is not a valid identifier"
|
|
msgstr "Názov komponentu %s%s%s nie je platný identifikátor"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Otvoriť balíček"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Otvoriť jednotku"
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
#, fuzzy
|
|
#| msgid "Test"
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Podmienka"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Konfiguračný adresár Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr "Konfigurovať budovanie %s"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Potvrdiť zmeny"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
#, fuzzy,badformat
|
|
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Chcete prebudovať Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "Potvrdiť nastavenia nového balíčka pre IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Akcia"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Konzolová aplikácia"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr "Kód konštruktora"
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "obsahuje"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinue
|
|
msgctxt "lazarusidestrconsts.liscontinue"
|
|
msgid "Continue"
|
|
msgstr "Pokračovať"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Pokračovať bez načítania formulára"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Spolupracovníci"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Ovládací prvok musí mať rodiča"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
msgid " { *Converted from %s* }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
msgid "Deleted file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
msgid "Added defines %s in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
msgid "Conversion took: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
msgid "Error=\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
msgid "Omitted unit %s from project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
msgid "Units to replace in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Chyba konverzie"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Konvertovať"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
#, fuzzy
|
|
#| msgid "Convert encoding"
|
|
msgid "Convert Encoding"
|
|
msgstr "Konvertovať kódovanie"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr "Konvertovať kódovanie projektov/balíčkov"
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Konvertovať projekt alebo balíček"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
msgid "Replaced call %s with %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
msgid "This log was saved to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Žiadne"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Šablóny kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Správy"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopy
|
|
msgctxt "lazarusidestrconsts.liscopy"
|
|
msgid "Copy"
|
|
msgstr "Kopírovať"
|
|
|
|
#: lazarusidestrconsts.liscopyall
|
|
msgid "Copy All"
|
|
msgstr "Kopírovať všetko"
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyalloutputclipboard
|
|
msgid "Copy all output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Chyba kopírovania"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Chyba kopírovania"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
msgid "Copy Filename %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Kopírovanie celého formulára nie je implementované"
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
#, fuzzy
|
|
#| msgid "Copy selected messages to clipboard"
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Kopírovať vybrané správy do schránky"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Hľadať správy FPC"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Hľadať správy Make"
|
|
|
|
#: lazarusidestrconsts.liscoscanformessages
|
|
msgid "Scan for messages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
#, fuzzy
|
|
#| msgid "Skip calling Compiler"
|
|
msgid "Skip calling compiler"
|
|
msgstr "Preskočiť volanie prekladača"
|
|
|
|
#: lazarusidestrconsts.liscouldnotadditomainsource
|
|
msgid "Could not add \"{$I %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
|
msgid "Could not add \"{$R %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
|
msgid "Could not add \"%s\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
|
msgid "Could not remove \"%s\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
|
msgid "Could not remove \"{$I %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
|
msgid "Could not remove \"{$R %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
#, fuzzy
|
|
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Upozornenie: Dodatočný konfiguračný súbor prekladača má rovnaké meno ako jeden zo štandardných mien konfiguračných súborov prekladača FreePascal. Toto môže mať za následok spracovanie dodatočného konfiguračného súboru a preskočenie štandardného."
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Otvoriť balíček %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Otvoriť jednotku %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
msgid ", CPU: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Najprv vytvorte projekt!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr "Vytvoriť adresár?"
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr "Vytvoriť uzol Pomoci"
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr "Vytvoriť v"
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
msgid "Create local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscsbottom
|
|
msgctxt "lazarusidestrconsts.liscsbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dole"
|
|
|
|
#: lazarusidestrconsts.liscstop
|
|
msgctxt "lazarusidestrconsts.liscstop"
|
|
msgid "Top"
|
|
msgstr "Hore"
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Zvoliť adresár"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Hodnoty adresárov CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definovať šablóny"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<premenná nezvolená>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Otvoriť ukážku"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Nástroje"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Premenná: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Meno premennej"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Šablóny"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "prosím vyberte makro"
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Vybrať makro kódu"
|
|
|
|
#: lazarusidestrconsts.liscurrent
|
|
msgctxt "lazarusidestrconsts.liscurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuálny"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Stĺpec kurzora v aktuálnom editore"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Riadok kurzora v aktuálnom editore"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "vlastné voľby"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Vlastné voľby"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Vlastný program"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscut
|
|
msgctxt "lazarusidestrconsts.liscut"
|
|
msgid "Cut"
|
|
msgstr "Vystrihnúť"
|
|
|
|
#: lazarusidestrconsts.lisdadattach
|
|
msgid "Attach"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadimagename
|
|
msgid "Image Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadpid
|
|
msgid "PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadrunningprocesses
|
|
msgid "Running Processes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Dátum"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdelete
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
|
msgid "Delete all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
|
msgid "Delete all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
|
msgid "Copy to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
|
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemexpression
|
|
msgid "&Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemnewvalue
|
|
msgid "&New value:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemresult
|
|
msgid "&Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
|
msgid "Delete"
|
|
msgstr "Delete"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
|
msgid "Enable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
|
msgid "Enable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Nie je zadaný debuger"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Nastaviť bod prerušenie hocikde"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
#, fuzzy
|
|
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Nie je definovaný debuger.%sNastavenie bodu prerušenia nemá význam, dokiaľ nenastavíte debuger v dialógu Voľby debugera v menu."
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpower
|
|
msgid "On/Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpowerhint
|
|
msgid "Disable/Enable updates for the entire window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Ladiť"
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Chyba debugera %sDebuger vstúpil do chybového stavu%sUložte svoju prácu!%sPoužite Stop, a dúfajte v najlepšie, we're pulling the plug."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
|
msgid "Debugger Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
|
msgid "Debugger Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
|
msgid "Debugger Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Neplatný debuger"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (ladím ...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Ďalšia prehľadávaná cesta"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Bod prerušenia"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Pri spustení zmazať záznam"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Všeobecné voľby debugera"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Špecifické voľby debugera (závisia na type debugera)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Záznam udalostí"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Obslúžené"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Obslúžené debugerom"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Obslúžené programom"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Ignorovať tieto výnimky"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Výnimky jazyka"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
#, fuzzy
|
|
#| msgid "Limit linecount to"
|
|
msgid "Limit line count to"
|
|
msgstr "Obmedziť počet riadkov na"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr "Modul"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Lazarus Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Výnimky OS"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Výstup"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proces"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Pokračovať"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr "Pokračovať obslúžené"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr "Pokračovať neobslúžené"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Zobraziť Správy pri zadstavení"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signály"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Vlákno"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Nemožno načítať súbor"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to load file %s%s%s."
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Nemožno načítať súbor %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisdecimal
|
|
msgctxt "lazarusidestrconsts.lisdecimal"
|
|
msgid "Decimal"
|
|
msgstr "Desiatkovo"
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Predvolené"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
|
msgid "Delay for hints and completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelete
|
|
msgctxt "lazarusidestrconsts.lisdelete"
|
|
msgid "Delete"
|
|
msgstr "Delete"
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "Z&mazať všetky "
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr "Zmazať všetky body prerušenia?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete all breakpoints in file %s%s%s?"
|
|
msgid "Delete all breakpoints in file \"%s\"?"
|
|
msgstr "Zmazať všetky body prerušenia v súbore %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr "Zmazať všetky v rovnakom zdroji"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr "Zmazať všetky vybraté body prerušenia"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Zmazať všetky tieto súbory?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Zmazať nejednoznačný súbor?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpoint
|
|
msgid "Delete Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr "Zmazať bod prerušenia na %s\"%s\" riadku %d?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
|
msgid "Delete breakpoint for address %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
|
msgid "Delete watchpoint for \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Zmazanie súboru zlyhalo"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
msgid "Delete mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old file %s%s%s?"
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Zmazať starý súbor %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr "Zmazať staré súbory?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr "Zmazať označené riadky"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
msgid "Delete value %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
#, fuzzy,badformat
|
|
#| msgid "Deleting of file %s%s%s failed."
|
|
msgid "Deleting of file \"%s\" failed."
|
|
msgstr "Mazanie súboru %s%s%s zlyhalo."
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Cieľový adresár"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr "Kód deštruktora"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Necitlivé na veľkosť"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Ignorovať prázdne riadky pri pridávaní a odstraňovaní"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Ignorovať rozdiely koncov riadkov (e.g. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Ignorovať niekoľko znakov medzery"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Ignorovať medzery (mimo znakov nového riadka)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Ignorovať medzery na konci riadka"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Ignorovať medzery na začiatku riadka"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Len výber"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
#, fuzzy
|
|
#| msgid "Open Diff in editor"
|
|
msgid "Open difference in editor"
|
|
msgstr "Otvoriť rozdiel v editore"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdigits
|
|
msgid "Digits:"
|
|
msgstr "Číslice:"
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Direktívy"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
msgid "directory %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotwritable
|
|
msgid "Directory not writable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablebreakpoint
|
|
msgid "Disable Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisabled
|
|
msgid "Disabled"
|
|
msgstr "Zakázané"
|
|
|
|
#: lazarusidestrconsts.lisdisablegroups
|
|
msgid "Disable Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassassembler
|
|
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Zahodiť zmeny"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Kliknite na jednu z položiek pre zobrazenie rozdielov"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Chyba čítania súboru: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Niektoré súbory boli na disku zmenené:"
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Rozoznávať veľké a malé písmená, napr. C a c"
|
|
|
|
#: lazarusidestrconsts.lisdlgadd
|
|
#, fuzzy
|
|
#| msgid "Add..."
|
|
msgctxt "lazarusidestrconsts.lisdlgadd"
|
|
msgid "Add ..."
|
|
msgstr "Pridať..."
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
#, fuzzy
|
|
#| msgid "Edit..."
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Upraviť ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Exportovať ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgsave
|
|
msgctxt "lazarusidestrconsts.lisdlgsave"
|
|
msgid "Save ..."
|
|
msgstr "Uložiť ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
#, fuzzy
|
|
#| msgid "%s does not exists: %s"
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s neexistuje: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
msgid "%sDo not check if another IDE instance is already running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Nezatvárať projekt"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr "neprekladať závislosti"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Nezobrazovať úvodnú obrazovku"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "Down"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Kresliť mriežku"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopírovať vybraté komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Vystrihnúť vybraté komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Presunúť komponent o jeden vzad"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Presunúť komponent o jeden vpred"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Presunúť komponent dozadu"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Presunúť komponent dopredu"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Vložiť vybraté komponenty zo schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Vybrať rodičovský komponent"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
#, fuzzy,badformat
|
|
#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr "Duplikované meno: Komponent pomenovaný %s%s%s už existuje v zdedených komponentoch %s"
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Upraviť"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr "Upraviť kontextovú pomoc"
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgid "Editor macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Všetky balíčky"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Aktuálny projekt"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Všetky projekty"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "nastaviť režim FPC na DELPHI"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr "nastaviť režim FPC na FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "nastaviť režim FPC na GPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr "nastaviť režim FPC na MacPas"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "nastaviť režim FPC na TP"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "zapnúť IOCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "zapnúť OVERFLOWCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "zapnúť RANGECHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "použiť jednotku HeapTrc"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "použiť jednotku LineInfo"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Platný nástroj musí mať aspoň titulok a meno súboru"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Upraviť Nástroj"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Kláves"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makrá"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametre:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Meno súboru programu:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
#, fuzzy
|
|
#| msgid "Scan output for Free Pascal Compiler messages"
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Vo výstupe hľadať správy FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
#, fuzzy
|
|
#| msgid "Scan output for make messages"
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Vo výstupe hľadať správy make"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Titulok a meno súboru sú vyžadované"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Pracovný adresár:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr "Všetko"
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
#, fuzzy
|
|
#| msgid "Emtpy Methods"
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr "Prázdne metódy"
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr "Nájdené prázdne metódy:"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr "Len published"
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr "Public"
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr "Published"
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr "Odstrániť metódy"
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr "Prehľadávať tieto sekcie triedy:"
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableall
|
|
msgid "&Enable All"
|
|
msgstr "Nastaviť vš&etky"
|
|
|
|
#: lazarusidestrconsts.lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr "Povoliť všetko v rovnakom zdroji"
|
|
|
|
#: lazarusidestrconsts.lisenablebreakpoint
|
|
msgid "Enable Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenabled
|
|
msgctxt "lazarusidestrconsts.lisenabled"
|
|
msgid "Enabled"
|
|
msgstr "Povolené"
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablegroups
|
|
msgid "Enable Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Zapnúť makrá"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenclose
|
|
msgid "Enclose"
|
|
msgstr "Uzavrieť"
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
#, fuzzy,badformat
|
|
#| msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr "Kódovanie súboru %s%s%s%sna disku je %s. Nové kódovanie je %s."
|
|
|
|
#: lazarusidestrconsts.lisendlessloopinmacros
|
|
msgid "Endless loop in macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Adresár nenájdený"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Neplatné meno debugera"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Súbor debugera \"%s\" nie je spustiteľný."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Testovací adresár \"%s\" nenájdený."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Neplatná voľba na pozícii %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Voľba na pozícii %d nedovoľuje argument: %s"
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Voľba na pozícii %d vyžaduje argument: %s"
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Chyba:"
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Chyba vytvárania súboru"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Chyba mazania súboru"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
msgid "Error in %s"
|
|
msgstr "Chyba v %s"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Chyba načítania súboru"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr "Chyba načítania %s z%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Chyba presúvania komponentu"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Chyba presúvania komponentu %s:%s"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr "Chyba otvorenia komponentu"
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Chyba analýzy toku komponentov lfm."
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Chyba čítania zoznamu balíčkov zo súboru %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr "Chyba čítania XML"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Error reading xml file %s%s%s%s%s"
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr "Chyba čítania XML súboru %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Chyba premenovania súboru"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Chyby"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
msgid ", Errors: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr "Chyba pri ukladaní %s do%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
msgid "Error writing file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Chyba zápisu zoznamu balíčkov do súboru%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisevalexpression
|
|
msgctxt "lazarusidestrconsts.lisevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevaluate
|
|
msgid "E&valuate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevaluatemodify
|
|
msgid "&Evaluate/Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogclear
|
|
msgid "Clear Events"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogoptions
|
|
msgid "Event Log Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogsavetofile
|
|
msgid "Save Events to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment
|
|
msgid "Add Comment ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment2
|
|
msgid "Add Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
#, fuzzy
|
|
#| msgid "Every n-th line number:"
|
|
msgid "Every n-th line number"
|
|
msgstr "Každé n-té číslo riadka:"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesbuildallselected
|
|
msgid "Build all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr "Príklady:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
|
|
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
|
msgid "Open first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexceptiondialog
|
|
msgid "Debugger Exception Notification"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
msgid "%s excluded at run time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Exclude Filter"
|
|
msgid "Exclude filter"
|
|
msgstr "Vylučovací filter"
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr "Vykonať príkaz po"
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr "Vykonať príkaz pred"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Vykonávanie zastavené"
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Skončiť"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
msgid "Exit code %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
msgid "Expand All (*)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Rozbaliť všetky triedy"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Rozbaliť všetky balíčky"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Rozbaliť všetky jednotky"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Úplné meno súboru aktuálneho súboru editora"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
#, fuzzy
|
|
#| msgid "Export ..."
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Exportovať ..."
