mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-17 01:49:25 +02:00
21813 lines
543 KiB
Plaintext
21813 lines
543 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: Free Pascal Lazarus Project.\n"
|
||
"Report-Msgid-Bugs-To: Abou Al Montacir <abou.almontacir@sfr.fr\n"
|
||
"POT-Creation-Date: yyyy-mm-dd hh:mm+0000\n"
|
||
"PO-Revision-Date: 2012-05-10 10:25+0100\n"
|
||
"Last-Translator: Khaled Shagrouni <shagrouni@gmail.com>\n"
|
||
"Language-Team: Arabic\n"
|
||
"Language: arabic\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"Plural-Forms: nplurals=1; plural=0\n"
|
||
"X-Generator: Easy Po 0.9.2\n"
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
|
||
#, object-pascal-format
|
||
msgid "Address Breakpoint %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakataddress
|
||
#, object-pascal-format
|
||
msgid "at $%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
|
||
#, object-pascal-format
|
||
msgid "at $%s: from origin %s line %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
|
||
#, object-pascal-format
|
||
msgid "at $%s: %s line %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
|
||
#, object-pascal-format
|
||
msgid "Source Breakpoint %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
||
#, object-pascal-format
|
||
msgid "Unknown Breakpoint %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
||
#, object-pascal-format
|
||
msgid "Watchpoint %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
|
||
#, object-pascal-format
|
||
msgid "Unknown Watchpoint out of scope %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
|
||
#, object-pascal-format
|
||
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventwatchscopeended
|
||
#, object-pascal-format
|
||
msgid "Watchpoint for \"%s\" out of scope %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgeventwatchtriggered
|
||
#, object-pascal-format
|
||
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
||
msgid "Use predefined scheme"
|
||
msgstr "إستخدم المخطط المحدد سلفا"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr "إلغ كلّ الإعدادات"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr "إلغ كلّ إعدادات النّصّ"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
||
msgid "Add history point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
||
msgid "Context Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
||
msgid "Context Menu (debug)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
||
msgid "Context Menu (tab)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
||
msgid "Jumps to implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
||
msgid "Jumps to implementation/other block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
||
msgid "History back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
||
msgid "History forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
||
msgid "Toggle extra Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
||
msgid "Paste"
|
||
msgstr "ألصق"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
||
#, object-pascal-format
|
||
msgid "Continue %0:s (Bound to: %1:s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
||
#, object-pascal-format
|
||
msgid "Continue %0:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
||
msgid "Select text"
|
||
msgstr "عيّن نصّا"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
||
msgid "Select text (lines)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
||
msgid "Select text (tokens)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
||
msgid "Select text (words)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
||
#, fuzzy
|
||
#| msgid "Select text (Columns)"
|
||
msgid "Select text (Column mode)"
|
||
msgstr "عيّن نصّا عموديّا"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
||
#, fuzzy
|
||
#| msgid "Select text (Lines)"
|
||
msgid "Select text (Line mode)"
|
||
msgstr "عيّن نصّا أفقيّا"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
||
msgid "Set free bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
||
msgid "Select current Line (Full)"
|
||
msgstr "عيّن السّطر الحاليّ كاملا"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
||
msgid "Select current Line (Text)"
|
||
msgstr "ّعيّن النّصّ قي السّطر الحالي"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
||
msgid "Select current Paragraph"
|
||
msgstr "عيّن الفقرة الحاليّة"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
||
msgid "Select current Word"
|
||
msgstr "عيّن الكلمة الحاليّة"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
||
msgid "Reset zoom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "عامّ"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
||
msgid "Extended, Actions, right gutter half only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
||
msgid "Use line numbers to select lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right button click includes caret move"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "نصّ"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
||
msgid "Alt-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
||
msgid "Alt-Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
||
msgid "Alt Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
||
msgid "Alt Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
||
msgid "Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
||
msgid "Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
msgid "Drag selection (copy/paste)"
|
||
msgstr "جرّ المعيّن (نسخ ولصق("
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
||
msgid "Extra-1 Button"
|
||
msgstr "زرّ إضافي-1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
||
msgid "Extra-2 Button"
|
||
msgstr "زرّ إضافي-2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
||
msgid "Alt Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
||
msgid "Ctrl Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
||
msgid "Double"
|
||
msgstr "مضاعف"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
||
msgid "Shift Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
||
msgid "Quad"
|
||
msgstr "رباعي"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
||
msgid "Triple"
|
||
msgstr "ثلاثي"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr "الزّر الأوسط"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
||
msgid "Middle"
|
||
msgstr "الأوسط"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
||
msgid "Extra 1"
|
||
msgstr "الإضافي 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
||
msgid "Extra 2"
|
||
msgstr "الإضافي 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
|
||
msgid "Horizontal-Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
||
msgid "Left 1"
|
||
msgstr "الأيسر 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
||
msgid "Left 2"
|
||
msgstr "الﻷيسر 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
||
msgid "Right"
|
||
msgstr "الأيمن"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
||
msgid "Wheel"
|
||
msgstr "العجلة"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
||
msgid "Right Button"
|
||
msgstr "الزّر الأيمن"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
||
msgid "Shift-Alt-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
||
msgid "Shift-Alt-Ctrl"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
||
msgid "Shift-Alt Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
||
msgid "Shift-Alt Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
||
msgid "Shift-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
||
msgid "Shift-Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
||
msgid "Shift Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
||
msgid "Wheel"
|
||
msgstr "العجلة"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
||
msgid "Shift Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
||
msgid "Scroll horizontal (System speed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
||
msgid "Scroll horizontal (Single line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
||
msgid "Scroll horizontal (Page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
||
msgid "Scroll horizontal (Half page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
||
msgid "Scroll horizontal (Page, less one line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
||
msgid "Scroll (System speed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
||
msgid "Scroll (Single line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
||
msgid "Scroll (Page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
||
msgid "Scroll (Half page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
||
msgid "Scroll (Page, less one line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
||
msgid "Zoom"
|
||
msgstr "تضخيم"
|
||
|
||
#: lazarusidestrconsts.dlfnopredefinedscheme
|
||
msgid "< None >"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfreadonlycolor
|
||
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
||
msgid "Read Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgactivedesktop
|
||
msgid "active"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
msgid "Brackets highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdefault
|
||
msgid "Default Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
|
||
msgid "Default Text / Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
msgid "Folded code marker"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
||
msgid "Fold start-line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
||
msgid "IfDef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
||
msgid "Outline Colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "نصّ"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
||
msgid "Hide start-line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
msgid "Incremental others"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
|
||
msgid "Highlight prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
msgid "Incremental search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
msgid "Current line highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
msgid "Mouse link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
|
||
msgid "Level 10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
|
||
msgid "Level 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
|
||
msgid "Level 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
|
||
msgid "Level 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
|
||
msgid "Level 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
|
||
msgid "Level 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
|
||
msgid "Level 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
|
||
msgid "Level 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
|
||
msgid "Level 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
|
||
msgid "Level 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
msgid "Selected Area"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwindowborder
|
||
msgid "Window border"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
||
msgid "Visualized Special Chars"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddnewmode
|
||
msgid "Add new mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "أضف فاصلة منقوطة"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "هجائيّا"
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always keep caret in visible area of editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
||
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgansicommenttab
|
||
msgid "Ansi (* *)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
msgid "Application settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
msgid "Include assertion code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgassociateddebugdesktop
|
||
#, object-pascal-format
|
||
msgid "Associated debug desktop for \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgassociateddebugdesktophint
|
||
msgid "If you select the desktop, the associated debug desktop will be selected as well."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautocreateformshint
|
||
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "Auto-create new forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
||
msgid "Auto Display Function Prototypes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse pointer when typing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgctxt "lazarusidestrconsts.dlgautoindent"
|
||
msgid "Auto indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoindentlink
|
||
msgid "(Set up smart indent)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoindenttype
|
||
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
||
msgid "Auto indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
||
msgid "Auto save active desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
||
msgid ""
|
||
"Save active desktop on IDE close\n"
|
||
"Save debug desktop on IDE close and debug end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgavailableformshint
|
||
msgid "These forms must be created and freed in the program code."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
|
||
msgid "Avoid unnecessary jumps"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "الخلفيّة"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(هذا الملف لا يحتوي على ملفات)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
||
msgid "Selection"
|
||
msgstr "تعيين"
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
msgid "Block indent (spaces)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindentkeys
|
||
msgid "Block indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindentlink
|
||
msgid "(edit keys)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
||
msgid "Tabs, cut off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
||
msgid "Tabs, then spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblocktabindent
|
||
msgid "Block indent (tabs)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
||
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgborderspacingcolor
|
||
msgid "BorderSpacing frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbracketmatchgroup
|
||
msgid "Matching bracket and quote pairs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
||
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretbackcolor
|
||
msgid "Secondary carets (multi-caret mode)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretcolor
|
||
msgctxt "lazarusidestrconsts.dlgcaretcolor"
|
||
msgid "Caret (Text-Cursor)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretcolorinfo
|
||
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretforecolor
|
||
msgid "Main or primary caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretgroupoptions
|
||
msgid "Caret (Text Cursor)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
|
||
msgid "Caret (Text Cursor) past end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "التّحقّق من خيارات التّرجمة"
|
||
|
||
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
||
#, object-pascal-format
|
||
msgid "orphaned file found: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr "النّتائج"
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "إختبار"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "إختبار التّحقّق من المترجم ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "إختبار التّحقّق من خيارات المترجم"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestrtlunits
|
||
msgid "Test: Checking RTL units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccousingconfigfile
|
||
#, object-pascal-format
|
||
msgid "using config file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "الأخير"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
msgid "Preview (max line length = 1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
msgid "Save As - auto rename Pascal files lower case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
||
msgid "Check and Auto Save Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
||
msgid "Check packages on form create"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
||
msgid "The form may require a package to work. Install such a package automatically."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
msgid "C style macros (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
||
msgid "Use Ansistrings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
msgid "Assembler style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcochecksandassertion
|
||
msgid "Checks and assertion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocompilercommands
|
||
msgid "Compiler Commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
msgid "C style operators (*=, +=, /= and -=)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
#, fuzzy
|
||
#| msgid "Debugging info"
|
||
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
||
msgid "Debugging"
|
||
msgstr "معلومات التّنقيح"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "إضافة لمسار المنقّح (لا شيئ):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenableboth
|
||
msgid "Both"
|
||
msgstr "كلاهما"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablefold
|
||
msgid "Fold"
|
||
msgstr "إطو"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablehide
|
||
msgid "Hide"
|
||
msgstr "إخف"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
||
msgid "Reverse fold-order in Popup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
msgid "Generate info for the debugger (slower / increases exe-size)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
msgid "Use Heaptrc unit (check for mem-leaks)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
msgid "Include files (-Fi):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoinfoforgdb
|
||
msgid "Debugger info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "الرّبط"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsavehint
|
||
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
||
msgid "Compiler options can be saved to an XML file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolornotmodified
|
||
msgid "Not modified"
|
||
msgstr "غير متغيّر"
|
||
|
||
#: lazarusidestrconsts.dlgcolors
|
||
msgctxt "lazarusidestrconsts.dlgcolors"
|
||
msgid "Colors"
|
||
msgstr "الألوان"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
||
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
||
msgid "Limit indent to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinue
|
||
msgid "Prefix comments on linebreak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematch
|
||
msgid "Match current line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
||
msgid "Match text including \"*\" of token \"(*\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
||
msgid "Match whole line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
||
#, object-pascal-format
|
||
msgid "Match text after token \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
||
#, object-pascal-format
|
||
msgid "Match text including token \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
||
msgid "Prefix new line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
||
msgid "Align Prefix at indent of previous line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
||
msgid "Align Prefix below start of comment on first comment line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
||
msgid "Do not indent prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
||
msgid "Comments and Strings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
||
msgid "Extend if matched or not matched"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
||
msgid "Extend if matched or not matched (not at EOL)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
||
msgid "Extend if matched"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
||
msgid "Extend if matched and caret in the middle of text (not at EOL)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcompilationandlinking
|
||
msgid "Compilation and Linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
msgid "Compiler messages"
|
||
msgstr "تعاليق المترجم"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessages
|
||
#, fuzzy
|
||
#| msgid "Compiler messages language file"
|
||
msgid "Compiler messages language file (*.msg)"
|
||
msgstr "الجذاذة المحدّدة للغة تعاليق المترحم"
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "خيارات التّرجمة"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
||
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgconfigandtarget
|
||
msgid "Config and Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
msgid "Config files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
||
msgid "Other debugging info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy current word when no selection exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgctxt "lazarusidestrconsts.dlgcorange"
|
||
msgid "Range"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcorelocatable
|
||
msgid "Relocatable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosetasdefault
|
||
msgid "Set compiler options as default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
msgid "&Show Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
msgid "Smart linkable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
msgid "Strip symbols from executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltype
|
||
msgid "Type of debug info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypeauto
|
||
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
||
msgid "Automatic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
||
msgid "Dwarf 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
||
msgid "Dwarf 2 with sets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
||
msgid "Dwarf 3 (beta)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypestabs
|
||
msgid "Stabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcotrashvariables
|
||
msgid "Trash variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
msgid "Unit style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr "الثّرثرة"
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
msgid "C++ styled INLINE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
|
||
msgid "Create new Run Parameters settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcurlycommenttab
|
||
msgid "Curly { }"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
||
msgid "Currently respected by messages window, jump history and search results."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursormoveclearsselection
|
||
msgid "Caret left/right clears selection (no move)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Caret skips selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Caret skips tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdebugdesktop
|
||
msgid "debug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdefaulttabfont
|
||
msgid "Default tab font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdeletemode
|
||
msgid "Delete mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
|
||
msgid "Delete"
|
||
msgstr "إمح"
|
||
|
||
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
|
||
msgid "Delete selected desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopname
|
||
msgid "Desktop name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopsexported
|
||
#, object-pascal-format
|
||
msgid "%d desktop(s) successfully exported to \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopsimported
|
||
#, object-pascal-format
|
||
msgid "%d desktop(s) successfully imported from \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
||
msgid "Different values background"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
||
msgid "Distance between grid points is the smallest step when moving a control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
msgid "Draw divider level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
||
msgid "Draw the component's name below it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
||
msgid "Code Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
msgid "Add close statement for Pascal blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeddelayinsec
|
||
#, object-pascal-format
|
||
msgid "(%s sec delay)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
msgid "Editor Files"
|
||
msgstr "الجذاذات الّتي بصدد التّحرير"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
||
msgid "Ignore Locks, use longest unused editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
||
msgid "Ignore Locks, if editor is current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
||
msgid "Ignore Locks, if editor in current window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
||
msgid "Locked, if text in view"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
||
msgid "Unlocked"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
||
msgid "Unlocked, if text in centered view"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
||
msgid "New tab, existing or new window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
||
msgid "New tab in new window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
||
msgid "New tab in existing window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
||
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
||
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
||
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
||
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
||
msgid "This option will use any not locked Editor."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
||
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
||
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "مائل"
|
||
|
||
#: lazarusidestrconsts.dlgeditexportbackcolor
|
||
msgid "Use Background color in HTML export"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontsize
|
||
msgid "Editor font size"
|
||
msgstr "حجم خطّ المحرّر"
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "خيارات المحرّر"
|
||
|
||
#: lazarusidestrconsts.dlgeditschemdefaults
|
||
msgid "Scheme globals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
#, fuzzy
|
||
#| msgid "Misc"
|
||
msgctxt "lazarusidestrconsts.dlgedmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "متفرّقات"
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedtabindent
|
||
msgid "Tab and Indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "الجذاذات"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "الشّبكة"
|
||
|
||
#: lazarusidestrconsts.dlgenvidestartup
|
||
msgid "IDE Startup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "اللّغة"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguagehint
|
||
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "متفرّقات"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "لا شيء"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
msgid "Other Files"
|
||
msgstr "الجذاذت الأخرى"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
msgid "Tabs for project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "النّوع"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
||
msgid "Focus messages at compilation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra character spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external debug symbols file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfileassociationinos
|
||
msgid "Opening Files from OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfiles
|
||
#, object-pascal-format
|
||
msgid "%s files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterall
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.dlgfilterall"
|
||
msgid "All files"
|
||
msgstr "كلّ الجذاذات"
|
||
|
||
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
||
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
||
msgid "CodeTools template file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterdcifile
|
||
msgid "DCI file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiform
|
||
msgid "Delphi form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphipackage
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
||
msgid "Delphi package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiproject
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
||
msgid "Delphi project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiunit
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
||
msgid "Delphi unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterexecutable
|
||
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
||
msgid "Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
||
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
||
msgid "FPC message file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterhtml
|
||
msgid "HTML files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
||
msgid "Bitmap images"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagespixmap
|
||
msgid "Pixmap images"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagespng
|
||
msgid "PNG images"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
||
msgid "Editor file types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
||
msgid "Lazarus file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusform
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
||
msgid "Lazarus form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
||
msgid "Lazarus include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
||
msgid "Lazarus other file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
||
msgid "Lazarus package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusproject
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
||
msgid "Lazarus project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
||
msgid "Lazarus project source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarussession
|
||
msgid "Lazarus session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusunit
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
||
msgid "Lazarus unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterpascalfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
||
msgid "Pascal file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterprograms
|
||
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
||
msgid "Programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfilterxml
|
||
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
||
msgid "XML files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunk
|
||
msgid "Chunk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunksect
|
||
msgid "Chunk section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlasp
|
||
msgid "ASP"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
||
msgid "Comment"
|
||
msgstr "الهامش"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
||
msgid "Node"
|
||
msgstr "العقدة"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmitem
|
||
msgid "Item"
|
||
msgstr "العنصر"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmlist
|
||
msgid "List <>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmobject
|
||
msgid "Object (inherited, inline)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasansicomment
|
||
msgid "Comment (* *)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasborcomment
|
||
msgid "Comment { }"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasfordo
|
||
msgid "For/Do"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifthen
|
||
msgid "If/Then/Else"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
||
msgid "Record"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
||
msgid "Repeat"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
||
msgid "Comment //"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
||
msgid "While/Do"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpaswithdo
|
||
msgid "With/Do"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcdata
|
||
msgid "CData"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
||
msgid "Comment"
|
||
msgstr "الهامش"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmldoctype
|
||
msgid "DocType"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
||
msgid "Node"
|
||
msgstr "العقدة"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlprocess
|
||
msgid "Processing Instruction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
|
||
msgid "Force DPI scaling in design-time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
|
||
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
||
msgid "The running Lazarus instance cannot accept any files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
||
msgid "Change Object Inspector contents on clicking form title bar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
||
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfpcexecutable
|
||
#, object-pascal-format
|
||
msgid "Compiler executable (e.g. %s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfppkgconfigurationfile
|
||
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
msgid "Text-mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "محرّر الأشكال"
|
||
|
||
#: lazarusidestrconsts.dlgfrombeginning
|
||
msgid "From b&eginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
msgid "From c&ursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggrayeddesktopsdocked
|
||
msgid "Grayed desktops are for docked environment."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
||
msgid "Grayed desktops are for undocked environment."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
||
msgid "Grid consists of small dots which help aligning controls."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "كاشف الأوامر"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr "أدوات الأوامر"
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
||
msgid "Debugger"
|
||
msgstr "المنقّح"
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr "المحرّر"
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "البيئة"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguidelineshint
|
||
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
||
msgid "Collapsed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgheapandstacksize
|
||
msgid "Heap and stack sizes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
msgid "Heap size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
||
msgid "Height of one property in the grid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "الإرتفاع"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghideideonrunhint
|
||
msgid "Do not show the IDE at all while program is running."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
||
msgid "Hide tab in single page windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
msgid "Show hints for parameter \"Sender\" not used"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
msgid "Show hints for unused units in main"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier Completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockactive
|
||
msgid "Active $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockinactive
|
||
msgid "Inactive $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
||
msgid "Included mixed state $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeactive
|
||
msgid "Active $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeinactive
|
||
msgid "Inactive $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
||
msgid "Included mixed state $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgimportdesktopexists
|
||
msgid ""
|
||
"A desktop with the same name already exists.\n"
|
||
"Please confirm the desktop name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
|
||
msgid "Include code templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
|
||
msgid "Include identifiers containing prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
|
||
msgid "Include all keywords and operators"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludewordstoidentcompl
|
||
msgid "Include words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
|
||
msgid "don't include"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
|
||
msgid "from all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
|
||
msgid "from current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
||
msgid "Indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
msgid "Tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsertclassparts
|
||
msgid "Insert class parts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsertimplementation
|
||
msgid "Implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsertinterface
|
||
msgid "Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsertmethods
|
||
msgid "Insert method implementations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsertsection
|
||
msgid "Insert into Uses section of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgjumpcodeblockpos
|
||
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgjumpsinglelinepos
|
||
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgjumptomethodbody
|
||
msgid "Jump directly to method body"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep caret X position when navigating up/down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeylink
|
||
msgid "(Edit Key)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "اللّغة"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglazarusinstances
|
||
msgid "Lazarus instances"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
msgid "Guide lines Left,Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
msgid "1 (quick, debugger friendly with small limitations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
msgid "2 (-O1 + quick optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
msgid "3 (-O2 + slow optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel4opt
|
||
msgid "4 (-O3 + aggressive optimizations, beware)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
msgid "0 (no optimization, for debugging)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
msgid "Link smart"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
msgid "Display line numbers in run-time error backtraces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
msgid "View Project Forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
msgid "View Project Frames"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
||
msgid "View Project Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmakeexecutable
|
||
msgid "\"Make\" executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmanagedesktops
|
||
msgid "Manage desktops"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupfoldcolor
|
||
msgid "Vertical-mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
msgid "Highlight all occurrences of Word under Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupoutline
|
||
msgid "Outline (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
|
||
msgid "Warning: There are no colors configured for the selected language"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefined
|
||
msgid "User defined markup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
||
msgid "Delete"
|
||
msgstr "إمح"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
||
#, object-pascal-format
|
||
msgid "Delete list \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
||
msgid "Add Word or Term"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
||
msgid "Remove Word or Term"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
||
msgid "Toggle Word or Term"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
||
msgid "Duplicate Term"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
||
#, object-pascal-format
|
||
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
||
msgid "Add/Remove in all editors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
||
msgid "Delete list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
||
msgid "Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
||
msgid "Add list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
||
msgid "Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