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Exportovať zoznam"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpression
|
|
msgid "Expression:"
|
|
msgstr "Výraz:"
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
|
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
|
msgid "Extend include files search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludepath
|
|
msgid "Extend include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr "Rozšíriť cestu jednotky?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
|
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
|
msgid "Extend unit search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Oddeliť"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr "Oddeliť procedúru"
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
#, fuzzy
|
|
#| msgid "External tools"
|
|
msgid "External Tools"
|
|
msgstr "Externé nástroje"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Disahnuté maximum nástrojov"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Už tam je maximum z %s nástrojov."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr "Redukovať kreslenie návrhára"
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr "Kresliť položky návrhára len pri nečinnosti (redukuje zaťaženie per slabšie počítače)"
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "Súbor"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
|
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Súbor %s%s%s%snevyzerá ako textový súbor.%sOtvoriť ho i tak?"
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr "Prípona súboru programu"
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Súborový filter"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "Súbor nie je zapisovateľný"
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr "Súbor je symbolický odkaz"
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s is virtual."
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Súbor %s%s%s je virtuálny."
|
|
|
|
#: lazarusidestrconsts.lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr "Chyba linkovania súboru"
|
|
|
|
#: lazarusidestrconsts.lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr "Meno súboru/adresa"
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Súbor nenájdený"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%s"
|
|
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Súbor %s%s%s nenájdený.%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
msgid "file %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
msgid "File not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Súbor %s%s%s nenájdený.%sChcete ho vytvoriť?%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Súbor nie je malými znakmi"
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "Súbor nie je textový"
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
#, fuzzy
|
|
#| msgid "File Settings ..."
|
|
msgid "File Settings"
|
|
msgstr "Nastavenia súboru ..."
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "Súbory v kódovaní ASCII alebo UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
msgid "File %s is converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Súbory nie sú v kódovaní ASCII ani UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr "súbor, do ktorého je zapísaný výstup ladenia. Ak nie je zadaný, ladiaci výstup je vypísaný do konzoly."
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filter"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
msgid "Filter: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
msgid "Filter all messages of type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr "Množiny filtrov"
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
msgid "Find Declaration of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
#, fuzzy
|
|
#| msgid "Include sub directories"
|
|
msgid "Include &sub directories"
|
|
msgstr "Vrátane podadresárov"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "&Viacriadkový vzor"
|
|
|
|
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Upraviť šablóny kódu"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr "prehľadávať všetky súbory v &projekte"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
msgid "search in &active file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr "prehľadávať a&dresáre"
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Kde"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Nájsť kombináciu klávesov"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "Opraviť súbor LFM"
|
|
|
|
#: lazarusidestrconsts.lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr "Plávajúca čiarka"
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Vynútiť premenovanie"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Chyba formátu"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
msgid "Found version %s, expected %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpccfgismissing
|
|
msgid "fpc.cfg is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr "fpcmake zlyhal"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "Verzia FPC:"
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "Verzia FPC (napr. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Editor FPCDoc"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "&Spätné hľadanie"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Freepascal source directory"
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Adresár zdrojov FreePascal"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "Hľa&dať dopredu"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Ďalšie súbory pre hľadanie (napr. /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Nájsť alebo premenovať identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Nájsť odkazy"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Identifikátor: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "vo všetkých balíčkoch a projektoch"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "v aktuálnej jednotke"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "v hlavnom projekte"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "v projekte/balíčku vlastniacom aktuálnu jednotku"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Neplatný identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Premenovať všetky referencie"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Hľadať aj v komentároch"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "Funkcia"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Všeobecné"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgotoselected
|
|
msgid "Goto selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<description>%sCopyright (C) <rok> <meno autora> <kontakt>%sTento zdrojový kód je slobodný softvér; môžete ho rozširovať a/alebo upravovať podľa podmienok GNU Všeobecnej verejnej licencie, tak ako je zverejnené Nadáciou Free Software; verzie 2 licencie alebo (podľa svojho rozhodnutia) akejkoľvek neskoršej verzie. %sTento zdrojový kód je šírený v nádeji, že bude užitočný, ale BEZ AKEJKO2VEK ZÁRUKY; dokonca aj bez zahrnutej záruky PREDAJNOSTI alebo VHDODNOSTI NA PRÍSLUŠNÝ ÚČEL. Ďalšie detaily si pozrite v GNU Všeobecnej verejnej licencii. %sKópia GNU Všeobecnej verejnej licencie je dostupná cez World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Môžete ju získaj aj napísaním do Nadácie Free Software, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Skupina"
|
|
|
|
#: lazarusidestrconsts.lisgroupassignexisting
|
|
msgid "Assign to existing \"%s\" group?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydelete
|
|
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydeletemore
|
|
msgid "%sThere are %d more empty groups, delete all?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
|
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinput
|
|
msgid "Group name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinvalid
|
|
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnew
|
|
msgid "Set new group ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnone
|
|
msgid "Clear group(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Rozšíriť na najväčšie"
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr "Má pomoc"
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Hlavičkový komentár pre triedu"
|
|
|
|
#: lazarusidestrconsts.lishelp
|
|
msgctxt "lazarusidestrconsts.lishelp"
|
|
msgid "Help"
|
|
msgstr "Pomoc"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr "Položky pomoci"
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Výber pomoci"
|
|
|
|
#: lazarusidestrconsts.lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr "Šestnástkovo"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
#, fuzzy
|
|
#| msgid "Help for FreePascal Compiler message"
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Pomoc pre správu FreePascal Compiler"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr "Rada: Skontrolujte, či dva balíčky neobsahujú jednotku s rovnakým menom."
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
msgid ", Hints: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Uložiť všetko"
|
|
|
|
#: lazarusidestrconsts.lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Krok dnu"
|
|
|
|
#: lazarusidestrconsts.lishintstepout
|
|
msgid "Run until function returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Krok cez"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Rada: Funkcia \"Vytvoriť ResourceString\" očakáva reťazcovú konštantu.%sProsím vyberte výraz a skúste znova."
|
|
|
|
#: lazarusidestrconsts.lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Prepnúť formulár/jednotka"
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Zobraziť formuláre"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Zobraziť jednotky"
|
|
|
|
#: lazarusidestrconsts.lishitcount
|
|
msgid "Hitcount"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Databázy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Voľby pomoci"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Vlastnosti:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Prehliadača"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "Cesta k HTML dokumentácii FPC"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Vodorovne"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr "ID"
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr "IDE"
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
|
msgid "Creating Makefile for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
|
msgid "Error: running 'compile after' tool failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
|
msgid "WARNING: unit name invalid %s, package=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Identifikátor začína s ..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Identifikátor obsahuje ..."
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "Voľby IDE:"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
|
msgid "IDE title shows selected build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
|
msgid "IDE title shows project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
msgid "IDE title starts with project name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Exportovaný súbor existuje"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
#, fuzzy,badformat
|
|
#| msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "Exportovaný súbor %s%s%s existuje.%sotvoriť súbor a nahradiť len voľby prekladača?%s(Ostatné nastavenia ostanú zachované.)"
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Načítať zo súboru"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "Nedávne súbory"
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Uložiť do súboru"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignore
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisignore"
|
|
msgid "Ignore"
|
|
msgstr "Ignorovať"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Ignorovať všetko"
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr "Ignorovať a pokračovať"
|
|
|
|
#: lazarusidestrconsts.lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr "Ignorovať binárky"
|
|
|
|
#: lazarusidestrconsts.lisignoreexceptiontype
|
|
msgid "Ignore this exception type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Importný zoznam"
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludeallsubdirectories
|
|
msgid "Include all subdirectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludefilter
|
|
#, fuzzy
|
|
#| msgid "Include Filter"
|
|
msgid "Include filter"
|
|
msgstr "Zahŕňací filter"
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "cesta include"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Cesty Include"
|
|
|
|
#: lazarusidestrconsts.lisincludesubdirectories
|
|
msgid "Include subdirectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindex
|
|
msgid "Index"
|
|
msgstr "Index"
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Informácie o %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr "Zdedená položka"
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
#, fuzzy,badformat
|
|
#| msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr "Pred vytvorením čistej kópie projektu/balíčka, budú zmazané všetky súbory všetky súbory v cieľovom adresári a všetok ich obsah stratený.%s%sZmazať všetky súbory v %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Vložiť"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr "Vložiť makro"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag
|
|
msgid "Insert PrintShort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
msgid "Insert semicolon if needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspect
|
|
msgid "&Inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectclassinherit
|
|
msgid "%s : Class %s inherits from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdata
|
|
msgid "Data"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdialog
|
|
msgid "Debug Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectmethods
|
|
msgid "Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectpointerto
|
|
msgid "Pointer to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectproperties
|
|
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
|
msgid "Properties"
|
|
msgstr "Vlastnosti"
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolclass
|
|
msgid "Show class column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcoltype
|
|
msgid "Show type column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
|
msgid "Show visibility column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectunavailable
|
|
msgid "%s : unavailable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstance
|
|
msgid "Instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstancehint
|
|
msgid "Use instance class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr "Inštalácia zlyhala"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Nainštalovať výber"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compile package create a simple Makefile."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
msgid "internal error: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Neplatný príkaz"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Neplatné mazanie"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr "Neplatný výraz:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Neplatný výraz.%sRada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu v jednom súbore. Prosím vyberte výraz a skúste znova."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Neplatný filter"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
msgid "Invalid mode %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Neplatný viacnásobný výber"
|
|
|
|
#: lazarusidestrconsts.lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr "Neplatné (vypnuté)"
|
|
|
|
#: lazarusidestrconsts.lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr "Neplatné (zapnuté)"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Neplatný identifikátor Pascalu"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
|
#, fuzzy
|
|
#| msgid "The name \"%s\" is not a valid pascal identifier."
|
|
msgid "The name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Meno \"%s\" nie je platný identifikátor Pascalu."
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Neplatné meno procedúry"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Neplatné meno súboru projektu"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr "Neplatný adresár publikovania"
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Neplatný výber"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
msgid "invalid version in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s už je časťou projektu."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "%s%s%s nie je platné meno projektu.%sProsím vyberte iné (napr. project1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
msgid "Jump to procedure %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
msgid "%s KB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepininstalllist
|
|
msgid "Keep in install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Zachovať meno"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep relative indentation of multi line template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Keep indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Ponechať a pokračovať"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Kláves"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Vlastné príkazy"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Príkazy návrhára"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Príkazy Inšpektora objektov"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr "Kláves (alebo postupnosť dvoch)"
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Zrušiť budovanie"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr "Pridať pozorovanie"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Vybudovať projekt/program"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klasický"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Zatvoriť projekt"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Config %sBuild File%s"
|
|
msgid "Config \"Build File\""
|
|
msgstr "Konfigurovať %sVybudovanie súboru%s"
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
#, fuzzy
|
|
#| msgid "Configure custom components"
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfigurovať voliteľné komponenty"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Kontextovo závislá pomoc"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Konvertovať balíček Delhi na Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project"
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Konvertovať projekt Delphi na Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit"
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Konvertovať jednotku Delphi na Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
#, fuzzy
|
|
#| msgid "Convert DFM file to LFM"
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Konvertovať súbor DFM na LFM"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Copy selected Components to clipboard"
|
|
msgid "Copy selected components"
|
|
msgstr "Kopírovať vybraté komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Cut selected Components to clipboard"
|
|
msgid "Cut selected components"
|
|
msgstr "Vystrihnúť zvolené komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
msgid "Default adapted to OS X"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Zmazať posledný znak"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
#, fuzzy
|
|
#| msgid "Diff editor files"
|
|
msgid "Diff Editor Files"
|
|
msgstr "Rozdiely súborov editora"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Upraviť šablóny kódu"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Upraviť kontextovo závislú pomoc"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
#, fuzzy
|
|
#| msgid "Enclose selection"
|
|
msgid "Enclose Selection"
|
|
msgstr "Uzavrieť výber"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Vyskúšať/Upraviť"
|
|
|
|
#: lazarusidestrconsts.liskmexampleprojects
|
|
msgid "Example Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Nastavenie externých nástrojov"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
#, fuzzy
|
|
#| msgid "Find incremental"
|
|
msgid "Find Incremental"
|
|
msgstr "Nájsť narastajúco"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
#, fuzzy
|
|
#| msgid "Go to marker 0"
|
|
msgid "Go to bookmark 0"
|
|
msgstr "Choď na značku 0"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
#, fuzzy
|
|
#| msgid "Go to marker 1"
|
|
msgid "Go to bookmark 1"
|
|
msgstr "Choď na značku 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
#, fuzzy
|
|
#| msgid "Go to marker 2"
|
|
msgid "Go to bookmark 2"
|
|
msgstr "Choď na značku 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
#, fuzzy
|
|
#| msgid "Go to marker 3"
|
|
msgid "Go to bookmark 3"
|
|
msgstr "Choď na značku 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
#, fuzzy
|
|
#| msgid "Go to marker 4"
|
|
msgid "Go to bookmark 4"
|
|
msgstr "Choď na značku 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
#, fuzzy
|
|
#| msgid "Go to marker 5"
|
|
msgid "Go to bookmark 5"
|
|
msgstr "Choď na značku 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
#, fuzzy
|
|
#| msgid "Go to marker 6"
|
|
msgid "Go to bookmark 6"
|
|
msgstr "Choď na značku 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
#, fuzzy
|
|
#| msgid "Go to marker 7"
|
|
msgid "Go to bookmark 7"
|
|
msgstr "Choď na značku 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
#, fuzzy
|
|
#| msgid "Go to marker 8"
|
|
msgid "Go to bookmark 8"
|
|
msgstr "Choď na značku 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
#, fuzzy
|
|
#| msgid "Go to marker 9"
|
|
msgid "Go to bookmark 9"
|
|
msgstr "Choď na značku 9"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr "Choď na editor zdrojových kódov 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr "Choď na editor zdrojových kódov 10"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr "Choď na editor zdrojových kódov 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr "Choď na editor zdrojových kódov 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr "Choď na editor zdrojových kódov 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr "Choď na editor zdrojových kódov 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr "Choď na editor zdrojových kódov 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr "Choď na editor zdrojových kódov 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr "Choď na editor zdrojových kódov 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr "Choď na editor zdrojových kódov 9"
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Vložiť dátum a čas"
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Vložiť meno používateľa"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Skontrolovať"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Schéma rozloženia klávesnice"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus (default)"
|
|
msgstr "Lazarus (predvolené)"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "Mac OS X (Apple style)"
|
|
msgstr "Mac OS X (štýl Apple )"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "Mac OS X (Lazarus style)"
|
|
msgstr "Mac OS X (štýl Lazarus)"
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr "Nový balíček"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Nový projekt"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Nový projekt zo súboru"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nová jednotka"
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Otvoriť súbor balíčka"
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
#, fuzzy
|
|
#| msgid "Paste Components from clipboard"
|
|
msgid "Paste Components"
|
|
msgstr "Vložiť komponenty zo schránky"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Prerušiť program"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Publikovať projekt"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Spustiť program"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr "Uložiť všetky"
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr "Uložiť ako"
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Uložiť projekt"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Uložiť projekt ako"
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
#, fuzzy
|
|
#| msgid "Select line end"
|
|
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
|
msgid "Select Line End"
|
|
msgstr "Vybrať koniec riadka"
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
#, fuzzy
|
|
#| msgid "Select line start"
|
|
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Vybrať začiatok riadka"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
#, fuzzy
|
|
#| msgid "Select page bottom"
|
|
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Vybrať spodok stránky"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
#, fuzzy
|
|
#| msgid "Select page top"
|
|
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Vybrať vrchol stránky"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
#, fuzzy
|
|
#| msgid "Select word left"
|
|
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Vybrať slovo naľavo"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
#, fuzzy
|
|
#| msgid "Select word right"
|
|
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Vybrať slovo napravo"
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Nastaviť voľnú záložku"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
#, fuzzy
|
|
#| msgid "Set marker 0"
|
|
msgid "Set bookmark 0"
|
|
msgstr "Nastaviť značku 0"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
#, fuzzy
|
|
#| msgid "Set marker 1"
|
|
msgid "Set bookmark 1"
|
|
msgstr "Nastaviť značku 1"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
#, fuzzy
|
|
#| msgid "Set marker 2"
|
|
msgid "Set bookmark 2"
|
|
msgstr "Nastaviť značku 2"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
#, fuzzy
|
|
#| msgid "Set marker 3"
|
|
msgid "Set bookmark 3"
|
|
msgstr "Nastaviť značku 3"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
#, fuzzy
|
|
#| msgid "Set marker 4"
|
|
msgid "Set bookmark 4"
|
|
msgstr "Nastaviť značku 4"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
#, fuzzy
|
|
#| msgid "Set marker 5"
|
|
msgid "Set bookmark 5"
|
|
msgstr "Nastaviť značku 5"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
#, fuzzy
|
|
#| msgid "Set marker 6"
|
|
msgid "Set bookmark 6"
|
|
msgstr "Nastaviť značku 6"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
#, fuzzy
|
|
#| msgid "Set marker 7"
|
|
msgid "Set bookmark 7"
|
|
msgstr "Nastaviť značku 7"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
#, fuzzy
|
|
#| msgid "Set marker 8"
|
|
msgid "Set bookmark 8"
|
|
msgstr "Nastaviť značku 8"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
#, fuzzy
|
|
#| msgid "Set marker 9"
|
|
msgid "Set bookmark 9"
|
|
msgstr "Nastaviť značku 9"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
#, fuzzy
|
|
#| msgid "Stop program"
|
|
msgid "Stop Program"
|
|
msgstr "Zastaviť program"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Prepnúť medzi Jednotkou a formulárom"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle bookmark 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle bookmark 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle bookmark 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle bookmark 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle bookmark 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle bookmark 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle bookmark 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle bookmark 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle bookmark 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle bookmark 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
#, fuzzy
|
|
#| msgid "Toggle view Breakpoints"
|
|
msgid "View Breakpoints"
|
|
msgstr "Prepnúť zobrazenie Body prerušenia"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
#, fuzzy
|
|
#| msgid "Toggle view Call Stack"
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Prepnúť zobrazenie Zásobník volaní"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Prepnúť zobrazenie Prieskumník kódu"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
#, fuzzy
|
|
#| msgid "Toggle view component palette"
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Prepnúť zobrazenie Palety komponentov"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
#, fuzzy
|
|
#| msgid "Toggle view Debugger Output"
|
|
msgid "View Debugger Output"
|
|
msgstr "Prepnúť zobrazenie Výstup debugera"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Prepnúť zobrazenie Editor dokumentácie"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Prepnúť zobrazenie tlačítiek IDE"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
#, fuzzy
|
|
#| msgid "Toggle view Local Variables"
|
|
msgid "View Local Variables"
|
|
msgstr "prepnúť zobrazenie Lokálne premenné"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Prepnúť zobrazenie Správy"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Prepnúť zobrazenie Inšpektor obejktov"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Prepnúť zobrazenie Výsledky hľadania"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Prepnúť zobrazenie Editora zdrojových kódov"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
#, fuzzy
|
|
#| msgid "Toggle view Watches"
|
|
msgid "View Watches"
|
|
msgstr "Prepnúť zobrazenie Pozorovaní"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Zobraziť históriu skokov"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Zobraziť voľby projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
#, fuzzy
|
|
#| msgid "View project source"
|
|
msgid "View Project Source"
|
|
msgstr "Zobraziť zdrojový kód projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Zobraziť info o jednotke"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Neplatné spúšťanie aplikácie"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Spustenie cieľového príkazového riadka"
|
|
|
|
#: lazarusidestrconsts.lislazarus
|
|
msgctxt "lazarusidestrconsts.lislazarus"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Adresár Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
msgid "directory, to be used as a basedirectory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr "Lazarus IDE v%s"
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "Lazarus IDE"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Identifikátor jazyka Lazarus (napr. en, de, sk)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Meno jazyka Lazarus (napr. english, slovak)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [voľby] <meno-suboru-projektu>"
|
|
|
|
#: lazarusidestrconsts.lislazbuildaboaction
|
|
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
|
msgid "Action"
|
|
msgstr "Akcia"
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
#, fuzzy
|
|
#| msgid "Confirm before rebuilding Lazarus"
|
|
msgid "Confirm before build"
|
|
msgstr "Potvrdiť pred prebudovaním Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Chyba zapisovania súboru"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr "%s%s%s%slazbuild nie je interaktívny, ruším."