||
msgid "Set bound at term end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
||
msgid "Set bound at term start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
||
msgid "Ignore bounds for terms longer than"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
||
msgid "selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
||
msgid "current word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
||
msgid "Settings for terms added by key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
||
msgid "Smart match selection bounds"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
||
msgid "New list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
||
msgid "No lists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
||
msgid "Select ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
||
msgid "Key Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
||
msgid "Main settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordbracket
|
||
msgid "Keyword brackets on caret (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
msgid "Match whole words, if length is less or equal to:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
msgid "Ignore keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
msgid "Disable timer for markup current word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
msgid "Trim spaces (when highlighting current selection)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecenthint
|
||
msgid "Value 0 means unlimited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
|
||
msgid "Middle-click-modifier to close all other tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
|
||
msgid "Middle-click-modifier to close tabs on the right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmode
|
||
msgid "Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseaction
|
||
msgid "Mouse Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
||
msgid "Single"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
||
msgid "Double"
|
||
msgstr "مضاعف"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
||
msgid "Triple"
|
||
msgstr "ثلاثي"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
||
msgid "Quad"
|
||
msgstr "رباعي"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
||
msgid "Extra 1"
|
||
msgstr "إضافي 1"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
||
msgid "Extra 2"
|
||
msgstr "إضافي 2"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr "الأوسط"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
msgid "Make Fallback"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "الأيمن"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
||
msgid "Wheel down"
|
||
msgstr "العجلة إلى أسفل"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
|
||
msgid "Wheel left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
|
||
msgid "Wheel right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
||
msgid "Wheel up"
|
||
msgstr "العجلة إلى أعلى"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
|
||
msgid "Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr "الفأرة"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeall
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
||
msgid "All"
|
||
msgstr "الكلّ"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
||
msgid "Line Changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
||
msgid "Overview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
||
msgid "Overview Mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "نصّ"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "تعيين"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptopt2label
|
||
msgid "Opt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
msgid "Filter Mod-Keys"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
||
msgid "Debug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
||
msgid "Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
||
msgid "Fatal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
||
msgid "Hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
||
msgid "Important"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
||
msgid "Normal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
||
msgid "Note"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
||
msgid "Panic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
||
msgid "Time and statistics"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
||
msgid "Verbose"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
||
msgid "Verbose 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
||
msgid "Verbose 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
||
msgid "Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
||
msgid "Navigation keys move all carets (column-select)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretdelskipcr
|
||
msgid "Skip delete key at EOL (do not join lines)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretgroupoptions
|
||
msgid "Multi-caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretmode
|
||
msgid "Navigation keys move all carets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
||
msgid "Enable multi-caret for column selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
||
msgid "always start a new instance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
||
msgid "do not allow multiple instances"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
||
msgid "open files in a running instance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "تعيين متعدّد"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
||
msgid "Jump target priority between multiple editors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
||
msgid "Order to use for editors matching the same criteria"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
||
msgid "Most recent focused editor for this file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
||
msgid "Editor (for file) in most recent focused window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
||
msgid "Priority list of criteria to choose an editor:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinoptions
|
||
msgid "Pages and Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiwintabgroup
|
||
msgid "Notebook Tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnewdesktop
|
||
msgid "New desktop ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnewprojecttype
|
||
msgid "New Project Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
msgid "No automatic renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnoavailableunits
|
||
msgid "No available units to add."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnonformbackgroundcolor
|
||
msgid "Other Designer background (e. g. TDataModule)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpos
|
||
msgid "Source notebook tabs position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
msgid "Do not split line after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
msgid "Do not split line in front of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnsprincipalclass
|
||
msgid "NSPrincipalClass"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height (0 = auto)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "متفرّقات"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoptimizationlevels
|
||
msgid "Optimization levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgotheroptimizations
|
||
msgid "Other optimizations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
msgid "Other unit files (-Fu):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverviewgutterback1color
|
||
msgid "Background 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverviewgutterback2color
|
||
msgid "Background 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverviewguttercolor
|
||
msgid "Overview Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
|
||
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
|
||
msgid "Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
msgid "Overwrite block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoverwritedesktop
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"Desktop with the name \"%s\" was found.\n"
|
||
"Should the old desktop be overwritten?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
msgid "Default Pascal extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywords
|
||
msgid "Highlight control statements as keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
||
msgid "Extended Pascal Keyword Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
||
msgid "Markup (on caret)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
||
msgid "Matching Keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
||
msgid "Outline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
msgid "Pass options to linker with \"-k\", delimiter is space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywords
|
||
msgid "Highlight \"String\" keyword(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
||
msgid "Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
||
msgid "None"
|
||
msgstr "لا شيئ"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
||
msgid "Only \"String\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
msgid "Persistent block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Visible caret in unfocused editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursornoblink
|
||
msgid "Caret in unfocused editor does not blink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoansiutf8
|
||
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoasinvoker
|
||
msgid "as invoker (asInvoker)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
msgid "&Clear Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodebugger
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.dlgpodebugger"
|
||
msgid "Debugger"
|
||
msgstr "المنقّح"
|
||
|
||
#: lazarusidestrconsts.dlgpodefaulticon
|
||
msgid "Load &Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawareness
|
||
msgid "DPI awareness"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
||
msgid "off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
||
msgid "Vista-8: off, 8.1+: per monitor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
||
msgid "Vista-8: on, 8.1+: per monitor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
|
||
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenesson
|
||
msgid "on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoexecutionlevel
|
||
msgid "Execution Level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpohighestavailable
|
||
msgid "highest available (highestAvailable)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
#, object-pascal-format
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr "(لا شيئ)"
|
||
|
||
#: lazarusidestrconsts.dlgpointertypecheck
|
||
msgid "@<pointer> returns a typed pointer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
msgid "&Load Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpolongpathaware
|
||
msgid "Long path awareness"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "متفرّقات"
|
||
|
||
#: lazarusidestrconsts.dlgporequireadministrator
|
||
msgid "require administrator (requireAdministrator)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgporesources
|
||
msgid "Resources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
msgid "&Save Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpouiaccess
|
||
msgid "UI Access (uiAccess)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpouselclscaling
|
||
msgid "Use LCL scaling (Hi-DPI)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
msgid "Use manifest resource (and enable themes)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
||
msgid "Prefer double-click over single-click"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpriorities
|
||
msgid "Priorities"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgproject
|
||
msgctxt "lazarusidestrconsts.dlgproject"
|
||
msgid "Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptionsfor
|
||
#, object-pascal-format
|
||
msgid "Options for Project: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgprojecttoopenorcreate
|
||
msgid "Project to Open or Create"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
msgid "Project Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
msgid "&Prompt on replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project and packages at start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreallydeletedesktop
|
||
#, object-pascal-format
|
||
msgid "Really delete desktop \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
msgid "Regular e&xpressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrenamedesktop
|
||
msgid "Rename desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
||
msgid "Rename"
|
||
msgstr "أبدل الإسم"
|
||
|
||
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
||
msgid "Rename selected desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
#, fuzzy
|
||
#| msgid "&Replace with"
|
||
msgid "Replace wit&h"
|
||
msgstr "أبدل بـ..."
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreset
|
||
msgctxt "lazarusidestrconsts.dlgreset"
|
||
msgid "Reset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgresetall
|
||
msgid "Reset all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
msgid "Guide lines Right,Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
msgid "Right click selects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
||
msgid "Select grandchildren"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
msgid "Rubberband Creation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Rubberband Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"The running Lazarus instance cannot accept any files.\n"
|
||
"Do you want to open them in a new IDE instance?\n"
|
||
"\n"
|
||
"%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
||
msgid "Lazarus instance is running but not responding."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "البيئة"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
msgid "Run Parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunwithdebug
|
||
msgid "Run uses the debugger (disable for release-mode)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavecurrentdesktop
|
||
msgid "Save current desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
||
msgid "Save current desktop as"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
|
||
msgid "Save active desktop as ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
|
||
msgid "Save active desktop as"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
||
msgid "The files are available in the \"Open Recent\" history list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
||
msgid "Only files that belong to this project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsavein
|
||
msgid "Save in"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
|
||
msgid "Force 1024 columns minimum for horizontal scroll range"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollbarpasteolnone
|
||
msgid "Do not add any permanent space to horizontal scroll range"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollbarpasteolpage
|
||
msgid "Always add one page to horizontal scroll range"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
msgid "Scrolling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollhint
|
||
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
||
msgid "Show scroll hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
msgid "Allow Caret to move past the end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
#, object-pascal-format
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
msgid "Searching ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsearchscope
|
||
msgid "Search scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgselectallchildcontrols
|
||
msgid "Select all child controls together with their parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgselectallnoscroll
|
||
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
msgid "&Selected text"
|
||
msgstr "النّصّ المعيّن"
|
||
|
||
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
|
||
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
|
||
msgid "Set active"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
|
||
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
|
||
msgid "Set active"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
||
msgid "The parameter name for the default setter procedure."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
||
msgid "is prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
||
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
||
msgid "use const"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
||
msgid "If checked, the setter parameter is marked with \"const\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowallunits
|
||
msgid "Show all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
||
msgid "Show captions of nonvisual components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "أظهر الشّروط"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowdesignerhints
|
||
msgid "Show designer hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
||
msgid "Hint shows control's position or size while moving or resizing it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowfilenameincaption
|
||
msgid "Show file name in caption"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
msgctxt "lazarusidestrconsts.dlgshowhint"
|
||
msgid "Show hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowingwindows
|
||
msgid "Showing Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowmessagesicons
|
||
msgid "Show Messages Icons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
msgid "Show notes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
msgid "Show warnings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
||
msgid "Show single button in TaskBar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
||
msgid "Skip forward class declarations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgslashcommenttab
|
||
msgid "Slash //"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelineshint
|
||
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
||
msgid "Multiline tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstacksize
|
||
msgid "Stack size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstringautoappend
|
||
msgid "Append text to close string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstringautoprefix
|
||
msgid "Prefix string on new line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstringbreakindenttab
|
||
msgid "String ''"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstringenableautocontinue
|
||
msgid "Extend strings on linebreak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
||
msgid "Show tab numbers in notebook"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
msgid "Target platform"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetspecificoptions
|
||
msgid "Target-specific options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtextstyle
|
||
msgid "Text-Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtexttofind
|
||
#, fuzzy
|
||
#| msgid "&Text to Find"
|
||
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
||
msgid "Search s&tring"
|
||
msgstr "إبحث عن العبارة التالية"
|
||
|
||
#: lazarusidestrconsts.dlgthiselementusescolor
|
||
msgid "The element uses (and edits) the schemes:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
|
||
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
|
||
msgid "Toggle as debug desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
|
||
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
|
||
msgid "Toggle as debug desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtopinfohint
|
||
msgid "Current Class/Proc Hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
msgid "Trim spaces style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "تراجع بعد الحفظ"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
msgid "Undo / Redo"
|
||
msgstr "تراجع / كرّر"
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "حد التراجع"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
||
msgid "Refresh"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
msgid "Code Folding"
|
||
msgstr "طيّ الأوامر"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
msgid "Use additional compiler config file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
msgid "Divider Drawing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
msgid "Use standard compiler config file (fpc.cfg)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusehighlight
|
||
msgid "Use Highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseiconsincompletionbox
|
||
msgid "Icons in code completion box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseminimumime
|
||
msgid "IME handled by System"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguserschemeerror
|
||
#, object-pascal-format
|
||
msgid "Failed to load user-scheme file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseschemedefaults
|
||
msgid "- Scheme globals -"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseschemelocal
|
||
msgid "selected language"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusetabshistory
|
||
msgid "Use tab history when closing tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseunitcaption
|
||
msgid "Add unit to Uses section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "نافذة"
|
||
|
||
#: lazarusidestrconsts.dlgwordexceptions
|
||
msgid "Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
msgid "Write FPC logo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
|
||
msgid " (Ignoring project settings below)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsstoreconverterconfiginses
|
||
msgid "Store converter config in session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
|
||
msgid "Store project debugger configs in session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsthedebuggerbackendselecti
|
||
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
|
||
msgid "This only affects the list of converters below. The options setting which list to use are always stored in the session."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsusetheidegloballistofconv
|
||
msgid "Use the IDE-Global list of converters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsusetheprojectlistofconver
|
||
msgid "Use the project list of converters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
|
||
msgid "Using IDE default debugger settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.drsusingselectedidedebuggers
|
||
msgid "Using selected IDE debugger settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmalignmenu
|
||
msgid "Align ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
msgid "Delete Selection"
|
||
msgstr "إمح التّعيين"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
msgid "Mirror Horizontal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
msgid "Mirror Vertical"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
msgid "Back One"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
msgid "Forward One"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
msgid "Move to Back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
msgid "Move to Front"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmresetmenu
|
||
msgid "Reset ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
msgid "Save Form as XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmscalemenu
|
||
msgid "Scale ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "عيّن الكلّ"
|
||
|
||
#: lazarusidestrconsts.fdmsizemenu
|
||
msgid "Size ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugchangepath
|
||
msgid "Change path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
|
||
msgid "Error: The backend is not configured."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
|
||
msgid "(The configured backend's package is not installed.)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
|
||
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
|
||
msgid "Hint: The backend type is OK, but not the recommended type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
|
||
msgid "Create a new recommended backend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugcurrent
|
||
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
|
||
msgid "Current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
|
||
msgid "The selected backend uses the external executable:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
|
||
#, object-pascal-format
|
||
msgid "The selected backend requires an external executable: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
|
||
#, object-pascal-format
|
||
msgid "Default for your OS/Arch is: \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugignore
|
||
msgctxt "lazarusidestrconsts.initdlgdebugignore"
|
||
msgid "Ignore"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugkeepbackend
|
||
msgid "Keep backend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugnew
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.initdlgdebugnew"
|
||
msgid "New"
|
||
msgstr "جذاذة &جديدة"
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
|
||
msgid "Error: External executable is a directory, not a file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
|
||
msgid "Error: External executable not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
|
||
msgid "Error: External file is not executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
|
||
msgid "Error: No default for external executable found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
|
||
msgid "Error: No external executable specified."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugpopupinformation
|
||
#, object-pascal-format
|
||
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
|
||
msgid "Select an existing backend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
|
||
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
|
||
#, object-pascal-format
|
||
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
|
||
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
|
||
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
|
||
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstatesetupok
|
||
msgid "Setup is OK."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
|
||
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
||
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
||
msgid "Create New Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
|
||
msgid "Directory for unit file:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile2
|
||
#, object-pascal-format
|
||
msgid "Existing file: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
||
#, object-pascal-format
|
||
msgid "File \"%s\" already exists in the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename/URL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2picon24x24
|
||
msgid "Icon 24x24:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2picon36x36
|
||
msgid "Icon 36x36:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2picon48x48
|
||
msgid "Icon 48x48:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
||
msgid "Invalid Circular Dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
#, object-pascal-format
|
||
msgid "\"%s\" is not a valid unit name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
#, object-pascal-format
|
||
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ppackageorproject
|
||
msgid "Package/Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette page:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
||
msgid "Show all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
#, object-pascal-format
|
||
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
#, object-pascal-format
|
||
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
#, object-pascal-format
|
||
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
#, object-pascal-format
|
||
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
#, object-pascal-format
|
||
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
#, object-pascal-format
|
||
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
#, object-pascal-format
|
||
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
#, object-pascal-format
|
||
msgid "The package already has a dependency on the package \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
#, object-pascal-format
|
||
msgid "The page name \"%s\" is too long (max 100 chars)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
#, object-pascal-format
|
||
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
#, object-pascal-format
|
||
msgid "The unitname \"%s\" already exists in this package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
#, object-pascal-format
|
||
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
#, object-pascal-format
|
||
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "أوقف التحميل"
|
||
|
||
#: lazarusidestrconsts.lisaborted
|
||
msgid "Aborted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "أوقف تحميل المشروع"
|
||
|
||
#: lazarusidestrconsts.lisabout
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.lisabout"
|
||
msgid "About"
|
||
msgstr "بطاقة التعريف"
|
||
|
||
#: lazarusidestrconsts.lisabout2
|
||
#, object-pascal-format
|
||
msgid "About %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutide
|
||
msgid "About IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "التعريف بلازاروس"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
#, object-pascal-format
|
||
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
#, object-pascal-format
|
||
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "الثناء"
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivate
|
||
msgid "Activate"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivateselected
|
||
msgid "Activate Selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactive
|
||
msgid "Active"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
|
||
msgid "Add a new separator above selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
|
||
msgid "Add a new separator below selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefine
|
||
msgid "Add defines simulating Delphi7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefinehint
|
||
msgid "Useful when the code has checks for supported compiler versions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
||
#, object-pascal-format
|
||
msgid "Added missing object \"%s\" to pascal source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddedpropertysfors
|
||
#, object-pascal-format
|
||
msgid "Added property \"%s\" for %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddfcutf8
|
||
msgid "Add -FcUTF8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddfcutf8hint
|
||
msgid "May be needed if source files have non-ansistring literals."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddfilter
|
||
msgid "Add Filter ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
||
msgid "Addition does not fit the current message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
||
msgid "Addition fits the current message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadditions
|
||
msgid "Additions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddkeyworddo
|
||
msgid "Add keyword \"do\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddmodifieroverload
|
||
msgid "Add modifier \"overload\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddmodifieroverride
|
||
msgid "Add modifier \"override\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddmodifierreintroduce
|
||
msgid "Add modifier \"reintroduce\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
||
#, object-pascal-format
|
||
msgid "Add new build mode, copying settings from \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddnewmacro
|
||
msgid "Add new macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddpackagerequirement
|
||
msgid "Add package requirement?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
||
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject2
|
||
msgid "Add package to project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddparameterbrackets
|
||
msgid "Add parameter brackets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
||
msgid "Add to include search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
#, object-pascal-format
|
||
msgid "Add %s to project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtostartupcomponents
|
||
msgid "Add to startup components?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddunitnotrecommended
|
||
msgid "Add unit (not recommended)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddvaluetomacro
|
||
#, object-pascal-format
|
||
msgid "Add value to macro %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
msgid "Add File to Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
msgid "Destination package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
msgid "File type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
#, object-pascal-format
|
||
msgid "Invalid package ID: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
#, object-pascal-format
|
||
msgid "Package \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
||
msgid "Show all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
#, object-pascal-format
|
||
msgid "The package %s is read only."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
#, object-pascal-format
|
||
msgid "A file \"%s\" already exists.%sReplace it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
||
#, object-pascal-format
|
||
msgid "A filter with the name \"%s\" already exists."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
||
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
msgid "All blocks look ok."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallbuildmodes
|
||
msgid "<All build modes>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalloptions
|
||
msgid "All Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
||
msgid "All parameters of this function are already set at this call. Nothing to add."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
#, object-pascal-format
|
||
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalpha
|
||
msgid "Alpha"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
||
msgid "Always convert suggested default file name to lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
||
msgid "Always draw selected items focused"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
||
msgid "A macro with this name already exists."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
#, object-pascal-format
|
||
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous unit found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
||
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtotopside
|
||
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
#, object-pascal-format
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttoleftside
|
||
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttorightside
|
||
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttoleftside
|
||
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttorightside
|
||
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorsof
|
||
#, object-pascal-format
|
||
msgid "Anchors of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortoptobottomside
|
||
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortoptotopside
|
||
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
|
||
#, object-pascal-format
|
||
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisappearance
|
||
msgid "Appearance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
||
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapply
|
||
msgctxt "lazarusidestrconsts.lisapply"
|
||
msgid "Apply"
|
||
msgstr "نفّذ"
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplyconventions
|
||
msgid "Apply conventions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplyconventionshint
|
||
msgid "Adjust name extension and character case for platform and file type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
||
msgid "A project unit can not be used by other packages/projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
||
msgid "Ask before saving project's session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
||
msgid "Ask for component name after putting it on a designer form."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
||
msgid "Ask for file name on new file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisasknameoncreate
|
||
msgid "Ask name on create"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheight
|
||
msgid "Automatically adjust IDE main window height"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
||
msgid "Show complete component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
||
msgid "If component palette spans over more lines, show them all and not only one."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomarkup
|
||
msgid "Markup and Matches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomatic
|
||
msgctxt "lazarusidestrconsts.lisautomatic"
|
||
msgid "Automatic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomatically
|
||
msgid "Automatically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
||
msgid "Automatically convert .lfm files to .lrs resource files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
||
msgid "do not complete selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeontype
|
||
msgid "Automatically invoke on typing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
|
||
msgid "Only complete if word is longer or equal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
|
||
msgid "Only complete when at end of word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
|
||
msgid "Use completion box delay"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyontab
|
||
msgid "tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
||
msgid "Automatically use single possible identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
msgid "Completion and Hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisavailableforinstallation
|
||
msgid "Available for installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
||
msgid "Available project build modes:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbackupchangedfiles
|
||
msgid "Make backup of changed files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbackuphint
|
||
msgid "Creates a Backup directory under project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
#, object-pascal-format
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
msgid "Behind related"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
||
msgid "be less verbose, can be given multiple times"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
||
msgid "be more verbose, can be given multiple times"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
||
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
msgid "Always build before run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (leave empty for file path)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
msgid "Border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottom
|
||
msgctxt "lazarusidestrconsts.lisbottom"
|
||
msgid "Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbrowseandselectacompiler
|
||
msgid "Browse and select a compiler (e.g. ppcx64"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtnapply
|
||
msgid "&Apply"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtnclose
|
||
msgctxt "lazarusidestrconsts.lisbtnclose"
|
||
msgid "&Close"
|
||
msgstr "أغلق"
|
||
|
||
#: lazarusidestrconsts.lisbtndlgreplace
|
||
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
||
msgid "&Replace ..."
|
||
msgstr "أبدل ..."