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Voľby:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
#, fuzzy
|
|
#| msgid "Restart after building the IDE"
|
|
msgid "Restart after building IDE"
|
|
msgstr "Po úspešnom vybudovaní reštartovať"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Cieľový CPU:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Cieľový adresár:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Cieľový OS:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Nemožno zapísať súbor \"%s\":%s"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Vyčistiť + Vybudovať všetko"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
#, fuzzy
|
|
#| msgid "LCL Widget Type"
|
|
msgid "LCL widget type"
|
|
msgstr "Typ LCL Widgetu"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr "Pridať odkaz k zdedeným"
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Kopírovať zo zdedených"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Presunúť položky do zdedených"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr "Jednotku %s nevlastní žiadny balíček alebo projekt.%sProsím pridajte jednotku do balíčka alebo projektu.%sNemožno vytvoriť súbor fpdoc."
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "šípka vľavo"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Ľavý·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vľavo od prvku."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Ľavé ukotvenie"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·ľavej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Ľavé strany"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Rovnaká ľavá vzdialenosť"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgid "Levels"
|
|
msgstr "Úrovne"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "LFM súbor"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "LFM súbor poškodený"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<popis>%sCopyright (C) <rok> <meno autora> <kontakt>%sToto je slobodný program;môžete ho distribuovať a/alebo upravovať za podmienok GNU Library General Public License, tak ako ju zverejnila Free Software Foundation; buď verzie 2 Licencie alebo (podľa Vašej voľby) akejkoľvek novšej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "cesta knižnice"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisline
|
|
msgid "Line:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinelength
|
|
msgid "Line/Length"
|
|
msgstr "Dĺžka riadka"
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr "Odkaz:"
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "voľby linkera"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr "Cieľ linkovania"
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr "načítanie %s zlyhalo."
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocals
|
|
msgid "Locals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyname
|
|
msgid "&Copy Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
|
|
msgid "Copy &RAW Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
|
msgid "C&opy Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsnotevaluated
|
|
msgid "Locals not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogcallstack
|
|
msgid "Log Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogcallstacklimit
|
|
msgid "(frames limit. 0 - no limits)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogevalexpression
|
|
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogmessage
|
|
msgid "Log Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
msgid "Macro %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Zadajte dáta"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Zadajte parametre spustenia"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Application.CreateForm statements"
|
|
msgid "Main unit has Application.CreateForm statements"
|
|
msgstr "Základná jednotka obsahuje Application.CreateForm"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
|
|
msgid "Main unit has Application.Scaled statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
|
|
msgid "Main unit has Application.Title statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Základná jednotka má v sekcii uses všetky jednotky projektu"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Urobiť spustiteľné"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Make nenájdený"
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Vytvoriť ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Pripojiť k výberu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, fuzzy,badformat
|
|
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resourcestring %s%s%s už existuje.%sProsím zvoľte iné meno.%sPoužite Ignorovať pre jeho pridanie."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Voľby konverzie"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Vlastný identifikátor"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identifikátor"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Dĺžka identifikátora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Predpona identifikátora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Vložiť podľa abecedy"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Vložiť v závislosti na kontexte"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Neplatný výber ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr "Prosím zvoľte sekciu resourcestring zo zoznamu."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "ResourceString už existuje"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Výber ResourceString:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Ukážka zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Reťazcová knštanta v zdrojovom kóde"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Reťazce s rovnakou hodnotou:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaxs
|
|
msgid "Max %d"
|
|
msgstr "Max %d"
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
msgid "%s MB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismeaction
|
|
msgctxt "lazarusidestrconsts.lismeaction"
|
|
msgid "Action"
|
|
msgstr "Akcia"
|
|
|
|
#: lazarusidestrconsts.lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr "Výpis pamäte"
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Zrušiť budovanie"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
#, fuzzy
|
|
#| msgid "Add breakpoint"
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Pridať bod prerušenia"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
#, fuzzy
|
|
#| msgid "Add jump point to history"
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Pridať bod skoku do histórie"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add editor file to Project"
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Pridať z editora do projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
#, fuzzy
|
|
#| msgid "Add watch ..."
|
|
msgid "Add &Watch ..."
|
|
msgstr "Pridať pozorovanie ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubreak
|
|
msgid "&Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Vybudovať súbor"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build Lazarus with current profile"
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Vybudovať Lazarus"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
#, fuzzy
|
|
#| msgid "Check LFM file in editor"
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Skontrolovať súbor LFM v editore"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
#, fuzzy
|
|
#| msgid "Clean directory ..."
|
|
msgid "Clean Directory ..."
|
|
msgstr "Vyčistiť adresár ..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
#, fuzzy
|
|
#| msgid "Close A&ll Editor Files"
|
|
msgid "Close A&ll"
|
|
msgstr "Zatvoriť všetky súbory editora"
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Zatvoriť projekt"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
#, fuzzy
|
|
#| msgid "CodeTools defines editor ..."
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Editor definícií CodeTools ..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
#, fuzzy
|
|
#| msgid "Comment selection"
|
|
msgid "Comment Selection"
|
|
msgstr "Zakomentovať výber"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Dokončovanie kódu"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Konfigurovať budovanie + Spustiť súbor ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
#, fuzzy
|
|
#| msgid "Configure custom components ..."
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfigurovať voliteľné komponenty ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
#, fuzzy
|
|
#| msgid "Configure external tools ..."
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Nastaviť externé nástroje..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Konfigurovať Vybudovanie Lazarus"
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Kontextovo závislá pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenucontinue
|
|
msgid "&Continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi package to Lazarus package ..."
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Konvertovať balíček Delphi na Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project ..."
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Konvertovať projekt Delphi na Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Konvertovať jednotku Deplhi na Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
#, fuzzy
|
|
#| msgid "Convert binary DFM to text LFM + check syntax ..."
|
|
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgstr "Konvertovať súbor DFM na LFM ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
#, fuzzy
|
|
#| msgid "Convert encoding of projects/packages ..."
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Konvertovať kódovanie projektov/balíčkov ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
#, fuzzy
|
|
#| msgid "Debug windows"
|
|
msgid "Debug Windows"
|
|
msgstr "Okná ladenia"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Upraviť"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Šablóny kódu ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Upraviť kontextovo závislú pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
#, fuzzy
|
|
#| msgid "Install/Uninstall packages ..."
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Konfigurovať inštalované balíčky ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
msgid "Add icon from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
msgid "Captioned items: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
msgid "Change %s for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
msgid "Change the shortCut for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
msgid "Component is unexpected kind"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
msgid "<conflict resolution complete>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
#, fuzzy
|
|
#| msgid "Delete Item"
|
|
msgid "&Delete item"
|
|
msgstr "Zmazať položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
msgid "Editing Caption of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
msgid "Editing %s for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
msgid "Further shortcut conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
msgid "GroupIndex: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
msgid "Values in use: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
msgid "Items with icon: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Editor menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Posunúť dole (alebo vpravo)"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Posunúť hore (alebo vľavo)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
msgid "Pick an icon from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
msgid "Popup assignments: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
msgid "%s conflicts with %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
msgid "Shortcut items: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
msgid "Shortcut not yet changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
msgid "Shortcuts (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
msgid "Shortcut,Source Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
msgid "Shortcuts used in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
|
msgid "ShowMenuEditor: TMenu parameter is nil"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
msgid "\"%s\" in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
|
msgid "Some widgetsets do not allow separators in the main menubar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
msgid "%s: Shortcuts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorssubmenu
|
|
msgid "%s submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
#, fuzzy
|
|
#| msgid "Enclose selection ..."
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Uzavrieť výber ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
#, fuzzy
|
|
#| msgid "Evaluate/Modify ..."
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Vyskúšať/Upraviť ..."
|
|
|
|
#: lazarusidestrconsts.lismenuexampleprojects
|
|
msgid "Example Projects ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure ..."
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Oddeliť procedúru ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Súbor"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Nájsť"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Nájsť ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
#, fuzzy
|
|
#| msgid "Find other end of code block"
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Nájsť druhý koniec bloku kódu"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
#, fuzzy
|
|
#| msgid "Find code block start"
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Nájsť začiatok bloku kódu"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
#, fuzzy
|
|
#| msgid "Find Declaration at cursor"
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Nájsť deklaráciu na kurzore"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Nájsť odkazy na identifikátor ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find &in files ..."
|
|
msgid "Find &in Files ..."
|
|
msgstr "Nájsť v &súboroch ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Ná&jsť ďalší"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Nájsť &predchádzajúci"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Voľby prostredia ..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Goto include directive"
|
|
msgid "Goto Include Directive"
|
|
msgstr "Choď na direktívu include"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line ..."
|
|
msgid "Goto Line ..."
|
|
msgstr "Choď na riadok ..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Odhadni zle umiestnený IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
#, fuzzy
|
|
#| msgid "Guess unclosed block"
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Odhadni neuzavretý blok"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
#, fuzzy
|
|
#| msgid "IDE internals"
|
|
msgid "IDE Internals"
|
|
msgstr "IDE interné"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Narastajúce hľadanie"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
#, fuzzy
|
|
#| msgid "Indent selection"
|
|
msgid "Indent Selection"
|
|
msgstr "Zväčšiť odsadenie"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
#, fuzzy
|
|
#| msgid "ChangeLog entry"
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Položka ChangeLog"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
#, fuzzy
|
|
#| msgid "Insert from Character Map"
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Vložiť z mapy znakov"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
#, fuzzy
|
|
#| msgid "Insert CVS keyword"
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "Kľúčové slovo CVS"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
#, fuzzy
|
|
#| msgid "Current date and time"
|
|
msgid "Current Date and Time"
|
|
msgstr "Aktuálny dátum a čas"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
#, fuzzy
|
|
#| msgid "General"
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Všeobecné"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
#, fuzzy
|
|
#| msgid "GPL notice"
|
|
msgid "GPL Notice"
|
|
msgstr "GPL vyhlásenie"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
#, fuzzy
|
|
#| msgid "LGPL notice"
|
|
msgid "LGPL Notice"
|
|
msgstr "LGPL vyhlásenie"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
#, fuzzy
|
|
#| msgid "Current username"
|
|
msgid "Current Username"
|
|
msgstr "Meno aktuálneho používateľa"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
#, fuzzy
|
|
#| msgid "Inspect ..."