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr "إبحث ..."
|
||
|
||
#: lazarusidestrconsts.lisbtnquit
|
||
#, fuzzy
|
||
#| msgid "Quit"
|
||
msgctxt "lazarusidestrconsts.lisbtnquit"
|
||
msgid "&Quit"
|
||
msgstr "خروج من البرنامج"
|
||
|
||
#: lazarusidestrconsts.lisbtnremove
|
||
msgctxt "lazarusidestrconsts.lisbtnremove"
|
||
msgid "&Remove"
|
||
msgstr "إمح"
|
||
|
||
#: lazarusidestrconsts.lisbtnrename
|
||
msgid "&Rename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr "أبدل"
|
||
|
||
#: lazarusidestrconsts.lisbuild
|
||
msgctxt "lazarusidestrconsts.lisbuild"
|
||
msgid "Build"
|
||
msgstr "إبن"
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildcaption
|
||
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
||
msgid "Build"
|
||
msgstr "إبن"
|
||
|
||
#: lazarusidestrconsts.lisbuildide
|
||
msgid "Build IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuilding
|
||
msgid "Building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
||
msgid "Building Lazarus failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmode
|
||
#, object-pascal-format
|
||
msgid "Build Mode: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
||
msgid "Differences between build modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
||
msgid "Differences from other build modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffmode
|
||
msgid "Mode:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
||
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodes
|
||
msgid "Build modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "إبن مشروعا جديدا"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
msgid "Build number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildstage
|
||
msgctxt "lazarusidestrconsts.lisbuildstage"
|
||
msgid "Build"
|
||
msgstr "إبن"
|
||
|
||
#: lazarusidestrconsts.lisbusy
|
||
msgid "Busy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbyte
|
||
#, object-pascal-format
|
||
msgid "%s byte"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotcompileproject
|
||
msgid "Cannot compile project"
|
||
msgstr "تعذّرت ترجمة المشروع"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
msgid "Cannot copy top level component."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
#, object-pascal-format
|
||
msgid "Cannot create file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotdeletelastmode
|
||
msgid "Cannot delete last mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotexecute
|
||
#, object-pascal-format
|
||
msgid "cannot execute \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotfind
|
||
#, object-pascal-format
|
||
msgid "Cannot find %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotfindexecutable
|
||
#, object-pascal-format
|
||
msgid "cannot find executable \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
#, object-pascal-format
|
||
msgid "Cannot find Lazarus starter:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotopenform
|
||
#, object-pascal-format
|
||
msgid "Cannot open form \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotsaveform
|
||
#, object-pascal-format
|
||
msgid "Cannot save form \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannotsubstitutemacros
|
||
#, object-pascal-format
|
||
msgid "Cannot substitute macro \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
||
msgid "Cannot test the compiler while debugging or compiling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscantfindavalidppu
|
||
#, object-pascal-format
|
||
msgid "Can't find a valid %s.ppu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscaptioncomparefiles
|
||
msgid "Compare files (not for creating patches)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscbpfiles
|
||
#, object-pascal-format
|
||
msgid "%s (%s files)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
||
#, object-pascal-format
|
||
msgid "Really delete %s source files%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
#, object-pascal-format
|
||
msgid "Change Class of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
#, object-pascal-format
|
||
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
#, object-pascal-format
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
#, object-pascal-format
|
||
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
|
||
#, object-pascal-format
|
||
msgid "RTL unit not found: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
#, object-pascal-format
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
#, object-pascal-format
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
|
||
#, object-pascal-format
|
||
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
#, object-pascal-format
|
||
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgctxt "lazarusidestrconsts.lisccoskip"
|
||
msgid "Skip"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
#, object-pascal-format
|
||
msgid "Unable to create Test Pascal file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
||
msgid "Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
#, fuzzy
|
||
#| msgid "(Filter)"
|
||
msgid "(filter)"
|
||
msgstr "(مصفاة)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.liscein"
|
||
msgid "%s in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
msgid "Is a root control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
msgid "Parameters count treated as \"many\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
msgid "Nested procedures count treated as \"many\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenteralostwindow
|
||
msgid "Center a lost window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
msgid "Center Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "إحتل أوسط النافذة"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
msgid "Preferred exhibition mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgctxt "lazarusidestrconsts.lisceomodesource"
|
||
msgid "Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "الأخرى"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
msgid "Show observations about"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscesurrounding
|
||
msgid "Surrounding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
|
||
#, object-pascal-format
|
||
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
||
msgid "Do not know how to copy this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
||
msgid "Do not know how to cut this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
||
msgid "Do not know how to delete this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
||
msgid "Error creating component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
||
#, object-pascal-format
|
||
msgid "Error creating component: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
||
msgid "Error destroying component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
||
#, object-pascal-format
|
||
msgid "Error destroying component of type %s of unit %s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
||
msgid "Error destroying mediator"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
||
#, object-pascal-format
|
||
msgid "Error destroying mediator %s of unit %s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeinfile
|
||
#, object-pascal-format
|
||
msgid "In file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
||
msgid "Invalid component owner"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
||
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
||
#, object-pascal-format
|
||
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
||
#, object-pascal-format
|
||
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
||
#, object-pascal-format
|
||
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
||
#, object-pascal-format
|
||
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
||
#, object-pascal-format
|
||
msgid "The component of type %s failed to set its owner to %s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
||
#, object-pascal-format
|
||
msgid "Unable to clear the form editing selection%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischange
|
||
msgctxt "lazarusidestrconsts.lischange"
|
||
msgid "Change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangebuildmode
|
||
msgid "Change build mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
||
#, object-pascal-format
|
||
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
msgid "Change Parent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeswerenotsaved
|
||
msgid "Changes were not saved"
|
||
msgstr "لم يقع حفظ التّغييرات"
|
||
|
||
#: lazarusidestrconsts.lischangetounix
|
||
msgid "Change to Unix /"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangetowindows
|
||
msgid "Change to Windows \\"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckall
|
||
msgid "Check All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
||
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
||
msgid "Check for disk file changes via content rather than timestamp"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
||
#, object-pascal-format
|
||
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
||
msgid ". Check if package %s is in the dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
||
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
||
msgid "Check the next token in source and add a semicolon if needed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
||
#, object-pascal-format
|
||
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckuncheckall
|
||
msgid "Check/uncheck all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
||
msgid "Choose a file with CodeTools templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseanameforthecomponent
|
||
msgid "Choose a name for the component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseanexamplefile
|
||
msgid "Choose an example file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
||
msgid "Choose an FPC message file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
||
msgid "Choose a Pascal file for indentation examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerexecutable
|
||
#, object-pascal-format
|
||
msgid "Choose compiler executable (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosecompilermessages
|
||
msgid "Choose compiler messages file"
|
||
msgstr "إختر جذاذة لغة تعاليق المترجم"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
||
msgid "Choose debugger executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseexecutable
|
||
msgid "Choose an executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosemakeexecutable
|
||
msgid "Choose \"make\" executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosenameandtext
|
||
msgid "Choose name and text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscirculardependencydetected
|
||
msgid "Circular dependency detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclass
|
||
msgid "&Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
#, object-pascal-format
|
||
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassnotfoundat
|
||
#, object-pascal-format
|
||
msgid "Class %s not found at %s(%s,%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
#, object-pascal-format
|
||
msgid "Class \"%s\" of method \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldirclean
|
||
msgid "Clean"
|
||
msgstr "نضّف"
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "نظّف الملفّ"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "نظّف الملفّات الفرعيّة"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanall
|
||
msgid "Clean all"
|
||
msgstr "نضّف الكلّ"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanonlyonce
|
||
msgid "Switch after building to automatically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanup
|
||
msgid "Clean up"
|
||
msgstr "نضّف"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuild
|
||
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
||
msgid "Clean up and build"
|
||
msgstr "نضّف وإبن"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuildproject
|
||
msgid "Clean up and build project"
|
||
msgstr "نضّف وإبن المشروع"
|
||
|
||
#: lazarusidestrconsts.liscleanuplazbuild
|
||
msgid "Clean up + lazbuild"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanuppackage
|
||
#, object-pascal-format
|
||
msgid "Clean up package \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclear
|
||
msgctxt "lazarusidestrconsts.lisclear"
|
||
msgid "Clear"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclearfilter
|
||
msgid "Clear filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclearthefilterforoptions
|
||
msgid "Clear the filter for options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclicktoseethechoices
|
||
msgid "Click to see the choices"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
||
msgid "Click to Select Palette Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclone
|
||
msgid "Clone"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
#, fuzzy
|
||
#| msgid "&Close"
|
||
msgctxt "lazarusidestrconsts.lisclose"
|
||
msgid "Close"
|
||
msgstr "أغلق"
|
||
|
||
#: lazarusidestrconsts.liscloseall
|
||
msgctxt "lazarusidestrconsts.liscloseall"
|
||
msgid "Close All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscloseallchecked
|
||
msgid "Close All Checked"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsclose
|
||
msgid "Close files"
|
||
msgstr "أغلق الجذاذات"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabshide
|
||
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
||
msgid "Hide window"
|
||
msgstr "إخف النّافذة"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsquestion
|
||
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclosealltabstitle
|
||
msgid "Close Source Editor Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr "المكوّنات"
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr "القائمة"
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmppages
|
||
msgid "Pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmppalettevisible
|
||
msgid "Palette is &visible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmprestoredefaults
|
||
msgid "&Restore defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
#, object-pascal-format
|
||
msgid "%s%sClick OK if you definitely want to do that."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscode
|
||
msgid "Code"
|
||
msgstr "الأوامر"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
msgctxt "lazarusidestrconsts.liscodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "عارض الأوامر"
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialogcaption
|
||
msgid "Code creation options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
||
msgid "Class section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialoglocation
|
||
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
||
msgid "Location"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "أضف مسارا"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr "إعرض"
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "إحذف مسارا"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr "الوصف"
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr "الأخطاء"
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "مثال"
|
||
|
||
#: lazarusidestrconsts.liscodehelpgroupbox
|
||
msgid "FPDoc settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
||
msgid "FPDoc Editor"
|
||
msgstr "محرّر أوامر FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<لا شيئ>"
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
#, object-pascal-format
|
||
msgid " A token \"%s\" already exists! "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
msgid "Auto complete on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "الهامش:"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
#, object-pascal-format
|
||
msgid "Action: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
#, object-pascal-format
|
||
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
#, object-pascal-format
|
||
msgid "%s, auto generated"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes cannot be edited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
msgid "Compiler path"
|
||
msgstr "الطّريق إلى المترجم"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "حوّل العقدة"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
#, object-pascal-format
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal Git Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
#, object-pascal-format
|
||
msgid "Create Defines for %s Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "إحذف العقدة"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
#, object-pascal-format
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
#, object-pascal-format
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
#, object-pascal-format
|
||
msgid "%s directory"
|
||
msgstr "ملف %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC Git source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
||
msgid "IfDef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal Git Source Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
#, object-pascal-format
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
#, object-pascal-format
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "لم يقع تعيين أيّ شيئ"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node cannot contain child nodes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
#, object-pascal-format
|
||
msgid "%s project directory"
|
||
msgstr "ملف المشروع %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "العقدة المعيّنة:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal Git source directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
#, object-pascal-format
|
||
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
||
#, object-pascal-format
|
||
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
#, object-pascal-format
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
||
#, object-pascal-format
|
||
msgid "%s:%svalue \"%s\" is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscaret
|
||