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Skontrolovať ..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
#, fuzzy
|
|
#| msgid "Jump back"
|
|
msgid "Jump Back"
|
|
msgstr "Skočiť späť"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
#, fuzzy
|
|
#| msgid "Jump forward"
|
|
msgid "Jump Forward"
|
|
msgstr "Skočiť dopredu"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Skoč na"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to next bookmark"
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Skoč na ďalšiu záložku"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
#, fuzzy
|
|
#| msgid "Jump to next error"
|
|
msgid "Jump to Next Error"
|
|
msgstr "Skoč na ďalšiu chybu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to previous bookmark"
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Skoč na predchádzajúcu záložku"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
#, fuzzy
|
|
#| msgid "Jump to previous error"
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Skoč na predchádzajúcu chybu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
#, fuzzy
|
|
#| msgid "Lowercase selection"
|
|
msgid "Lowercase Selection"
|
|
msgstr "Výber na malé písmená"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
msgid "Editor Macros ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Vytvoriť ResourceString ..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
|
msgid "MultiPaste ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nový komponent"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
msgid "New %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nový formulár"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Nový ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
#, fuzzy
|
|
#| msgid "New package ..."
|
|
msgid "New Package ..."
|
|
msgstr "Nový balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Nový projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
#, fuzzy
|
|
#| msgid "New Project from file ..."
|
|
msgid "New Project from File ..."
|
|
msgstr "Nový projekt zo súboru ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nová jednotka"
|
|
|
|
#: lazarusidestrconsts.lismenuok
|
|
#, fuzzy
|
|
#| msgid "&Ok"
|
|
msgctxt "lazarusidestrconsts.lismenuok"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Online pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
#, fuzzy
|
|
#| msgid "Open ..."
|
|
msgid "&Open ..."
|
|
msgstr "Otvoriť ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
#, fuzzy
|
|
#| msgid "Open filename at cursor"
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Otvoriť súbor na kurzore"
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package ..."
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Otvoriť načítaný balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
#, fuzzy
|
|
#| msgid "Open package file (.lpk) ..."
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Otvoriť súbor balíčka (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
#, fuzzy
|
|
#| msgid "Open package of current unit"
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Otvoriť balíček aktuálnej jednotky"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Otvoriť projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
#, fuzzy
|
|
#| msgid "Open &Recent ..."
|
|
msgid "Open &Recent"
|
|
msgstr "Otvoriť posledné ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
#, fuzzy
|
|
#| msgid "Open recent package"
|
|
msgid "Open Recent Package"
|
|
msgstr "Otvoriť nedávny balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project ..."
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Otvoriť nedávny projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
#, fuzzy
|
|
#| msgid "&Package"
|
|
msgid "Pa&ckage"
|
|
msgstr "&Balíček"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
#, fuzzy
|
|
#| msgid "Package Graph ..."
|
|
msgid "Package Graph"
|
|
msgstr "Graf balíčkov ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
#, fuzzy
|
|
#| msgid "Package links ..."
|
|
msgid "Package Links ..."
|
|
msgstr "Odkazy balíčkov ..."
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr "Zoznam procedúr ..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Projekt"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Inšpektor projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Voľby projektu ..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
#, fuzzy
|
|
#| msgid "Run"
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Spustiť"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Publikovať projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
#, fuzzy
|
|
#| msgid "Quick compile"
|
|
msgid "Quick Compile"
|
|
msgstr "Rýchly preklad"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Quick syntax check"
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Rýchla kontrola syntaxe"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Odstrániť z projektu ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Premenovať identifikátor ..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
#, fuzzy
|
|
#| msgid "Reporting a bug"
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Hlásenie chyby ..."
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Rescan FPC source directory"
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Znova prezrieť zdrojové kódy FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
#, fuzzy
|
|
#| msgid "Reset debugger"
|
|
msgid "Reset Debugger"
|
|
msgstr "Reštartovať debuger"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Obnoviť"
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "Sp&ustiť"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Spustiť súbor"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
#, fuzzy
|
|
#| msgid "Run Parameters ..."
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Parametre spustenia ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
#, fuzzy
|
|
#| msgid "Run to &Cursor"
|
|
msgid "Step over to &Cursor"
|
|
msgstr "Spustiť po kurzor"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
#, fuzzy
|
|
#| msgid "Save"
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Uložiť"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
#, fuzzy
|
|
#| msgid "Save As ..."
|
|
msgid "Save &As ..."
|
|
msgstr "Uložiť ako ..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Uložiť projekt"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Uložiť projekt ako ..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Hľadať"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Vybrať"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
#, fuzzy
|
|
#| msgid "Select all"
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrať všetko"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
#, fuzzy
|
|
#| msgid "Select code block"
|
|
msgid "Select Code Block"
|
|
msgstr "Vybrať blok kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
#, fuzzy
|
|
#| msgid "Select line"
|
|
msgid "Select Line"
|
|
msgstr "Vybrať riadok"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
#, fuzzy
|
|
#| msgid "Select paragraph"
|
|
msgid "Select Paragraph"
|
|
msgstr "Vybrať odsek"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
#, fuzzy
|
|
#| msgid "Select to brace"
|
|
msgid "Select to Brace"
|
|
msgstr "Vybrať po zátvorku"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
#, fuzzy
|
|
#| msgid "Select word"
|
|
msgid "Select Word"
|
|
msgstr "Vybrať slovo"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free bookmark"
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Nastav voľnú záložku"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
#, fuzzy
|
|
#| msgid "Sort selection ..."
|
|
msgid "Sort Selection ..."
|
|
msgstr "Zoradiť výber ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepinto
|
|
#, fuzzy
|
|
#| msgid "Step in&to"
|
|
msgid "Step In&to"
|
|
msgstr "Krok dnu"
|
|
|
|
#: lazarusidestrconsts.lismenustepintocontext
|
|
msgid "Step Into (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepout
|
|
msgid "Step O&ut"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepover
|
|
#, fuzzy
|
|
#| msgid "&Step over"
|
|
msgid "&Step Over"
|
|
msgstr "Krok cez"
|
|
|
|
#: lazarusidestrconsts.lismenustepovercontext
|
|
msgid "Step Over (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
#, fuzzy
|
|
#| msgid "Tabs to spaces in selection"
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Tabulátory výberu na medzery"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "O ..."
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Obsah"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Štandardné menu Upraviť"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Štandardné menu Súbor"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Štandardné menu Pomoc"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefind
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
|
msgid "Find"
|
|
msgstr "Nájsť"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefindnext
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
|
msgid "Find Next"
|
|
msgstr "Nájsť ďalší"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopenrecent
|
|
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr "Otvoriť nedávne"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Príručka"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Nástroje"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
#, fuzzy
|
|
#| msgid "Uncomment selection"
|
|
msgid "Uncomment Selection"
|
|
msgstr "Odkomentovať výber"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
#, fuzzy
|
|
#| msgid "Unindent selection"
|
|
msgid "Unindent Selection"
|
|
msgstr "Zmenšiť odsadenie výberu"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
#, fuzzy
|
|
#| msgid "Uppercase selection"
|
|
msgid "Uppercase Selection"
|
|
msgstr "Výber na veľké písmená"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Zobraziť"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
#, fuzzy
|
|
#| msgid "View Anchor Editor"
|
|
msgid "Anchor Editor"
|
|
msgstr "Zobraziť Editor ukotvenia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewassembler
|
|
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "Body prerušenia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Zásobník volaní"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Prieskumník kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
#, fuzzy
|
|
#| msgid "View Component Palette"
|
|
msgid "Component Palette"
|
|
msgstr "Zobraziť Paletu komponentov"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponenty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Záznam udalostí"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
#, fuzzy
|
|
#| msgid "Debug output"
|
|
msgid "Debug Output"
|
|
msgstr "Výstup ladenia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
#, fuzzy
|
|
#| msgid "Forms..."
|
|
msgid "Forms ..."
|
|
msgstr "Formuláre ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
#, fuzzy
|
|
#| msgid "Jump History ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Zobraziť Históriu skokov ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Lokálne premenné"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Správy"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Inšpektor objektov"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgid "Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Prehliadač obmedzení"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Výsledky hľadania"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
#, fuzzy
|
|
#| msgid "Toggle form/unit view"
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Prepnúť formulár/jednotka"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
#, fuzzy
|
|
#| msgid "Unit Dependencies ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Zobraziť závislosti jednotky"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
#, fuzzy
|
|
#| msgid "Unit Information"
|
|
msgid "Unit Information ..."
|
|
msgstr "Zobraziť info o jednotke"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
#, fuzzy
|
|
#| msgid "Units..."
|
|
msgid "Units ..."
|
|
msgstr "Jednotky ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Pozorovania"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Okno"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
#, fuzzy
|
|
#| msgid "Other"
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Ostatné"
|
|
|
|
#: lazarusidestrconsts.lismeprojects
|
|
msgid "Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Editor správ"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Nenájdená metóda triedy"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
msgid "missing directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Chýbajúce udalosti"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
msgid "missing executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Chýbajúce identifikátory"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Chýbajúce balíčky"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Abort now, install packages or fix paths and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
msgid "Skip this Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
msgid "expected \":=\" after macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
msgid "expected macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
msgid "From %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
msgid "Set \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencoding
|
|
msgid "Use system encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencodinghint
|
|
msgid "Disable support for UTF-8 default string encoding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
msgid "Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
msgid "(was \"%s\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
msgid ", Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
#| "\n"
|
|
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<description>%sCopyright (C) <year> <meno autora> <contact>%sTáto knižnica je slobodný softvér; môžete ju distribuovať a/alebo upravovať podľa ustanovení GNU Library General Public License tak ako ju zverenila Free Software Foundation; buď verzie 2 Licencie alebo (podľa vašej voľby) akoukoľvek novšej verzie s nasledujúcimi úpravami:%sAko špeciálny výnimka, vlastníci autorského práva tejto knižnice Vám dovoľujú prepojiť túto knižnicu s nezávislými modulmi za účelom vytvorenia programov, pričom nezávisí na licencii týchto nezávislých modulov, a kopírovať a distribuovať výsledné programy za podmienok poskytnutých podľa Vášho rozhodnutia, ktoré sa môžu líšiť pre každý nezávislý modul. Nezávislý modul je modul, ktorý nie je odvodený alebo založený na tejto knižnici. Ak upravujete túto knižnicu, môžete rozšíriť túto výnimku pre svoju verziu knižnice, ale nie je to vaša povinnosť. Ak to nechcete urobiť, zmažte túto výnimku zo svojej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lismodify
|
|
msgid "&Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Viac"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr "Viac"
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
#, fuzzy
|
|
#| msgid "Move Page ..."
|
|
msgid "Move Page"
|
|
msgstr "Presunúť stranu ..."
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisms
|
|
msgid "(ms)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Uložiť správy do súboru (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Meno"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Konflikt mena"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Meno novej procedúry"
|
|
|
|
#: lazarusidestrconsts.lisnever
|
|
msgctxt "lazarusidestrconsts.lisnever"
|
|
msgid "Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Nový"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nová trieda"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr "Nová konzolová aplikácia"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Vytvoriť novú súbor editora.%sZvoľte typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Vytvoriť nový prázdny textový súbor."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Vytvoriť nový projekt.%sZvoľte typ"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Vytvoriť nový štandardný balíček.%sBalíček je kolekcia jednotiek ak omponentov."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Vytvoriť novú jednotku s dátovým modulom."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
#, fuzzy
|
|
#| msgid "Create a new unit with a frame"
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Vytvoriť novú jednotku s rámcom"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Vytvoriť novú jednotku s formulárom LCL."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Nezvolená položka"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Prosím, najprv vyberte položku."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Nové kódovanie:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
msgid "Macro %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
#, fuzzy,badformat
|
|
#| msgid "%s - (new project)"
|
|
msgid "(new project)"
|
|
msgstr "%s - (nový projekt)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisno
|
|
msgid "No"
|
|
msgstr "Nie"
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Bez záložných súborov"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Bez zmeny"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Nie je vybratý kód"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Žiadne zdedené voľby prekladača"
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr "6iadne vybrané okno IDE"
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "bez mena"
|
|
|
|
#: lazarusidestrconsts.lisnone
|
|
msgid "%snone"
|
|
msgstr "%sžiadne"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr "nie je vybratý žiadny uzol"
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
msgid "No program file \"%s\" found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Nenájdená sekcia ResourceString"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
#, fuzzy
|
|
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Filter je zvyčajne regulárny výraz. Pri Jednoduchej syntaxi je 'a' normálny znak, '*' vystupuje ako čokoľvek, '?' nahrádza jeden znak a čiarka a bodkočiarka oddeľujú možnosti. Napríklad: Jednoduchá syntax *.pas;*.pp korešponduje s ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Nenájdená reťazcová premenná"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
|
msgid "Not a valid Pascal identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dole"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "šípka vľavo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "šípka vpravo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Hore"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy FreePascal"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
|
|
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
|
|
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr "Neimplementované"
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr "Zatiaľ neimplementované:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Nie teraz"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreate
|
|
msgid "Create"
|
|
msgstr "Vytvoriť"
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Vytvoriť nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
msgid "Number of files to convert: %s"
|
|
msgstr "Počet konvertovaných súborov: %s"
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr "Object Pascal - predvolené"
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr "cesta objektov"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoff
|
|
msgid "? (Off)"
|
|
msgstr "? (Vypnúť)"
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
msgid " of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Class %s%s%s not found."
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Trieda %s%s%s nenájdená."
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "automaticky inštalovaný dynamicky"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "automaticky inštalovaný staticky"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Popis:"
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sPopis: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Meno súboru: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "inštalovaný dynamicky"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "inštalovaný staticky"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
msgid "%sLicense: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "chýbajúci"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "zmenený"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package"
|
|
msgid "Open Loaded Package"
|
|
msgstr "Otvoriť načítaný balíček"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Meno balíčka"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Prosím, vyberte balíček"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "len na čítanie"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Stav"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sTento balíček je nainštalovaný, ale nebol nájdený súbor lpk"
|
|
|
|
#: lazarusidestrconsts.lisok
|
|
#, fuzzy
|
|
#| msgid "ok"
|
|
msgctxt "lazarusidestrconsts.lisok"
|
|
msgid "OK"
|
|
msgstr "OK"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Stará trieda"
|
|
|
|
#: lazarusidestrconsts.lison
|
|
msgid "? (On)"
|
|
msgstr "? (Zapnúť)"
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Hľadať len celé slová"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Otvoriť"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Otvoriť ako súbor XML"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Otvoriť existujúci súbor"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Otvoriť súbor"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Otvoriť súbor"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Otvoriť %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Otvoriť balíček?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr "Otvoriť balíček %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Otvoriť súbor balíčka"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Otvoriť projekt?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Otvoriť projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Znova otvoriť projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Otvoriť súbor projektu"
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr "Otvoriť symbolický odkaz"
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr "Otvoriť cieľ"
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Otvoriť súbor ako bežný zdrojový kód"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr "Otvoriť balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr "Otvoriť projekt %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Voľby"
|
|
|
|
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
|
msgid "Options changed, recompiling clean with -B"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr "alebo"
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
msgid ", OS: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr "Prepísať jazyk. Napríklad --language=de. Pre možné hodnoty pozrite súbory v adresári languages."
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr "%sprepíše predvolený prekladač. napr. ppc386 ppcx64 ppcppc atď. predvolené je uložené v environmentoptions.xml"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
msgid "%soverride the project or IDE build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr "%sprepisuje CPU projektu. napr. i386 x86_64 powerpc powerpc_64 atď. predvolené: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr "%sprepisuje operačný systém projektu. napr. win32 linux. predvolené: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr "%sprepisuje widgetset projektu. napr. gtk gtk2 qt win32 carbon. predvolené: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Prepísať súbor?"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Prepísať súbor na disku"
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Balíček"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
msgid "package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
msgid ", package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
#, fuzzy
|
|
#| msgid "Package Info"
|
|
msgid "Package info"
|
|
msgstr "Informácie o balíčku"
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Meno balíčka začína s ..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Meno balíčka obsahuje ..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Balíček potrebuje inštaláciu"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
msgid "Package \"%s\" Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgid "Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
msgid "parser \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasscount
|
|
msgid "Pass Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
|
|
msgid "passing compiler define \"%s\" twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
|
|
msgid "passing compiler option -%s twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispaste
|
|
msgctxt "lazarusidestrconsts.lispaste"
|
|
msgid "Paste"
|
|
msgstr "Vložiť"
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr "Cesta"
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Prezerať"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
#, fuzzy
|
|
#| msgid "Move path down"
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Posunúť cestu dole"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
#, fuzzy
|
|
#| msgid "Move path up"
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Posunúť cestu hore"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Cesty šablón"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Prehľadávať cesty:"
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Prerušiť"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddotheritems
|
|
msgid "Add other items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add to project"
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Pridať do projektu"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Použiť zmeny"
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Volá procedúru %sRegister%s zvolenej jednotky"
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Preložiť všetko?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Preložiť balíček"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Voľby prekladača pre balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Vytvoriť Makefile"
|
|
|
|
#: lazarusidestrconsts.lispckeditdefault
|
|
msgid "%s, default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
#, fuzzy
|
|
#| msgid "Edit General Options"
|
|
msgid "Edit general options"
|
|
msgstr "Upraviť Všeobecné voľby"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Vlastnosti súboru"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Inštalovať"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Neplatná maximálna verzia"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Neplatná minimálna verzia"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maximálna verzia"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimálna verzia:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Zmenené: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Posunúť závislosť dole"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Posunúť závislosť hore"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Balíček %s%s%s bol zmenený.%sUložiť balíček?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "balíček %s neuložený"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Stránka: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Znova pridať závislosť"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Znova pridať súbor"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Len na čítanie: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
#, fuzzy
|
|
#| msgid "Recompile all required"
|
|
msgid "Recompile All Required"
|
|
msgstr "Znova preložiť všetky vyžadované"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
#, fuzzy
|
|
#| msgid "Recompile clean"
|
|
msgid "Recompile Clean"
|
|
msgstr "Vyčistiť a znova preložiť"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Znova preložiť tento a všetky vyžadované balíčky?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Registrované pluginy"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Registrovať jednotku"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Odstrániť závislosť"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Odstrániť závislosť?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Odstrániť závislosť %s%s%s%sz balíčka %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Odstránené vyžadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Odstrániť súbor"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Odstrániť súbor?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Odstrániť súbor %s%s%s%sz balíčka %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Odstrániť zvolenú položku"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Vyžadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save package"
|
|
msgid "Save Package"
|
|
msgstr "Uložiť balíček"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maximálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Minimálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Odinštalovať"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Zobraziť zdrojový kód balíčka"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Nainštalované"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Inštalovať pri ďalšom štarte"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sStav: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
#, fuzzy
|
|
#| msgid "Uninstall on next start"
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Odinštalovať pri ďalšom štarte"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Pridať voľby k závislostiam balíčkov a projektov"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Pridať cesty k závislým balíčkom/projektom"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
#, fuzzy
|
|
#| msgid "Author:"
|
|
msgid "Author"
|
|
msgstr "Autor:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automaticky prebudovať, keď je to potrebné"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automaticky prebudovať, pri prebudovaní všetkého"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Vlastné"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
#, fuzzy
|
|
#| msgid "Description/Abstract"
|
|
msgid "Description / Abstract"
|
|
msgstr "Popis/Zhrnutie"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
#, fuzzy
|
|
#| msgid "Designtime and Runtime"
|
|
msgid "Designtime and runtime"
|
|
msgstr "Doba návrhu i spustenia"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "Integrácia IDE"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Zahrnúť"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Neplatný typ balíčka"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Knižnica"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
#, fuzzy
|
|
#| msgid "License:"
|
|
msgid "License"
|
|
msgstr "Licencia:"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linkovač"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Hlavná"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Manuálny preklad (nikdy automaticky)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Nižšia"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objekt"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Voľby balíčka"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
#, fuzzy
|
|
#| msgid "PackageType"
|
|
msgid "Package type"
|
|
msgstr "Typ balíčka"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Poskytuje"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Vydanie"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Balíček %s%s%s má nastavený príznak autoinštalácie.%sTo znamená, že bude inštalovaný v IDE. Inštalačné balíčky %smusia byť balíčkami doby návrhu."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Tento balíček poskytuje to isté ako balíčky:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
#, fuzzy
|
|
#| msgid "Update/Rebuild"
|
|
msgid "Update / Rebuild"
|
|
msgstr "Aktualizovať/Prebudovať"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Použitie"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Zrušiť"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Postup"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Nájdený konflikt"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Upraviť virtuálnu jednotku"
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Meno súboru:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Opraviť veľkosť písmen"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Neplatné meno jednotky"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Neplatné meno jednotky"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
msgid "Missing files of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
#, fuzzy
|
|
#| msgid "Sort Files"
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Zoradiť súbory"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Meno jednotky:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "Doplnenie CompiledSrcPath"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Výstupný adresár"
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Značka zdrojového adresára balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Cesta jednotky"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Naozaj chcete zahodiť všetky zmeny balíčka %s a znova načítať súbor?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Nová jednotka nie je v ceste jednotiek"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Publikovať balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Obnoviť balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Súbor %s%s%s%smomentálne nie je v ceste jednotiek balíčka.%s%sPridať %s%s%s do cesty jednotiek?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
|
msgid "Binary"
|
|
msgstr "Binárny"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Súbor include"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr "Spravoanie súboru XML"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - textový formulár Lazarus"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - Lazarus resource"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypemainunit
|
|
msgid "Main Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Virtuálna jednotka"
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
|
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
|
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
|
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
|
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
|
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
|
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "%sPridanie novej závislosti projektu %s: balíček %s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr "Pridať jednotku do klauzuly uses balíčka. Toto vypnúť len pre jednotky, ktoré nemusia byť prekladané vo všetkých triedach."
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Nájdená nejednoznačné jednotky"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automaticky inštalované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sOba balíčky sú spojené. To znamená, že jeden balíček používa druhý alebo sú oba použité tretím balíčkom."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Porušená závislosť"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangcompilepackage
|
|
msgid "Compile package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Zmazanie zlyhalo"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Zmazať súbor starého balíčka?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old package file %s%s%s?"
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Zmazať starý súbor balíčka %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Závislosť bez vlastníka: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Chyba čítania súboru"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Chyba čítania balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
|
msgid "Error: updating po files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Chyba zapisovania súboru"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Chyba zápisu balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Súbor už v balíčku existuje"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Súbor je v projekte"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Meno súboru je iné ako z mena balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Meno súboru je použité iným balíčkom"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Meno súboru je použité projektom"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found."
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Súbor %s%s%s nenájdený."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Súbor neuložený"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíček:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíčky:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr "neplatné meno súboru preladača"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Neplatná prípona súboru"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Neplatná prípona súboru balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Neplatné meno súboru balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Neplatné meno balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Neplatné meno balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Načítanie balíčka %s nahradí balíček %s%szo súboru %s.%sStarý balíček je upravený.%s%sUložiť starý balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr "Nový balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Balíček: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Konflikty balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
#, fuzzy
|
|
#| msgid "Package is no designtime package"
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Balíček nie je pre dobu návrhu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Balíček je vyžadovaný"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "základný súbor zdrojového kódu balíčka"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Meno balíčka už existuje"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Balíčky musia mať príponu .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Prosím, uložte súbor pred jeho pridaním do balíčka."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Prebudovať Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace existing file %s%s%s?"
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Nahradiť existujúci súbor %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Nahradiť súbor"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save Package?"
|
|
msgid "Save package?"
|
|
msgstr "Uložiť balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Uložiť balíček %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, fuzzy,badformat
|
|
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Má byyť súbor premenovaný malými písmenami na %s%s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Preskočiť tento balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "konfiguračný súbor statických balíčkov"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "Súbor prekladača pre balíček %s nie je platný spustiteľný súbor:%S%S"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis already in the package %s."
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Súbor %s%s%s%suž je v balíčku %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is not a Lazarus package."
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Súbor %s%s%s nie je balíček Lazarus."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Meno súboru %s%s%s nesúhlasí s menom balíčka %s%s%s v súbore.%sZmeňte menobalíčka na %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Meno súboru %s%s%s je časťou aktuálneho projektu.%sProjekty a balíčky nemôžu zdieľať súbory."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Meno súboru %s%s%s je použité %sbalíčka %s%s%s%sv súbore %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
|
msgid "The file \"%s\" of package %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Zlyhalo načítanie týchto balíčkov:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Zlyhalo načítanie týchto balíčkov:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
#, fuzzy,badformat
|
|
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr "%sNasledujúce jednotky budú pridané do sekcie uses %s%s:%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
|
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
|
|
msgstr "Balíček %s%s%s pri inštalácii zlyhal.%sOdstrániť ho z inštalačného zoznamu?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, fuzzy,badformat
|
|
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Meno súboru balíčka %s%s%s v%s%s%s%s nie je platné meno balíčka Lazarus."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, fuzzy
|
|
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Balíček %s je balíčkom len pre dobu behu. %sBalíčky len pre dobu behu nemožno inštalovať do IDE."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Balíček %s%s%s je označený na inštaláciu, ale nádá sa nájsť.%sOdstrániť závislosť zo zoznamu inštalovaných balíčkov?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Balíček %s je vyžadovaný balíčkom %s, ktorý je označený pre inštaláciu.%sViz graf balíčkov."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Meno balíčka %s%s%s nie je platným menom balíčka%sProsím zvoľte iné meno (napr. balicek1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Meno balíčka %s%s%s %ssúboru %s%s%s je neplatné."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Balíček %s%s%s bol označený na odinštaláciu.%sMomentálne Lazarus podporuje builen staticky pripojené balíčky, preto odinštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Balíček %s%s%s bol označený na inštaláciu.%sMomentálne Lazarus podporuje len staticky pripojené balíčky, preto inštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Projekt vyžaduje balíček %s%s%s.%sAle tento nebol nájdený. Pozrite Projekt -> Inšpektor projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, fuzzy,badformat
|
|
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Existujú dve jednotky s rovnakým menom:%s%s1. %s%s%s z %s%s2. %s%s%s z %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Existuje jednotka FPC s rovnakým menom ako balíček:%s%s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Už existuje jednotka FPC s rovnakým menom ako %s%s%s%s%s z %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Balíček so zvoleným menom %s%s%s.%suž existuje. Konfliktný balíček: %s%s%s%sSúbor: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Balíček %s%s%s načítaný %szo súboru %s%s%s už existuje.%sPozrite Balíček -> Graf balíčkov .%sNahradenie nie je možné."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Medzi vyžadovanými balíčkami sú neuloýené balíčky. Pozrite graf balíčkov."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Už existuje jednotka s rovnakým enom ako blíček:%s%s1. %s%s%s z %s%s2. %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Toto je virtuálny balíček. Zatiaľ nemá zdrojový kód. Prosím najprv uložte balíček."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Nemožno vytvoriť adresár"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
|
msgstr "Nemožno vytvoriť výstupný adresár %s%s%s%sbalíčka %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
|
msgstr "Nemožno vytvoriť zdrojový adresár %s%s%s%spre balíček %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Nemožno vytvoriť cieľový adresár pre Lazarus:%s%s%s%s.%sTento adresár je potebný pre nové, zmenené Lazarus IDE s vašimi balíčkami."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete file %s%s%s."
|
|
msgid "Unable to delete file \"%s\"."
|
|
msgstr "Nemožno zmazať súbor %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Nemožno zmazať súbor"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
|
msgstr "Nemožno zmazať starý stavový súbor %s%s%s%sbalíčka %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
|
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
|
msgstr "Nemožno otvoriť balíček %s%s%s.%sTento balíček bol označený na inštaláciu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nemožno čítať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Nemožno zapísať balíček %s%s%s%sdo súboru %s%s%s.%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nemožno zapísať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Odinštalovať balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Odinštalovať balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Neuložený balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Použiť jednotku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Upozornenie: Súbor %s%s%s%spatrí do aktuálneho projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr "nový"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr "odstrániť"
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsinstalled
|
|
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
|
msgid "Installed"
|
|
msgstr "Nainštalované"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
#, fuzzy
|
|
#| msgid "Can not register components without unit"
|
|
msgid "Cannot register components without unit"
|
|
msgstr "Nemožno registrovať komponent bez jednotky"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
#, fuzzy,badformat
|
|
#| msgid "Component Class %s%s%s already defined"
|
|
msgid "Component Class \"%s\" already defined"
|
|
msgstr "Trieda komponentu %s%s%s je už definovaná"
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sFile Name: %s%s%s"
|
|
msgid "%s%sFile Name: \"%s\""
|
|
msgstr "%s%sMeno súboru: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Neplatná trieda komponentu"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Neplatné meno jednotky: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgsyslpkfilename
|
|
msgid "%s%slpk file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Súbor balíčka nenájdený"
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
|
msgid "Package registration error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "Procedúra Register je prázdna"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "Bolo volané RegisterUnit, ale neregistruje sa žiadny balíček."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
|
msgid "%s%sThe lpk file was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr "Balíček %s%s%s je nainštalovaný, ale nebol nájdený platný súbor balíčka (.lpk).%sBol vytvorený poškodený fiktívny balíček."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "Toto je predvolený balíček. Určený len pre komponenty bez balíčkov (zastarané)."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr "Tento balíček je nainštalovaný, ale súbor lpk nebol nájdený. Všetky jeho komponenty sú deaktivované. Prosím opravte to."
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sUnit Name: %s%s%s"
|
|
msgid "%s%sUnit Name: \"%s\""
|
|
msgstr "%s%sMeno jednotky: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
|
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
|
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
|
msgid "Unit \"%s\" was removed from package (lpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Tento súbor nepatrí do žiadneho načítaneho balíčka."
|
|
|
|
#: lazarusidestrconsts.lispkgtransitivity
|
|
msgid "Transitivity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read package file %s%s%s.%sError: %s"
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Nemožno čítať súbor balíčka %s%s%s.%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Globálne"
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
msgid "Online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Odkazy balíčkov"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Používateľ"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Prosím pred spustením otvorte jednotku."
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy"
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<Všetko>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Zmeniť font"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Kopírovať meno metódy do schránky"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filtrovanie s porovnávaním akejkoľvek časti metódy"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filtrovanie s porovnávaním začiatku metódy"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Skoč na výber"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Nič>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objekty"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Neukladať žiadne informácie o relácii"
|
|
|
|
#: lazarusidestrconsts.lispointer
|
|
msgid "Pointer"
|
|
msgstr "Ukazovateľ"
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
#, fuzzy
|
|
#| msgid "Save in IDE config directory"
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Uložiť v konfiguračnom adresári IDE"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Uložiť do súboru .lps"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Uložiť do súboru .lps v adresári projektu"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Informácie o relácii uložiť v"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
msgid "%s (position outside of source)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr "hlavný konfiguračný adresár, kde Lazarus uchováva svoje konfiguračné súbory. Predvolené je "
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
msgid "prior %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr "Súkromné (private)"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Súkromná metóda"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
#, fuzzy,badformat
|
|
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr "Pred pokračovaním asi bude potrebné nainštalovať niektoré balíčky .%s%sUpozornenie:%sProjekt závisí na niektorých balíčkoch, ktoré obsahujú jednotky s procedúrou Register. Procedúra Register je bežne používaná na inštaláciu komponentov v IDE, ale nasledujúce jednotky vyzerajú akoby patrili do balíčkov, ktoré zatiaľ v IDE nainštalované nie sú. Ak sa pokúsite otvoriť v IDE formulár, ktorý používa takéto komponenty, dostanete chyby o chýbajúcich komponentoch a načítanie formulára môže vyvolať neočakávané správanie.%s%sToto nemá vplyv na otváranie súborov projektu alebo jeho zdrojových kódov.%s%sZnamená to len, že nie je dobrý nápad otvárať formulár v návrhovom zobrazení pred nainštalovaní chýbajúcich balíčkov.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedúra"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Procedúra s rozhraním"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Program zistený"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
#, fuzzy
|
|
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Zdrojový kód programu musí mať príponu Pascalu ako .pas, .pp or .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
|
msgid "Add Files to Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Závislosť už existuje"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
#, fuzzy
|
|
#| msgid "Add editor files"
|
|
msgid "Add Editor Files"
|
|
msgstr "Pridať súbory editora"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Neplatná Min-Max verzia"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
|
#, fuzzy
|
|
#| msgid "Invalid pascal unit name"
|
|
msgid "Invalid Pascal unit name"
|
|
msgstr "Neplatné meno jednotky pascal"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Neplatná verzia"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maximálna Verzia (voliteľné):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimálna verzia (voliteľné)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nový vyžadovaný"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Meno balíčka:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Balíček nenájdený"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Závislosť %s%s%s nebola nájdená.%sProsím zvoľte existujúci balíček."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maximálna verzia %s%s%s je neplatná.%sProsím použite formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximálna verzia je nižšia ako Minimálna."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, fuzzy,badformat
|
|
#| msgid "The project has already a dependency for the package %s%s%s."