msgid "Caret (^)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "لا شيئ"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapse
|
||
msgid "Collapse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseall
|
||
msgid "Collapse All [Ctrl+Minus]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseall2
|
||
msgid "Collapse All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomboboxes
|
||
msgid "Combo Boxes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscommandlineparameters
|
||
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
||
msgid "Command line parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompile
|
||
msgctxt "lazarusidestrconsts.liscompile"
|
||
msgid "Compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompileanddonotaskagain
|
||
msgid "Compile and do not ask again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilefollowingmodes
|
||
msgid "Compile the following modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilenormally
|
||
msgid "Compile normally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompileproject
|
||
msgid "Compile Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilercfgismissing
|
||
#, object-pascal-format
|
||
msgid "%s is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
||
#, object-pascal-format
|
||
msgid "Compiler \"%s\" does not support target %s-%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
#, object-pascal-format
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
||
#, object-pascal-format
|
||
msgid "Compiler messages file not found:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilestage
|
||
msgctxt "lazarusidestrconsts.liscompilestage"
|
||
msgid "Compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilewithprojectsettings
|
||
msgid "Compile with project settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
||
msgid "Compile with -vd for more details. Check for duplicates."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
#, object-pascal-format
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%sبصدد بناء "
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
||
msgid "Show long line hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
||
msgid "Extend far left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
||
msgid "Extend some left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
||
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
||
msgid "Never"
|
||
msgstr "أبدا"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
||
msgid "Extend right only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
||
#, object-pascal-format
|
||
msgid "Component name \"%s\" is a Pascal keyword."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
#, object-pascal-format
|
||
msgid "Component name \"%s\" is keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
#, object-pascal-format
|
||
msgid "Component name \"%s\" is not a valid identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomppalcomponentlist
|
||
msgid "View All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompress
|
||
msgid "Compress"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompresshint
|
||
msgid "The resulting directory will be compressed into a ZIP file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconditionals
|
||
msgctxt "lazarusidestrconsts.lisconditionals"
|
||
msgid "Conditionals"
|
||
msgstr "الشّروط"
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigfileofadditions
|
||
msgid "Config file of additions:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
#, object-pascal-format
|
||
msgid "Configure Build %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
||
msgid "Configure Toolbar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigurelazaruside
|
||
msgid "Configure Lazarus IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirm
|
||
msgid "Confirm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmation
|
||
msgid "Confirmation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
||
#, object-pascal-format
|
||
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
#, object-pascal-format
|
||
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageaction
|
||
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
||
msgid "New package set"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
||
msgid "Old package set"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconflict
|
||
msgid "Conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconflictdetected
|
||
msgid "Conflict detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
||
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontents
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liscontents"
|
||
msgid "Contents"
|
||
msgstr "المحتويات"
|
||
|
||
#: lazarusidestrconsts.liscontextsensitive
|
||
msgid "Context sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
||
msgid "Continue and do not ask again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontinuebuilding
|
||
msgid "Continue building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
||
msgid "Add comment after replacement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
|
||
msgid "Added MODE Delphi syntax modifier after unit name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvaddingflagforregister
|
||
#, object-pascal-format
|
||
msgid "Adding flag for \"Register\" procedure in unit %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
||
#, object-pascal-format
|
||
msgid "\")\" is missing from replacement function: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvbracketnotfound
|
||
msgid "Bracket not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvconvertedfrom
|
||
#, object-pascal-format
|
||
msgid " { *Converted from %s* }"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvcoordhint
|
||
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvcoordoffs
|
||
msgid "Coordinate offsets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdeletedfile
|
||
#, object-pascal-format
|
||
msgid "Deleted file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
||
#, object-pascal-format
|
||
msgid "Added defines %s in custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
||
#, object-pascal-format
|
||
msgid "Added Package %s as a dependency."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
||
#, object-pascal-format
|
||
msgid "Added unit \"%s\" to uses section."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
||
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
||
msgid "All sub-directories will be scanned for unit files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
||
msgid "BeginCodeTools failed!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphicategories
|
||
msgid "Categories:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
||
#, object-pascal-format
|
||
msgid "Changed encoding from %s to UTF-8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
||
msgid "Conversion Aborted."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionready
|
||
msgid "Conversion Ready."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
||
#, object-pascal-format
|
||
msgid "Conversion took: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
||
msgid "Convert Delphi package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
||
msgid "Convert Delphi project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
||
msgid "Convert Delphi unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
||
msgid "*** Converting unit files found during conversion ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
||
msgid "*** Converting unit files belonging to project/package ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphierror
|
||
#, object-pascal-format
|
||
msgid "Error=\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
||
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
||
msgid "Failed converting unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
||
#, object-pascal-format
|
||
msgid "Failed to convert unit \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
||
#, object-pascal-format
|
||
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
||
msgid "Found all unit files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifunc
|
||
msgid "Delphi Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
||
#, object-pascal-format
|
||
msgid "%s(%s,%s) missing include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiname
|
||
msgid "Delphi Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
||
msgid "Package name exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
||
#, object-pascal-format
|
||
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
||
#, object-pascal-format
|
||
msgid "Omitted unit %s from project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
||
#, object-pascal-format
|
||
msgid "Removed unit \"%s\" from uses section."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
||
msgid "*** Fixing used units and Repairing form files ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
||
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
||
#, object-pascal-format
|
||
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
||
msgid "Unitname exists in LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
||
#, object-pascal-format
|
||
msgid "Units to replace in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
||
#, object-pascal-format
|
||
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
||
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
msgid "Convert Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertotherhint
|
||
msgid "Other options affecting the conversion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttarget
|
||
msgid "Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
||
msgid "Cross-platform"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
||
msgid "Cross-platform versus Windows-only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargethint
|
||
msgid "Converter adds conditional compilation to support different targets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
||
msgid "Use the same DFM form file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
||
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
||
msgid "Support Delphi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
||
msgid "Use conditional compilation to support Delphi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvfixedunitname
|
||
#, object-pascal-format
|
||
msgid "Fixed unit name from %s to %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplacements
|
||
msgid "Function Replacements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplhint
|
||
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
||
msgid "Some Delphi functions can be replaced with LCL function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvfuncstoreplace
|
||
msgid "Functions / procedures to replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvleftoff
|
||
msgid "Left offset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvnewname
|
||
msgid "New Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvparentcontainer
|
||
msgid "Parent Container"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
||
#, object-pascal-format
|
||
msgid "Problems when trying to find all units from project file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
||
#, object-pascal-format
|
||
msgid "Problems when fixing include files in file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
||
#, object-pascal-format
|
||
msgid "Problems when repairing form file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
||
msgid "Repairing include files : "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvreplacedcall
|
||
#, object-pascal-format
|
||
msgid "Replaced call %s with %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
||
#, object-pascal-format
|
||
msgid "Replacement function parameter number should be >= 1: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
||
#, object-pascal-format
|
||
msgid "\"$\" should be followed by a number: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
||
msgid "Stopped because there already is a package with the same name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvthislogwassaved
|
||
#, object-pascal-format
|
||
msgid "This log was saved to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtopoff
|
||
msgid "Top offset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplacements
|
||
msgid "Type Replacements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplhint
|
||
msgid "Unknown types in form file (DFM/LFM)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtypestoreplace
|
||
msgid "Types to replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplacements
|
||
msgid "Unit Replacements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplhint
|
||
msgid "Unit names in uses section of a source unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvunitstoreplace
|
||
msgid "Units to replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvunknownprops
|
||
msgid "Unknown properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
||
#, object-pascal-format
|
||
msgid "User selected to end conversion with file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
||
msgid "Add/Config/Delete Toolbar(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaradddivider
|
||
msgid "Add Divider"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaraddselected
|
||
msgid "Add selected item to toolbar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaravailablecommands
|
||
msgid "Available commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyle
|
||
msgid "Toolbars border style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
||
msgid "None"
|
||
msgstr "لا شيئ"
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
||
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
||
msgid "Single"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "كاشف الأوامر"
|
||
|
||
#: lazarusidestrconsts.liscoolbarcodetemplates
|
||
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
||
msgid "Code Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarconfigure
|
||
msgid "&Configure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
||
msgid "Are you sure you want to delete the selected toolbar?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbardeletewarning
|
||
msgid "There must be at least one toolbar!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbardesigner
|
||
msgid "Designer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargeneralsettings
|
||
msgid "General Coolbar Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyle
|
||
msgid "Toolbars grab style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
||
msgid "Simple"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
||
msgid "Double"
|
||
msgstr "مضاعف"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
||
msgid "HorLines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
||
msgid "VerLines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
||
msgid "Gripper"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
||
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
||
msgid "Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabwidth
|
||
msgid "Grab width"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaridemainmenu
|
||
msgid "IDE Main Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarmessages
|
||
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
||
msgid "Move selected toolbar item down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
||
msgid "Move selected toolbar item up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbaroptions
|
||
msgid "IDE CoolBar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarpackageeditor
|
||
msgid "Package Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
||
msgid "Package Editor Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarremoveselected
|
||
msgid "Remove selected item from toolbar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
||
msgid "Restore defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
||
msgid "Please select a toolbar first!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarsourceeditor
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "محرّر الأوامر"
|
||
|
||
#: lazarusidestrconsts.liscoolbarsourcetab
|
||
msgid "Source Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
||
msgid "Toolbar commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarvisible
|
||
msgid "Coolbar is &visible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoolbarwidth
|
||
msgid "Coolbar width"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
||
msgid "Copy All Items to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
||
msgid "Copy All/Original Messages to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
||
msgid "Copy All Shown Messages to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "إنسخ الخطأ"
|
||
|
||
#: lazarusidestrconsts.liscopyfilename
|
||
#, object-pascal-format
|
||
msgid "Copy Filename %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
||
msgid "Copy File Name to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyfilesfailed
|
||
msgid "Copying files failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
#, object-pascal-format
|
||
msgid "Copy \"%s\" to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyitemtoclipboard
|
||
msgid "Copy Item to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopymovefiletodirectory
|
||
msgid "Copy/Move File to Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
||
msgid "Copy Selected Items to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
msgid "Copy Selected Messages to Clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
msgid "Skip calling compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
#, object-pascal-format
|
||
msgid "Could not add \"{$I %s}\" to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
#, object-pascal-format
|
||
msgid "Could not add \"{$R %s}\" to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
#, object-pascal-format
|
||
msgid "Could not add \"%s\" to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
#, object-pascal-format
|
||
msgid "Could not remove \"{$I %s}\" from main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
#, object-pascal-format
|
||
msgid "Could not remove \"{$R %s}\" from main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
#, object-pascal-format
|
||
msgid "Open Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
#, object-pascal-format
|
||
msgid "Open Unit %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscpu
|
||
#, object-pascal-format
|
||
msgid ", CPU: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateandedit
|
||
msgid "Create and edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
||
msgid "Create Debug and Release modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatefilter
|
||
msgid "Create Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatefppkgconfig
|
||
msgid "Restore Fppkg configuration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatelocalvariable
|
||
#, object-pascal-format
|
||
msgid "Create local variable \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatenewaddition
|
||
msgid "Create new addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackage
|
||
msgid "(Create new package)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
||
msgid "Create new package component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateproject
|
||
msgid "Create project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
||
msgid "Create/update .po file when saving a lfm file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
||
#, object-pascal-format
|
||
msgid "Creating file index of FPC sources %s ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
#, object-pascal-format
|
||
msgid "Variable: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
||
msgid "Update all method signatures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
||
msgid "Update multiple procedure signatures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscurrentlclwidgetset
|
||
#, object-pascal-format
|
||
msgid "Current LCL widgetset: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscurrentstate
|
||
msgid "Current state: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomopthint
|
||
msgid "These options are passed to the compiler after macros are replaced."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomoptions3
|
||
msgid "Custom Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
||
msgid "A Custom Free Pascal program."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
||
msgid "Breakpoint Evaluation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
||
msgid "Breakpoint Hit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
||
msgid "Breakpoint Message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
||
msgid "Breakpoint Stack Dump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgendefaultcolor
|
||
msgid "Default Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||
msgid "Exception Raised"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||
msgid "Module Load"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleunload
|
||
msgid "Module Unload"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
||
msgid "Output Debug String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessexit
|
||
msgid "Process Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessstart
|
||
msgid "Process Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadexit
|
||
msgid "Thread Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadstart
|
||
msgid "Thread Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||
msgid "Windows Message Posted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||
msgid "Windows Message Sent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "لم يقع تعيين أيّ منقّح"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
#, object-pascal-format
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebug
|
||
msgctxt "lazarusidestrconsts.lisdebug"
|
||
msgid "Debug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugger"
|
||
msgid "Debugger"
|
||
msgstr "المنقّح"
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
#, object-pascal-format
|
||
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
#, object-pascal-format
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%sبصدد ترميم "
|
||
|
||
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
||
msgid "Automatic typecast for objects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
|
||
msgid "BETA: Allow function calls in watches (if supported by backend)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
|
||
msgid "Automatically close the assembler window, after source not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
|
||
msgid "Automatically set \"use instance class type\" for new watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
|
||
msgid "Debugger backend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
||
msgid "Debugger"
|
||
msgstr "المنقّح"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
|
||
msgid "Debugger Backend:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
|
||
msgid "Change type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
|
||
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
||
msgid "Event Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit line count to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
||
msgid "Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
||
msgid "Reset Debugger after each run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
|
||
msgid "Show message on stop with Error (Exit-code <> 0)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
|
||
#, object-pascal-format
|
||
msgid "Unknown Debugger backend \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
||
msgid "Use event log colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
|
||
msgid "-- Use IDE default Debugger --"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
|
||
msgid "-- Use project Debugger --"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
||
msgid "Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
#, object-pascal-format
|
||
msgid "Unable to load file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefault
|
||
msgctxt "lazarusidestrconsts.lisdefault"
|
||
msgid "Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
||
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
||
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefaultplaceholder
|
||
msgid "(default)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
||
msgid "Default section of methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelayforcompletionbox
|
||
msgid "Delay for completion box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
||
msgid "Delay for long line hints in completion box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelayforhints
|
||
msgid "Delay for hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelete2
|
||
msgid "Delete?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteaddition
|
||
#, object-pascal-format
|
||
msgid "Delete addition \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletemacro
|
||
#, object-pascal-format
|
||
msgid "Delete macro \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletemode
|
||
#, object-pascal-format
|
||
msgid "Delete mode \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
#, object-pascal-format
|
||
msgid "Delete old file \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedmacro
|
||
msgid "Delete selected macro?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletethisaddition
|
||
msgid "Delete this addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
#, object-pascal-format
|
||
msgid "Delete value \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue2
|
||
#, object-pascal-format
|
||
msgid "Delete value %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
#, object-pascal-format
|
||
msgid "Deleting of file \"%s\" failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelimiterissemicolon
|
||
msgid "Delimiter is semicolon."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelphicompatibleresources
|
||
msgid "Delphi compatible resources. Recommended."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
||
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdesktops
|
||
msgid "Desktops ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgfile1
|
||
msgid "File1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgfile2
|
||
msgid "File2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "المعيّن فقط"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
#, fuzzy
|
||
#| msgid "Open Diff in editor"
|
||
msgid "Open difference in editor"
|
||
msgstr "إفتح الفروق في المحرّر"
|
||
|
||
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
||
#, object-pascal-format
|
||
msgid "different unit %s found at new position \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectivesfornewunit
|
||
msgid "Directives for new unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectories
|
||
msgid "Directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectory
|
||
msgid "Directory: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
#, object-pascal-format
|
||
msgid "Directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound2
|
||
#, object-pascal-format
|
||
msgid "directory %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotwritable
|
||
msgid "Directory not writable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
||
msgid "Directory where the IDE puts the .po files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisablei18nforlfm
|
||
msgid "Disable I18N for LFM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisableoptionxg
|
||
msgid "Disable Option -Xg?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisableoptionxg2
|
||
msgid "Disable option -Xg"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesall
|
||
msgid "Discard all changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
||
msgid "Discard changes and open project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandquit
|
||
msgid "Discard changes and quit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
||
msgid "Discard changes, create new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
#, object-pascal-format
|
||
msgid "Error reading file: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
||
msgid "Ignore all disk changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
||
msgid "Reload checked files from disk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
|
||
msgid "Some files have local changes. Either local or external changes will be overwritten."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgalloptions
|
||
msgid "All options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgchangeclass
|
||
msgid "Change Class ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgdefines
|
||
msgid "Defines ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgedit
|
||
#, fuzzy
|
||
#| msgid "Edit..."
|
||
msgctxt "lazarusidestrconsts.lisdlgedit"
|
||
msgid "Edit ..."
|
||
msgstr "غيّر"
|
||
|
||
#: lazarusidestrconsts.lisdlgexport
|
||
msgctxt "lazarusidestrconsts.lisdlgexport"
|
||
msgid "Export ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgimport
|
||
msgid "Import ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgmore
|
||
msgctxt "lazarusidestrconsts.lisdlgmore"
|
||
msgid "More ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgopen
|
||
msgctxt "lazarusidestrconsts.lisdlgopen"
|
||
msgid "Open ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
#, object-pascal-format
|
||
msgid "%s does not exist: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotchange
|
||
msgid "Do not change"
|
||
msgstr "لا تغيّر"
|
||
|
||
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
||
#, object-pascal-format
|
||
msgid "%sDo not check if another IDE instance is already running"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "لا تغلق المشروع"
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr "ولا تترجم الوحدات المعتمدة"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
||
msgid "Do not show this dialog for this project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
||
msgid "Do not show this message again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
||
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonwloadonlinepackages
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"The following package(s) are not available locally: %s.\n"
|
||
"In order to install it, you must download them first. Download now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdown
|
||
msgctxt "lazarusidestrconsts.lisdown"
|
||
msgid "Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdowngrade
|
||
msgid "Downgrade"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdowngradeconfiguration
|
||
msgid "Downgrade configuration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdownload
|
||
msgid "Download"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
||
msgid "Do you still want to create the new project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
||
msgid "Do you still want to open another project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
||
msgid "Do you still want to quit?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
||
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdropdowncount
|
||
msgid "Drop Down Count"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdropdowncounthint
|
||
msgid "Used for all ComboBoxes in IDE dialogs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
|
||
msgid "Show nonvisual components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
|
||
msgid "Toggle showing nonvisual components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicate
|
||
msgid "Duplicate"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicateentry
|
||
msgid "Duplicate entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatefilename
|
||
msgid "Duplicate File Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
#, object-pascal-format
|
||
msgid "Duplicate found of value \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatemodename
|
||
#, object-pascal-format
|
||
msgid "Mode \"%s\" is already present in the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatename
|
||
msgid "Duplicate Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
#, object-pascal-format
|
||
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
||
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatesearchpath
|
||
msgid "Duplicate search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
||
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicateunit
|
||
msgid "Duplicate Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicateunitin
|
||
#, object-pascal-format
|
||
msgid "Duplicate unit \"%s\" in \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
|
||
msgid "Amount to scroll in"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
|
||
msgid "Amount to scroll in (%)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
|
||
msgid "Amount to scroll in (Max)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
|
||
msgid "Auto Scroll on delete past left border"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
|
||
msgid "Auto Scroll on type past right border"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
|
||
msgid "Trigger on min chars (% of width)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
|
||
msgid "Trigger on min chars visible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedit
|
||
msgctxt "lazarusidestrconsts.lisedit"
|
||
msgid "Edit"
|
||
msgstr "تغيير"
|
||
|
||
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
||
msgid "Edit additional help for messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedithelp
|
||
msgid "Edit help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditkey
|
||
msgid "Edit Key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditorcolors
|
||
msgid "Editor Colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditormacros
|
||
msgctxt "lazarusidestrconsts.liseditormacros"
|
||
msgid "Editor Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditortoolbar
|
||
msgid "Editor ToolBar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditortoolbarsettings
|
||
msgid "Editor Toolbar Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditortoolbarvisible
|
||
msgid "Editor Toolbar is &visible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedoptsloadascheme
|
||
msgid "Load a scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "غير الأدوات"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
||
msgid "Key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
||
msgid "Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for FPC messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for \"make\" messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
||
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgctxt "lazarusidestrconsts.lisemdall"
|
||
msgid "All"
|
||
msgstr "الكلّ"
|
||
|
||
#: lazarusidestrconsts.lisemdemptymethods
|
||
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
||
msgid "Empty Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdnoclass
|
||
msgid "No class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdnoclassat
|
||
#, object-pascal-format
|
||
msgid "No class at %s(%s,%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
||
#, object-pascal-format
|
||
msgid "Unable to show empty methods of the current class, because%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisempty
|
||
msgid "Empty"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemptydestinationforpublishing
|
||
msgid "Destination directory for publishing is either a relative path or empty."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenabledonlyforpackages
|
||
msgid "Enabled only for packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
||
#, object-pascal-format
|
||
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenablei18nforlfm
|
||