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Projekt už má závislosť na balíčku %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Meno jednotky %s%s%s už v projekte existuje %sso súborom: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Meno jednotky %s%s%s už existuje vo výbere%sso súborom: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The unit name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Meno jednotky %s%s%s nei je platný identifikátor Pascalu."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add to project"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Pridať do projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Meno jednotky už existuje"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
msgid "Project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekt zmenený"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectcount
|
|
msgid "%d projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Adresár projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
|
msgid "Title in taskbar shows also directory path of the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Meno súboru projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Cesta k include projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Informačný súbor projektu zistený"
|
|
|
|
#: lazarusidestrconsts.lisprojectinformation
|
|
#, fuzzy
|
|
#| msgid "Project Information"
|
|
msgid "Project information"
|
|
msgstr "Informácie o projekte"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekt je spustiteľný"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Vlastnosti Makier projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Cesta k zdrojovým kódom projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Cesta k jednotkám projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr "Sprievodca projektom"
|
|
|
|
#: lazarusidestrconsts.lisprojfiles
|
|
msgid "Files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Potvrďte zmazanie závislosti"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Zmazať závislosť pre %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Inšpektor projektu - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Odstránené vyžadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Odstrániť súbor %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
msgid "Remove %s items from project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Nemožno čítať stavový súbor %s projektu %s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Nemožno zapísať stavový súbor projektu %s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Vždy vybudovať (aj keď nezmenené)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Nemožno zmeniť zoznam automaticky vytváraných formulárov v zdrojovom kóde programu.%sNajprv opravte chyby."
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Značka zdrojového adresára projektu"
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Opýtať sa na hodnotu"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr "Chránené (protected)"
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Chránená metóda"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Verejná metóda"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Zverejnená metóda"
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Publikovať adresár projektu"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Exclude filter"
|
|
msgid "Invalid exclude filter"
|
|
msgstr "Neplatný vylučovací filter"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Include filter"
|
|
msgid "Invalid include filter"
|
|
msgstr "Neplatný zahrňovací filter"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
#, fuzzy
|
|
#| msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Upraviť virtuálnu jednotku"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Už existuje jednotka s týmto menom.%sSúbor: %s"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
#, fuzzy
|
|
#| msgid "The unitname is not a valid pascal identifier."
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Meno jednotky nie je platný identifikátor Pascalu"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
#, fuzzy
|
|
#| msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
|
msgid "The unitname is used when the IDE extends uses clauses"
|
|
msgstr "Meno jednotky je použité, keď IDE pridáva do klauzulí uses."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi Project"
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "Konvertovať projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
#, fuzzy
|
|
#| msgid "New Project"
|
|
msgid "&New Project"
|
|
msgstr "Nový projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
#, fuzzy
|
|
#| msgid "Open Project"
|
|
msgid "&Open Project"
|
|
msgstr "Otvoriť projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project"
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Otvoriť nedávne"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixremoveunit
|
|
msgid "Quick fix: Remove unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
#, fuzzy
|
|
#| msgid "Quit Lazarus"
|
|
msgid "&Quit Lazarus"
|
|
msgstr "Skončiť Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisrange
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisrange"
|
|
msgid "Range"
|
|
msgstr "Rozsah"
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Chyba čítania"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr "Záznam/Štruktúra"
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Znova"
|
|
|
|
#: lazarusidestrconsts.lisregisters
|
|
msgctxt "lazarusidestrconsts.lisregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr "Regulárny výraz"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Relatívne cesty"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
#, fuzzy
|
|
#| msgid "remove"
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "odstrániť"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Odstrániť všetky neplatné vlastnosti"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
msgid "Removed property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefrominstalllist
|
|
msgid "Remove from install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
#, fuzzy
|
|
#| msgid "Remove from project"
|
|
msgid "Remove from Project"
|
|
msgstr "Odstrániť z projektu"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable
|
|
msgid "Remove local variable %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Odstrániť ich"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
msgid "Remove uses \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Premenovať"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Premenovať súbor?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Premenovanie súboru zlyhalo"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
msgid "Rename to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Premenovať na malé písmená"
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr "Znova otvoriť s iným kódovaním"
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr "Počet opakovaní:"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Nahradiť"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Nahradenie výberu zlyhalo."
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/sk"
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Chyba uloženia resource"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Reštartovať"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Obnovenie zlyhalo"
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "šípka vpravo"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Pravé ukotvenie"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Pravý okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vprav od prvku."
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·pravej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Pravé strany"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Rovnaká pravá vzdialenosť"
|
|
|
|
#: lazarusidestrconsts.lisroot
|
|
msgid "Root"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrootdirectory
|
|
msgid "Root Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Spustiť"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunbuttonhint
|
|
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
|
msgid "Run"
|
|
msgstr "Spustiť"
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
msgid "%s (running ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Súbor nie je spustiteľný"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The host application %s%s%s is not executable."
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Hostiteľská aplikácia %s%s%s nie je spustiteľná."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Spustiť"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Spustiť po zlyhané"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
#, fuzzy
|
|
#| msgid "Abstract methods - not yet overridden"
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr "Abstraktné metódy - zatiaľ neprepísané"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr "Abstraktné metódy %s"
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Kurzor nie je v definícii triedy"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IDE pracuje"
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr "%s je abstraktná trieda a má %s abstraktných metód."
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Abstraktné metódy nenájdené"
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr "Nahradiť všetky vybraté"
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr "Nahradiť prvý vybratý"
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Nič vybraté"
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr "Existuje %s abstraktných metód, ktoré možno prepípsať.%sZvoľte metódy, pre ktoré majú byť vytvorené kostry:"
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Neexistujú abstraktné metódy na prepísanie."
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr "Táto metóda nemôže byť prepísaná, pretože je definovaná v aktuálnej triede"
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr "Nemožno zobraziť abstraktné metódy tejto triedy, pretože"
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
#, fuzzy
|
|
#| msgid "Save ..."
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Uložiť ..."
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Uložiť všetko"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
#, fuzzy
|
|
#| msgid "save all modified files"
|
|
msgid "Save all modified files"
|
|
msgstr "uložiť všetky zmenené súbory"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Uložiť a skončiť dialóg"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Uložiť a prebudovať IDE"
|
|
|
|
#: lazarusidestrconsts.lissaveas
|
|
msgctxt "lazarusidestrconsts.lissaveas"
|
|
msgid "Save As"
|
|
msgstr "Uložiť ako"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Uložiť zmeny?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Uložiť zmeny do projektu %s?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
#, fuzzy
|
|
#| msgid "save current editor file"
|
|
msgid "Save current editor file"
|
|
msgstr "uložiť aktuálny súbor editora"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Uložiť informácie editora o súboroch, ktoré nepatria do projektu"
|
|
|
|
#: lazarusidestrconsts.lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Uložiť súbor ako"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, fuzzy,badformat
|
|
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Uložiť súbor %s%s%s%spred zatvorením formulára %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Uložiť informácie o zatvorených súboroch editora"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
msgid "Save project %s (*%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
msgid "Save session changes to project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Uložiť nastavenia"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Uložiť"
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Mierka:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
msgid "%s. Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
msgid "Search Unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr "druhý konfiguračný adresár, v ktorom Lazarus hľadá súbory konfigurácie šablón. Predvolený je "
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Pozri správy."
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sPozrite Projekt -> Inšpektor projektu"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Vyberte položku pomoci:"
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Zvoľte uzol"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Zvoľte súbory formulárov Delphi (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerebuilt
|
|
msgid "Selected %d modes were successfully built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Vybrať súbor"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
msgid "Select Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Výber presahuje reťazcovú konštantu"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Nástroj výberu"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
msgid "Select path to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr "Nastaviť predvolené"
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr "Krátky:"
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Zobraziť gutter"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Zobraziť rady v Inšpektore objektov"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Zobraziť identifikátory"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Zobraziť balíčky"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Zobraziť špeciálne znaky"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Zobraziť jednotky"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr "zobrazí verziu a skončí"
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Skrátiť na najmenšie"
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Súrodenec"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
#, fuzzy
|
|
#| msgid "Simple Syntax"
|
|
msgid "Simple syntax"
|
|
msgstr "Jednoduchá syntax"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Preskočiť súbor a pokračovať v načítaní"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Preskočiť otváranie posledného projektu"
|
|
|
|
#: lazarusidestrconsts.lisskipthesewarnings
|
|
msgid "Skip these warnings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Vhovujúce"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Prepáčte, tento typ zatiaľ nie je implementovaný"
|
|
|
|
#: lazarusidestrconsts.lissortforscope
|
|
msgid "Sort for scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Vzostupne"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Citlivé na veľkosť"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Zostupne"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Doména"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Ignorovať medzery"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Riadky"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Voľby"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Odseky"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Ukážka"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Prijať"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Zoradiť výber"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Slová"
|
|
|
|
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
|
|
msgid "Sort Unicode range list alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Zdroj a cieľ sú rovnaké: %s%s"
|
|
|
|
#: lazarusidestrconsts.lissourcebreakpoint
|
|
#, fuzzy
|
|
#| msgid "&Source Breakpoint..."
|
|
msgid "&Source Breakpoint ..."
|
|
msgstr "&Zdrojový bod prerušenia"
|
|
|
|
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
|
#, fuzzy,badformat
|
|
#| msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
|
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
|
|
msgstr "Zdrojový adresár %s%s%s%sa cieľový adresár %s%s%s%ssú tie isté.%s%sMožno ste nepochopili túto funkciu.%sFunkcia vyčistí/znovavytvorí cieľový adresár %sa kopíruje do neho balíček/projekt."
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
#, fuzzy,badformat
|
|
#| msgid "Source directory %s%s%s does not exist."
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Adresár zdrojových kódov %s%s%s neexistuje."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Zdrojový kód zmenený"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, fuzzy,badformat
|
|
#| msgid "Source of page %s%s%s has changed. Save?"
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Zdrojový kód stránky %s%s%s bol zmenený. Uložiť?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Cesty zdrojových kódov"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Rovnaká medzera"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr "Zdrojový OS"
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Hľadanie"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Hľadaný text"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Začať nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Zastaviť"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Zastaviť aktuálne ladenie a prebudovať projekt?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Zastaviť ladenie?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Zastaviť ladenie?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Zastaviť pri výnimke"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Zastaviť ladenie?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstrangelpifile
|
|
msgid "Strange lpi file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Chyba streamovania"
|
|
|
|
#: lazarusidestrconsts.lisstring
|
|
msgid "String"
|
|
msgstr "Reťazec"
|
|
|
|
#: lazarusidestrconsts.lisstyle
|
|
msgctxt "lazarusidestrconsts.lisstyle"
|
|
msgid "Style"
|
|
msgstr "Štýl"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Podprocedúra"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Podprocedúra na rovnakej úrovni"
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Úspešné"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "Revízia SVN: "
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Neplatné meno premennej"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid identifier."
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "%s%s%s nie je platný identifikátor."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Prepísať systémovú premennú"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Mód syntaxe"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tabulátor"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
#, fuzzy,badformat
|
|
#| msgid "Tab Order of"
|
|
msgid "Tab Order of %s"
|
|
msgstr "Poradie pre tabulátor"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
msgid "Tabs for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listakesnapshot
|
|
msgid "Take a Snapshot"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
msgid ", Target: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Cieľový CPU"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Meno súboru cieľového projektu"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Cieľový OS"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testovací adresár"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
#, fuzzy,badformat
|
|
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Trieda %s%s%s je TControl a môže byť vložená len do ovládacieho prvku.%sNemožno vložiť."
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
#, fuzzy,badformat
|
|
#| msgid "The Codetools found an error:%s%s%s"
|
|
msgid "The Codetools found an error:%s%s"
|
|
msgstr "CodeTools našiel chybu:%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The command after %s%s%s is not executable."
|
|
msgid "The command after \"%s\" is not executable."
|
|
msgstr "Príkaz za %s%s%s nie je spustiteľný."
|
|
|
|
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The command after publishing is invalid:%s%s%s%s"
|
|
msgid "The command after publishing is invalid:%s\"%s\""
|
|
msgstr "Príkaz pred publikovaním je neplatný:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr "Komponent %s nemožno zmazať, pretože nie je vlastnený %s."
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
#, fuzzy,badformat
|
|
#| msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr "Editor komponentu triedy %s%s%s vytvoril chybu:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
#, fuzzy,badformat
|
|
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr "Editor komponentu triedy %s%s%s%svyvolaný príkazom #%s %s%s%s%svytvoril chybu:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr "Komponent %s je dedí od %s.%sPre zmazanie dedeného komponentu otvorte predka a zmažte ho tam."
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
#, fuzzy,badformat
|
|
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr "Debuger %s%s%s%sneexistuje, alebo nie je spustiteľný.%s%sPozrite Prostredie -> Voľby debugera"
|
|
|
|
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
|
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, fuzzy,badformat
|
|
#| msgid "The destination directory%s%s%s%s does not exist."
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Cieľový adresár %s%s%s%s neexistuje."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
#, fuzzy,badformat
|
|
#| msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr "Cieľový adresár %s%s%s neexistuje.%sProsím skontrolujte cieľové meno súboru projektu v Projekt > Voľby projektu."
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
#, fuzzy,badformat
|
|
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Adresár %s%s%s nie je viac potrebný v ceste jednotiek.%sOdstrániť ho?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
|
msgid "The directory \"%s\" is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
|
#, fuzzy,badformat
|
|
#| msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
|
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
|
|
msgstr "Adresár %s%s%s zatiaľ nie je v ceste jednotiek.%sPridať ho?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr "Nenájdený adresár %s."
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s"
|
|
msgid "The file \"%s\""
|
|
msgstr "Súbor %s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
|
msgid "The file %s does not look like a lpi file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
|
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
|
msgstr "Súbor %s%s%s je symbolický odkaz. %s%sOtvoriť %s%s%s namiesto neho?"
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "Súbor %s%s%s%svyzerá byť programom. Zatvoriť aktuálny projekt a vytvoriť nový projekt Lazarus z tohoto programu?%s\"Nie\" načíta súbor ako bežný zdrojový kód."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
#, fuzzy
|
|
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr "Súbor %s vyzerá byť programovým súborom existujúceho projektu Lazarus."
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
|
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
|
msgstr "Súbor %s%s%s%sbol nájdený v jednom zo zdrojových adresárov balíčka %s a vyzerá ako preložená jednotka. Preložené jednotky musia byť vo výstupnom adresári balíčka, inak môžu mať iné balíčky problémy s použitím tohoto balíčka.%s%sZmazať tento súbor?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Súbor %s%s%s%snebol nájdený.%sChcete ho nájsť sám?%s"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Súbor %s%s%s%snebol nájdený.%sZvoľte Ignorovať pre pokračovanie v načítaní projektu,%sZvoľte Zrušiť pre zastavenie načítania."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
#, fuzzy,badformat
|
|
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Nasledujúce metódy použité v %s nie sú v zdrojovom kóde%s%s%s%s%s%sOdstrániť tieto odkazy?"
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
#, fuzzy,badformat
|
|
#| msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr "Kláves %s%sis už je priradený k %s.%s%sOdstrániť staré priradenie a priradiť kláves novej funkcii%s%s?"
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
#, fuzzy,badformat
|
|
#| msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr "Program %s%spotrebný pre spustenie neexistuje alebo nie je spustiteľný.%sChcete ho vytvoriť?%s%sViz nastavenia v Projekt -> Voľby projektu -> Aplikácia."
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
#, fuzzy,badformat
|
|
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Spúšťacia aplikácia %s%s%s%sneexistuje alebo nie je spustiteľná.%s%sViz Spustiť -> Parametre spustenia -> Lokálne"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
#, fuzzy
|
|
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "Súbor LFM (formulár Lazarus) obsahuje neplatné vlastnosti. To znamená, napríklad, že obsahuje nejaké vlastnosti/triedy, ktoré neexistujú v aktuálnom LCL. Štandardná oprava je odstrániť tieto vlastnosti z lfm a ručne opraviť kód Pascalu."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
#, fuzzy
|
|
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr "Nová jednotka zatiaľ nie je v ceste hľadaní jednotiek.%sPridať adresár %s?"
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
#, fuzzy,badformat
|
|
#| msgid "The output directory %s%s%s is missing."
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr "Výstupný adresár %s%s%s chýba."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr "Výstupný adresár %s je v zozname ciest hľadania include %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr "Výstupný adresár %s je v zdedenom zozname ciest hľadania include %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr "Výstupný adresár %s je v zozname zdedených ciest hľadania is jednotiek %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr "Výstupný adresár %s je v zozname ciest hľadania jednotiek%s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr "Výstupný adresár musí byť samostatný adresár a nesmie obsahovať žiadne zdrojové súbory."
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Balíšek už obsahuje jednotku s takýmto menom"
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
msgid "The package %s is already in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
#, fuzzy,badformat
|
|
#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr "Program %smake%s nebol nájdený.%sTento nástroj je potrebný na prebudovanie Lazarus.%s"
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, fuzzy,badformat
|
|
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Informačný súbor projektu %s%s%s%sje zhodný so záladným súborom zdrojového kódu!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, fuzzy
|
|
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Pred vybudovaním musíte projekt uložiť%sAk ste nastavili testovací adresár vo voľabch prostredia,%smôžete nový projekt naraz vytvoriť a vybudovať.%sUložiť projekt?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources, which require at least FPC 2.4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherearenoconflictingkeys
|
|
msgid "There are no conflicting keys."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
#, fuzzy,badformat
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "V adresári sú iné súbory s rovnakým menom,%s%sktoré sa líšia len veľkosťou písmen:%s%s%sZmazať ich?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Na disku už je súbor s rovnakým menom a podobnou koncovkou%sSúbor: %s%sNeplatný súbor: %s%s%sZmazať neplatný súbor?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a form with the name %s%s%s"
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Formulár s menom %s%s%suž existuje"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
msgid "There is already a package %s in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Jednotka s menom %s%s%suž existuje. Identifikátory Pascal musia byť unikátne."
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Jednotka s menom %s%s%s už v projekte existuje.%s"
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
#, fuzzy,badformat
|
|
#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr "Zdrojová trieda %s%s%s pochádza z %s%s%s. Možno je to preklep pre TForm."
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Pri zápise zvoleného komponentu nastala chyba %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Pri konvertovaní binárneho streamu zvoleného kompoenntu nastala chyba %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Pri kopírovaní streamu komponentu dos chránky nastala chyba:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
#, fuzzy
|
|
#| msgid "The root component can not be deleted."
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Koreňový komponent nemôže byť zmazaný."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
msgid "The target %s is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
msgid "The unit belongs to package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Jednotka %s existuje dvakrát v ceste jednotiek %s:"
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr "Meno súboru jednotky %s%s%s nie je malými písmenami.%sPrekladač FreePascal nehľadá všetky veľkosti. Je lepšie použiť mena súborov s malými písmenami.%s%sPremenovať súbor malými písmenami?"
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Jednotka samotná už má meno%s%s%s. Identifikátory Pascalu musia byť unikátne."
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr "Cesta hľadania jednotiek %s%s%s obsahuje zdrojový adresár %s%s%s balíčka %s"
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
#, fuzzy,badformat
|
|
#| msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr "Pracovný adresár %s%s%s neexistuje.%sProsím skontrolujte pracovný adresár v Spustiť > Parametre spustenia."
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "táto pomocná správa"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
#, fuzzy
|
|
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Vyzerá to ako pascalovský súbor.%sOdporúčame v·mene použiť malé písmená, aby ste predišli problémom na niektorých súborových systémoch a rôznych prekladačoch.%sPremenovať malými písmenami?"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Tento príkaz nemôže byť vytiahnutý.%sProsím vyberte nejaký kód pre vytiahnutie procedúry/metódy."
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreads
|
|
msgctxt "lazarusidestrconsts.listhreads"
|
|
msgid "Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadscurrent
|
|
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuálny"
|
|
|
|
#: lazarusidestrconsts.listhreadsfunc
|
|
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
|
msgid "Function"
|
|
msgstr "Funkcia"
|
|
|
|
#: lazarusidestrconsts.listhreadsgoto
|
|
msgid "Goto"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsline
|
|
msgctxt "lazarusidestrconsts.listhreadsline"
|
|
msgid "Line"
|
|
msgstr "Riadok"
|
|
|
|
#: lazarusidestrconsts.listhreadsnotevaluated
|
|
msgid "Threads not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadssrc
|
|
msgctxt "lazarusidestrconsts.listhreadssrc"
|
|
msgid "Source"
|
|
msgstr "Zdrojový kód"
|
|
|
|
#: lazarusidestrconsts.listhreadsstate
|
|
msgctxt "lazarusidestrconsts.listhreadsstate"
|
|
msgid "State"
|
|
msgstr "Stav"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr "&Nadpis"
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr "Titulok (nechajte prázdne pre predvolený)"
|
|
|
|
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
|
msgid "Choose a component icon 24x24"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Funkcia: pripojiť oddeľovač cesty"
|
|
|
|
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
|
#, fuzzy
|
|
#| msgid "Function: chomp path delimiter"
|
|
msgid "Function: remove trailing path delimiter"
|
|
msgstr "Funkcia: odstrániť oddeľovač cesty"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Funkcia: vybrať príponu súboru"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Funkcia: vybrať meno súboru + príponu"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Funkcia: vybrať len meno súboru"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Funkcia: vybrať cestu súboru"
|
|
|
|
#: lazarusidestrconsts.listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(neznáme makro: %s)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Cesty:"
|
|
|
|
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr "Prepnúť zobrazenie mien súborov s absolútnou alebo relatívnou cestou"
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptions
|
|
msgid "Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionshighlight
|
|
msgid "Highlight toolbars buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionsraise
|
|
msgid "Raise toolbars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Hore"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Horné zarovnanie"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Horný·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·nad·prvkom."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Horné okraje"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·hornej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Rovnaká horná medzera"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
msgid "Total Pages: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
msgid "File: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
msgid "Implementation Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
msgid "implementation uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
msgid "Interface Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
msgid "interface uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
msgid "Scanning: %s units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
msgid "Units: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
msgid "Used by Implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
msgid "used by implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
msgid "used by interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Túto správu už nezobrazovať."
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Chyba v regulárnom výraze"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Font bez UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line :"
|
|
msgid "Goto line:"
|
|
msgstr "Choď na riadok:"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nenájdené"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Nahradiť tento výskyt %s%s%s%s týmto %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Hľadanie: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Hľadaný reťazec '%s' nenájdený!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
#, fuzzy
|
|
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr "Aktuálny font editora nepodporuje UTF-8, ale systém vyzerá, že ho používa.%sTo znamená, že ne ASCII znaky môžu byť zobrazené nesprávne.%sMôžete si vybrať iný font vo voľbách editora."
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Vymazať vyrovnávaciu pamäť include"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s bajtov"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Vložil:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
#, fuzzy
|
|
#| msgid "in Project:"
|
|
msgid "In project:"
|
|
msgstr "v projekte:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Riadky:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Meno:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "nie"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Veľkosť:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "áno"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Zobraziť hodnoty CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Nemožno konvertovať binárny strom na text"
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Nemožno kopírovať komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nemožno pridať komentár hlavičky resource do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nemožno pridať resource T%s:FORMDATA do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "Do projektu nemožno pridať %s, pretože projekt už obsahuje jednotku s rovnakým menom."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Nemožno zálohovať súbor %s%s%s na %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sNemožno zmeniť triedu %s na %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Nemožno vyčistiť cieľový adresár"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Nemožno vyčistiť %s%s%s.%sProsím skontrolujte prístupové práva."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Nemožno konvertovať text komponentu do binárneho formátu:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Nemožno konvertovať súbor %s%s%s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Nemožno konvertovať textové dáta formulára súboru %s%s%s%s%sdo binárneho streamu. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Nemožno kopírovať súbor"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
|
msgstr "Nemožno prekopírovať súbor %s%s%s%sdo %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create backup directory %s%s%s."
|
|
msgid "Unable to create backup directory \"%s\"."
|
|
msgstr "Nemožno vytvoriť záložný adresár %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create directory %s%s%s."
|
|
msgid "Unable to create directory \"%s\"."
|
|
msgstr "Nemožno vytvoriť adresár %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Nemožno vytvoriť súbor"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create file %s%s%s"
|
|
msgid "Unable to create file \"%s\""
|
|
msgstr "Nemožno vytvoriť súbor %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
msgid "Unable to create file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create link %s%s%s with target %s%s%s"
|
|
msgid "Unable to create link \"%s\" with target \"%s\""
|
|
msgstr "Nemožno vytvoriť odkaz %s%s%s s cieľom %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file, because there is already a directory with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
|
msgid "Unable to create new method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Nemožno vytvoriť dočasný LFM bufer"
|
|
|
|
#: lazarusidestrconsts.lisunabletodelete
|
|
msgid "Unable to delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Nemožno zmazať poškodený súbor %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
msgid "unable to execute: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find a valid classname in %s%s%s"
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "Nemožno nájsť platné meno triedy v %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find file %s%s%s."
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Nemožno nájsť súbor %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr "Nemožno nájsť súbor %s%s%s.%sAk patrí do Vášho projektu, skontrolujte cestu hľadaní v %sProjekt->Voľby prekladača ...->Cesty ->Ostatné súbory jednotiek. Ak tento súbor patrí do balíčka, skontrolujte príslušné voľby prekladača balíčka. Ak tento súbor patrí do Lazara, overte vyčistenie prekladu. Ak súbor patrí do FPC, potom skontrolujte fpc.cfg. Ak si nie ste istí, použite Projekt->Voľby prekladača ...-> Test"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Nemožno nájsť %s v streame LFM."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Nemožno získať zmeny editora."
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Nemožno získať zdrojový kód pre návrhára."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
msgid "unable to load file %s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
|
msgid "Unable to load the component class \"%s\", because it depends on itself."
|
|
msgstr "Nemožno načítať triedu komponentu %s%s%s, pretože závisí sama na sebe."
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
msgid "Unable to open \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr "Nemožno otvoriť predka komponentu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Nemožno otvoriť návrhára.%sTrieda %s nie je potomkom triedy ako TForm alebo TDataModule."
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr "Nemožno čítať %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Nemožno čítať súbor"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s!"
|
|
msgid "Unable to read file \"%s\"."
|
|
msgstr "Nemožno čítať súbor %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgid "Unable to read file \"%s\"%sError: %s"
|
|
msgstr "Nemožno čítať súbor %s%s%s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadlpi
|
|
msgid "Unable to read lpi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
|
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
|
msgid "Unable to read the project info file%s\"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to remove old backup file %s%s%s!"
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Nemožno odstrániť starý záložný súbor %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Nemožno premenovať poškodený súbor %s%s%s%sna %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Nemožno premenovať súbor"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
|
msgstr "Nemožno premenovať súbor %s%s%s na %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
|
msgstr "Nemožno premenovať súbor %s%s%s%sna %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Nemožno premenovať formulár v zdrojovom kóde"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Nemožno premenovať metódu, prosím opravte chyby zobrazené v okne správ."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Nemožno premenovať premennú v zdrojovom kóde."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr "Nemožno spustiť"
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
msgid "Unable to run \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Nemožno nastaviť AnchorSide prvku"
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Nemožno streamovať vybraté komponenty"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Nemožno streamovať vybraté komponenty"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Nemožno streamovať %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Nemožno transformovať binárny stream komponentu %s:T%s na text."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Nemožno vytvoriť príkaz CreateForm v zdrojovom kóde projektu"
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write %s%s%s"
|
|
msgid "Unable to write \"%s\""
|
|
msgstr "Nemožno zapísať %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Nemožno zapisovať do súboru"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
msgid "Unable to write file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgid "Unable to write file \"%s\"%sError: %s"
|
|
msgstr "Nemožno zapísať súbor %s%s%s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
|
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
|
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
msgid "Unable to write to file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr "Nemožno zapísať xml stream do %s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Vrátiť"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
msgid "Uninstall %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Odinštalovať výber"
|
|
|
|
#: lazarusidestrconsts.lisunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisunit"
|
|
msgid "Unit"
|
|
msgstr "Jednotka"
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Identifikátor jednotky existuje"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%s unit %s in package %s%s"
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s jednotka %s v balíčku %s%s"
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Meno jednotky už v projekte existuje"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Meno jednotky začína s ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Meno jednotky obsahuje ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
msgid "unit %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinproject
|
|
msgid "A unit not found in project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Výstupný adresár jednotky"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "cesta jednotiek"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Cesty jednotiek"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
msgid "unit %s requires package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
|
msgid "Units not found in project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunsigned
|
|
msgid "Unsigned"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
msgid "Unused units of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "Up"
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
|
msgid "Updating PO files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr "Správa o použití (voľba -h)"
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Použiť ANSI reťazce"
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
msgid " used by %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Use Exclude Filter"
|
|
msgid "Use exclude filter"
|
|
msgstr "Použiť vylučovací filter"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseincludefilter
|
|
#, fuzzy
|
|
#| msgid "Use Include Filter"
|
|
msgid "Use include filter"
|
|
msgstr "Použiť zahŕňací filter"
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Spúšťanie aplikácie"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
msgid "Use package %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
msgid "Use package %s in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
msgid "Add to list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
msgid "Remove from list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Domovský adresár používateľa"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Hodnota"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
msgid "Value%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Premenná"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Overiť volania metód"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Verzia"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Zvislo"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Kopírovať informácie o verzii do schránky"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewbreakpointproperties
|
|
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsource
|
|
msgid "View Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcedisass
|
|
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
|
msgid "View Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Zobraziť zdrojový kód (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
|
|
msgstr "Upozornenie: Nájdený nejednoznačný súbor: %s%s%s. Zdrojový kód je: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
msgid ", Warnings: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatch
|
|
msgid "&Watch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchdata
|
|
msgid "Watch:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkind
|
|
msgid "Watch action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindread
|
|
msgid "Read"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindreadwrite
|
|
msgid "Read/Write"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindwrite
|
|
msgid "Write"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpoint
|
|
msgid "&Data/Watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpointbreakpoint
|
|
msgid "&Data/watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr "Pozorovať vlastnosti"
|
|
|
|
#: lazarusidestrconsts.liswatchscope
|
|
msgid "Watch scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchscopeglobal
|
|
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
|
msgid "Global"
|
|
msgstr "Globálne"
|
|
|
|
#: lazarusidestrconsts.liswatchscopelocal
|
|
msgid "Declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchtowatchpoint
|
|
msgid "Create &Data/Watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "S vyžadovanými balíčkami"
|
|
|
|
#: lazarusidestrconsts.liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr "Zma&zať všetko"
|
|
|
|
#: lazarusidestrconsts.liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr "Z&akázať všetko"
|
|
|
|
#: lazarusidestrconsts.liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr "Zap&núť všetky"
|
|
|
|
#: lazarusidestrconsts.liswlexpression
|
|
msgid "Expression"
|
|
msgstr "Výraz"
|
|
|
|
#: lazarusidestrconsts.liswlinspectpane
|
|
msgid "Inspect pane"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Vlastnosti"
|
|
|
|
#: lazarusidestrconsts.liswlwatchlist
|
|
#, fuzzy
|
|
#| msgid "Watch list"
|
|
msgid "Watch List"
|
|
msgstr "Zoznam Pozorovaní"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Slovo na kurzore aktuálneho editora"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Pracovný adresár pre budovanie"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Pracovný adresár pre spustenie"
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Chyba zápisu"
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr "Chyba zápisu: %s%sSúbor: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
msgid "wrong version in %s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr "XML Chyba"
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr "Chyba parsera XML v súbore %s%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisyes
|
|
msgid "Yes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
#, fuzzy
|
|
#| msgid "You can not build lazarus while debugging or compiling."
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<Všetko>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor kódu"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
msgid "lpk file valid (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr "Pridať jednotku balíčka do sekcie uses"
|
|
|
|
#: lazarusidestrconsts.regdlgbinary
|
|
msgctxt "lazarusidestrconsts.regdlgbinary"
|
|
msgid "Binary"
|
|
msgstr "Binárny"
|
|
|
|
#: lazarusidestrconsts.regdlgdecimal
|
|
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
|
msgid "Decimal"
|
|
msgstr "Desiatkovo"
|
|
|
|
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
|
msgid "Display type for selected Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgformat
|
|
msgid "Format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlghex
|
|
msgid "Hex"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgraw
|
|
msgid "Raw"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Pridať obrátene"
|
|
|
|
#: lazarusidestrconsts.rsattachto
|
|
msgid "Attach to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Automaticky zvyšovať číslo vybudovania"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
#, fuzzy
|
|
#| msgid "Build:"
|
|
msgid "&Build:"
|
|
msgstr "Vybudovať:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Množina znakov:"
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page"
|
|
msgstr "zatvoriť túto stránku"
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Podmienené definície"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Vytvoriť novú definíciu"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Zapnúť i18n"
|
|
|
|
#: lazarusidestrconsts.rsenterpid
|
|
msgid "Enter PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found, but not listed here: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
|
|
msgid "Force update PO files on next compile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Voľby i18n"
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
#, fuzzy
|
|
#| msgid "Include Version Info in executable"
|
|
msgid "Include version info in executable"
|
|
msgstr "Do preloženého programu zahrnúť informácie o verzii"
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
|
msgid "Column Names"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
|
msgid "Strategy for saving Columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
|
msgid "Column Width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometry
|
|
msgid "Custom geometry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
|
msgid "User can define window's position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
|
msgid "Fixed default geometry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
|
msgid "Always the same fixed position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
|
msgid "Let windowmanager decide"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
|
msgid "System windowmanagers have different strategies for positioning windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
|
msgid "Windows that have been open. They may be closed now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Obnoviť geometriu okien"
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
|
msgid "Use previous position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
|
msgid "Custom Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterdefault
|
|
msgid "Default Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
|
msgid "Restore with window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
|
msgid "Restore Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "Africky"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "Arabsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
#, fuzzy
|
|
#| msgid "Automatic (or english)"
|
|
msgid "Automatic (or English)"
|
|
msgstr "Automaticky (alebo anglický)"
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "Katalánsky"
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "Čínsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageczech
|
|
msgid "Czech"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "Holandsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "Anglicky"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "Finsky"
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr "Francúzsky"
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "Nemecky"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "Hebrejsky"
|
|
|
|
#: lazarusidestrconsts.rslanguagehungarian
|
|
msgid "Hungarian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "Indonézsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "Taliansky"
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "Japonsky"
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "Litovsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Voľby jazyka"
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "Poľsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguese
|
|
msgid "Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguesebr
|
|
msgid "Brazilian Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "Ruský"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Výber jazyka:"
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr "Slovensky"
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "Španielsky"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr "Turecky"
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "Ukrajinsky"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Ostatné informácie"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "Výstupný adresár pre .po:"
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgid "File name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr "Vybrať zdedenú položku"
|
|
|
|
#: lazarusidestrconsts.rsstartanewsearch
|
|
msgid "Start a new search"
|
|
msgstr "Začať nové hľadanie"
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Číslovanie verzií"
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Príkazu menu Help"
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Príkazy Command"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "Príkazy CodeTools"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Príkazy presunu kurzora"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Príkazy úpravy textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Príkazy menu Súbor"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makrá"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
#, fuzzy
|
|
#| msgid "Text marker commands"
|
|
msgid "Text bookmark commands"
|
|
msgstr "Príkazy značkovania textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Príkazy menu Balíček"
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Príkazy menu Projekt"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Príkazy menu Spustiť"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Príkazy hľadania a nahradzovania textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Príkazy výberu textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Príkazy zdrojových poznámok"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Príkazy menu Nástroje"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Príkazy menu Zobraziť"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Príkaz:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflikt"
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "zrušiť budovanie"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
#, fuzzy
|
|
#| msgid "Add jump point"
|
|
msgid "Add Jump Point"
|
|
msgstr "Pridať bod skoku"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "pridať pozorovanie"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Šablóny dokončovania kódu"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Zväčšiť odsadenie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Zmenšiť odsadenie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "vybudovať program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "vybudovať súbor"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build lazarus"
|
|
msgid "Build Lazarus"
|
|
msgstr "Vybudovať Lazarus"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Znak"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Zmazať celý text"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Stĺpcový režim výberu"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "konfiguračný súbor budovania"
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
#, fuzzy
|
|
#| msgid "Copy selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Kopírovať výber do schránky"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
#, fuzzy
|
|
#| msgid "Cut selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Vystrihnúť výber do schránky"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Zmazať po začiatok riadka"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Zmazať znak na kurzore"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Zmazať do konca riadka"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Zmazať posledná znak"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Zmazať po začiatok slova"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Zmazať aktuálny riadok"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Zmazať do konca slova"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Rozdiely"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Posunúť kurzor na úplný koniec"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Posunúť kurzor o na úplný začiatok"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "vyskúšať/zmeniť"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure"
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Oddeliť procedúru"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Externý nástroj %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Nastavenie externých nástrojov"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
#, fuzzy
|
|
#| msgid "Find text"
|
|
msgid "Find Text"
|
|
msgstr "Nájsť text"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Nájsť druhý koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Nájsť začiatok bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
#, fuzzy
|
|
#| msgid "Find declaration"
|
|
msgid "Find Declaration"
|
|
msgstr "Nájsť deklaráciu"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
#, fuzzy
|
|
#| msgid "Find identifier references"
|
|
msgid "Find Identifier References"
|
|
msgstr "Nájsť odkazy na identifikátor"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find in files"
|
|
msgid "Find in Files"
|
|
msgstr "Nájsť v súboroch"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
#, fuzzy
|
|
#| msgid "Find next"
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Nájsť ďalšie"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find next word occurrence"
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Nájsť ďalší výskyt slova"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
#, fuzzy
|
|
#| msgid "Find previous"
|
|
msgid "Find Previous"
|
|
msgstr "Nájsť predchádzajúci"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find previous word occurrence"
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Nájsť predchádzajúci výskyt slova"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
#, fuzzy
|
|
#| msgid "Find procedure definiton"
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Nájsť definíciu procedúry"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
#, fuzzy
|
|
#| msgid "Find procedure method"
|
|
msgid "Find Procedure Method"
|
|
msgstr "Nájsť metódu procedúry"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
msgid "Fold to Level %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Choď na editor %d "
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Go to to include directive of current include file"
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Choď na direktívu include aktuálneho include súboru"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
#, fuzzy
|
|
#| msgid "Go to line number"
|
|
msgid "Go to Line Number"
|
|
msgstr "Choď na riadok číslo"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
#, fuzzy
|
|
#| msgid "Go to Marker %d"
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Choď na značku %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Choď na XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced $IFDEF"
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Odhadni zle umiestnený $IFDEF"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Vložiť položku ChangeLog"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Vložiť z mapy znakov"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Vložiť kľúčové slovo CVS Author"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Vložiť kľúčové slovo CVS Date"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Vložiť kľúčové slovo CVS Header"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Vložiť kľúčové slovo CVS ID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Vložiť kľúčové slovo CVS Log"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Vložiť kľúčové slovo CVS Name"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Vložiť kľúčové slovo CVS Revision"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Vložiť kľúčové slovo CVS Source"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Vložiť aktuálny dátum a čas"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Vložiť vyhlásenie GPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Vložiť GUID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Vložiť LGPL vyhlásenie"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Zalomiť·riadok·a·ponechať kurzor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Režim vkladania"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Vložiť upravené LGPL vyhlásenie"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Vložiť aktuálne používateľské meno"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "skontrolovať"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
#, fuzzy
|
|
#| msgid "Invert assignment"
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Otočiť priradenie"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "šípka vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "šípka vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Zalomiť riadok a presunúť kurzor"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Posunúť kurzor na koniec riadka"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Riadkový režim výberu"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Posunúť kurzor na začiatok riadka"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
#, fuzzy
|
|
#| msgid "Make resource string"
|
|
msgid "Make Resource String"
|
|
msgstr "Vytvoriť ResourceString"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Choď na vyhovujúcu zátvorku"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Okno editora vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Posunúť editor úplne vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Okno editora vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Posunúť editor úplne vpraco"
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Nasledujúca záložka"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Choď na nasledujúci editor"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normálny režim výberu"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "Open file at cursor"
|
|
msgid "Open File at Cursor"
|
|
msgstr "Otvoriť súbor na kurzore"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Režim prepisovania"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Posunúť kurzor na spodok strany"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Posunúť kurzor o stranu dole"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Posunúť kurzor o stranu vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Posunúť kurzor o stranu vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Posunúť kurzor na začiatok strany"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Posunúť kurzor o jednu stranu hore"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
#, fuzzy
|
|
#| msgid "Paste clipboard to current position"
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Vložiť zo schránky na aktuálnu pozíciu"
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "prerušiť program"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Predchádzajúca záložka"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Choď na predchádzajúci editor"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "rýchly preklad, nelinkuje"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
#, fuzzy
|
|
#| msgid "remove break point"
|
|
msgid "remove breakpoint"
|
|
msgstr "odstrániť bod prerušenia"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
#, fuzzy
|
|
#| msgid "Remove empty methods"
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Odstrániť prázdne metódy"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
#, fuzzy
|
|
#| msgid "Rename identifier"
|
|
msgid "Rename Identifier"
|
|
msgstr "Premenovať identifikátor"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
#, fuzzy
|
|
#| msgid "Replace text"
|
|
msgid "Replace Text"
|
|
msgstr "Nahradiť text"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Hlásenie chyby ..."
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "reštartovať debuger"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "spustiť program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "spustiť súbor"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "parametre spustenia"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Rolovať o riadok dole"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Rolovať o znak vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Rolovať o znak vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Rolovať o riadok hore"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Vybrať dole"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrať všetky"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Konvertuj tabulátory na medzery vo výbere"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Vybrať po úplný koniec"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Vybrať po úplný začiatok"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "Select Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Vybrať do konca riadka"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Vybrať po začiatok riadka"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Vybrať do konca strany"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Vybrať stranu dole"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Vybrať stranu vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "vybrať stranu vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Vybrať vrch strany"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Vybrať stranu hore"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "Select Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Vybrať hore"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Vybrať slovo vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Vybrať slovo vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Nastaviť voľnú záložku"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, fuzzy
|
|
#| msgid "Set Marker %d"
|
|
msgid "Set bookmark %d"
|
|
msgstr "Nastav značku %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift Tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
#, fuzzy
|
|
#| msgid "Show abstract methods"
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Zobraziť abstraktné metódy"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
#, fuzzy
|
|
#| msgid "Show code context"
|
|
msgid "Show Code Context"
|
|
msgstr "Zobraziť kontext kódu"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "zastaviť program"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Syntax check"
|
|
msgid "Syntax Check"
|
|
msgstr "Kontrola syntaxe"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Zobraziť body prerušenia"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Zobraziť Zásobník volaní"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Zobraziť Prehliadač kódu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Zobraziť Prieskumník kódu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Zobraziť Paletu komponentov"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Zobraziť výstup debugera"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Prepnúť medzi formulárom a jednotkou"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Zobraziť Editor dokumentácie"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Zobraziť tlačítka IDE"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Zobraziť lokálne premenné"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
msgid "Toggle bookmark %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Zobraziť Správy"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Režim prepínania"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Zobraziť Inšpektor objektov"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Zobraziť obmedzenia prehliadača"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Zobraziť Výsledky hľadania"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Zobraziť editor zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Zobraziť Pozorovania"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "neznámy príkaz editora"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Zobraziť Editor ukotvenia"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Zobraziť komponenty"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Zobraziť formuláre"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Zobraziť závislosti jednotiek"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Zobraziť info o jednotke"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Zobraziť jednotky"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
#, fuzzy
|
|
#| msgid "Word completion"
|
|
msgid "Word Completion"
|
|
msgstr "Dokončovanie slov"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Posunúť kurzor o slovo vľavo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Posunúť kurzor o slovo vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr "Uparviť klávesy príkazu"
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Súbor je len na čítanie"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Súbor \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" nie je zapisovateľný."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "&Pridať pozorovanie v mieste kurzora"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Záložka"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Zatvoriť stránku"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
#, fuzzy
|
|
#| msgid "Copy filename"
|
|
msgid "Copy Filename"
|
|
msgstr "Kopírovať meno súboru"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Ladiť"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Kódovanie"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Nájsť deklaráciu"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Choď na záložku"
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Zvýrazňovač"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Skontrolovať ..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Otočiť priradenie"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto next Bookmark"
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Choď na ďalšiu záložku"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Zmenené"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "&Open file at cursor"
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Otvoriť súbor pod kurzorom"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto previous Bookmark"
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Choď na predchádzajúcu záložku"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Prejsť na procedúru"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Len na čítanie"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refactoring"
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free Bookmark"
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Nastaviť voľnú záložku"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Zobraziť čísla riadkov"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Zdrojový kód"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Zobraziť Zásobník volaní"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Zatiaľ neimplementované"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "INS"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "OVR"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Len na čítanie"
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Informácie o verzii"
|
|
|