msgid "Enable I18N for LFM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
||
msgid "Enable internationalization and translation support"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableoptiondwarf2
|
||
msgid "Enable Dwarf 2 (-gw)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableoptiondwarf2sets
|
||
msgid "Enable Dwarf 2 with sets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableoptiondwarf3
|
||
msgid "Enable Dwarf 3 (-gw3)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableoptionxg
|
||
msgid "Enable Option -Xg?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
||
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencloseinifdef
|
||
msgid "Enclose in $IFDEF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
||
#, object-pascal-format
|
||
msgid "Number of files failed to convert: %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisendlessloopinmacros
|
||
msgid "Endless loop in macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenternewnameformacros
|
||
#, object-pascal-format
|
||
msgid "Enter new name for Macro \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
#, object-pascal-format
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
#, object-pascal-format
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
#, object-pascal-format
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
#, object-pascal-format
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
#, object-pascal-format
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
#, object-pascal-format
|
||
msgid "Error in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
||
msgid "Error in the compiler file name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
||
msgid "Error in the custom compiler options (Other):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
||
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
||
msgid "Error in the \"Debugger path addition\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
||
msgid "Error in the search path for \"Include files\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
||
msgid "Error in the search path for \"Libraries\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
||
msgid "Error in the search path for \"Object files\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
||
msgid "Error in the search path for \"Other sources\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
||
msgid "Error in the search path for \"Other unit files\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
||
msgid "Error in the \"unit output directory\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
||
#, object-pascal-format
|
||
msgid "Error: (lazarus) invalid build mode \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile2
|
||
#, object-pascal-format
|
||
msgid "Error loading file \"%s\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
#, object-pascal-format
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
#, object-pascal-format
|
||
msgid "Error moving component %s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrornamingcomponent
|
||
msgid "Error naming component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserroropeningform
|
||
msgid "Error opening form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
#, object-pascal-format
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
#, object-pascal-format
|
||
msgid "Error reading xml file \"%s\"%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "الأخطاء"
|
||
|
||
#: lazarusidestrconsts.liserrors2
|
||
#, object-pascal-format
|
||
msgid ", Errors: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorsavingform
|
||
msgid "Error saving form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
#, object-pascal-format
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
||
#, object-pascal-format
|
||
msgid "Error setting the name of a component %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingfile
|
||
#, object-pascal-format
|
||
msgid "Error writing file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
#, object-pascal-format
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
msgid "Every n-th line number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexamplefile
|
||
msgid "Example file:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
#, object-pascal-format
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexclude
|
||
msgid "Exclude"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexcludedatruntime
|
||
#, object-pascal-format
|
||
msgid "%s excluded at run time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutableisadirectory
|
||
#, object-pascal-format
|
||
msgid "executable \"%s\" is a directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
||
#, object-pascal-format
|
||
msgid "executable \"%s\" lacks the permission to run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutionstoppedexitcode
|
||
#, object-pascal-format
|
||
msgid "Execution stopped with exit-code %1:d ($%2:s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexit
|
||
msgctxt "lazarusidestrconsts.lisexit"
|
||
msgid "Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexitcode
|
||
#, object-pascal-format
|
||
msgid "Exit code %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpand
|
||
msgid "Expand"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandall
|
||
msgid "Expand All [Ctrl+Plus]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandall2
|
||
msgid "Expand All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
msgctxt "lazarusidestrconsts.lisexport"
|
||
msgid "Export"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportall
|
||
msgid "Export all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportallitemstofile
|
||
msgid "Export All Items to File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportenvironmentoptions
|
||
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
||
msgid "Export environment options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexporthtml
|
||
msgid "Export as HTML"
|
||
msgstr "حوّل إلى HTML"
|
||
|
||
#: lazarusidestrconsts.lisexportimport
|
||
msgid "Export / Import"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportpackagelistxml
|
||
msgid "Export package list (*.xml)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportselected
|
||
msgid "Export selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexportsub
|
||
msgid "Export >>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
||
#, object-pascal-format
|
||
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
||
#, object-pascal-format
|
||
msgid "Extend include files search path of project with%s\"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendincludepath
|
||
msgid "Extend include path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
||
#, object-pascal-format
|
||
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
||
#, object-pascal-format
|
||
msgid "Extend unit search path of project with%s\"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "إستخرج"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr "إستخرج الطّريقة"
|
||
|
||
#: lazarusidestrconsts.lisextremelyverbose
|
||
msgid "Extremely Verbose"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
msgid "External Tools"
|
||
msgstr "الﻷدوات الخارجيّة"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
#, object-pascal-format
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
||
#, object-pascal-format
|
||
msgid "Failed to add %d not unique resource(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
||
#, object-pascal-format
|
||
msgid "Failed to create Application Bundle for \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
||
msgid "failed to resolve macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtosavefile
|
||
msgid "Failed to save file."
|
||
msgstr "لا يمكن حفظ الجذاذة"
|
||
|
||
#: lazarusidestrconsts.lisfatal
|
||
msgctxt "lazarusidestrconsts.lisfatal"
|
||
msgid "Fatal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfile
|
||
msgctxt "lazarusidestrconsts.lisfile"
|
||
msgid "File"
|
||
msgstr "جذاذة"
|
||
|
||
#: lazarusidestrconsts.lisfile2
|
||
msgid "File: "
|
||
msgstr "الجذاذة: "
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilters
|
||
msgid "File Filters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersaddrow
|
||
msgid "Add Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
||
msgid "Delete Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
||
msgid "Insert Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersmask
|
||
msgid "File mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
||
msgid "Set defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilterstitle
|
||
msgid "These are file filters that will appear in all File Open dialogs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefound
|
||
msgid "File found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
#, object-pascal-format, fuzzy, badformat
|
||
#| msgid "File %s%s%s has changed. Save?"
|
||
msgid "File \"%s\" has changed. Save?"
|
||
msgstr "الجذاذة %s%s%s تغيّرت هل تريد حفظها؟"
|
||
|
||
#: lazarusidestrconsts.lisfilehasnoproject
|
||
msgid "File has no project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisdirectory
|
||
msgid "File is directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisnotanexecutable
|
||
msgid "File is not an executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
#, object-pascal-format
|
||
msgid "File \"%s\" is virtual."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenamestyle
|
||
msgid "Filename Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
||
msgid "File \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound3
|
||
#, object-pascal-format
|
||
msgid "file %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound4
|
||
msgid "file not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound5
|
||
#, object-pascal-format
|
||
msgid "File not found:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
#, object-pascal-format
|
||
msgid "File \"%s\" not found.%sDo you want to create it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
|
||
#, object-pascal-format
|
||
msgid "%d files were converted to text format."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
msgid "File Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
||
#, object-pascal-format
|
||
msgid "File %s has incorrect syntax."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
||
#, object-pascal-format
|
||
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileshaverightencoding
|
||
msgid "*** All found files already have the right encoding ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
||
#, object-pascal-format
|
||
msgid "File %s was converted to text format."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilter3
|
||
#, object-pascal-format
|
||
msgid "Filter: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
||
msgid "Filter all messages of certain type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
||
#, object-pascal-format
|
||
msgid "Filter all messages of type %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilteralreadyexists
|
||
msgid "Filter already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
||
msgid "Filter Debug Messages and below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterhintsandbelow
|
||
msgid "Filter Hints and below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
||
msgid "Filter Hints without Source Position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
||
msgid "Filter None, do not filter by urgency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilternonurgentmessages
|
||
msgid "Filter non urgent Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilternotesandbelow
|
||
msgid "Filter Notes and below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
||
msgid "Filter the available options list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
||
msgid "Filter Verbose Messages and below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
||
msgid "Filter Warnings and below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfind
|
||
msgid "Find ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfinddeclarationof
|
||
#, object-pascal-format
|
||
msgid "Find Declaration of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectories
|
||
msgid "D&irectories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemask
|
||
msgid "Fi&le mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
msgid "Include &sub directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "all files in &project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "all &open files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
||
msgid "&active file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "&directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
|
||
msgid "project &group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Search location"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindmissingunit
|
||
msgid "Find missing unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfirsttest
|
||
msgid "&First test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfocushint
|
||
msgid "Focus hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
||
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisformacosdarwin
|
||
msgid "For macOS (Darwin)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisforwindows
|
||
msgid "For Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfoundversionexpected
|
||
#, object-pascal-format
|
||
msgid "Found version %s, expected %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
||
msgid "FPC version as one number (e.g. 20701)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagefile2
|
||
msgid "FPC message file:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagesappendix
|
||
msgid "FPC messages: Appendix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcresources
|
||
msgid "FPC resources (.res)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcsources
|
||
msgid "FPC sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpctooold
|
||
msgid "FPC too old"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "محرّر أوامر FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocerrorwriting
|
||
#, object-pascal-format
|
||
msgid "Error writing \"%s\"%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
||
msgid "FPDoc syntax error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagename
|
||
msgid "FPDoc package name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
||
msgid "FPDoc package name. Default is project file name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
||
#, object-pascal-format
|
||
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgcompilernotexecutable
|
||
#, object-pascal-format
|
||
msgid "The compiler [%s] configured for Fppkg is not an executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgcompilernotexists
|
||
#, object-pascal-format
|
||
msgid "The compiler [%s] configured for Fppkg does not exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgcompilernotfound
|
||
#, object-pascal-format
|
||
msgid "Could not find the compiler [%s] configured for Fppkg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgcompilerproblem
|
||
msgid "there is a problem with the Free Pascal compiler executable, "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgconfgenproblems
|
||
msgid "Warnings have to be resolved first"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgconfiguration
|
||
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgcreatefilefailed
|
||
#, object-pascal-format
|
||
msgid "Failed to generate the configuration file \"%s\": %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfilestobewritten
|
||
msgid "Files to be written:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfixconfiguration
|
||
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
|
||
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
|
||
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
|
||
msgid "An up-to-date version is needed to create the configuration files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
|
||
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
|
||
msgid "It is probably too old to create the configuration files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
|
||
#, object-pascal-format
|
||
msgid "The fpcmkcfg configuration tool it too old [%s]."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkginstallationpath
|
||
#, object-pascal-format
|
||
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkglibprefix
|
||
#, object-pascal-format
|
||
msgid "Fpc library prefix: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgprefix
|
||
#, object-pascal-format
|
||
msgid "Fpc prefix: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgproblem
|
||
msgid "Problem with Fppkg configuration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
|
||
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgrtlnotfound
|
||
msgid "Fppkg reports that the RTL is not installed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgwriteconfexception
|
||
#, object-pascal-format
|
||
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgwriteconffailed
|
||
#, object-pascal-format
|
||
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfppkgwriteconfigfile
|
||
msgid "Write new configuration files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreeingbufferlines
|
||
#, object-pascal-format
|
||
msgid "freeing buffer lines: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
||
msgid "Free Pascal Compiler messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascalprefix
|
||
msgid "Free Pascal compiler prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
msgid "Free Pascal source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
#, object-pascal-format
|
||
msgid "Identifier: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrirenaming
|
||
msgid "Renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrisearch
|
||
msgid "Search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfull
|
||
msgid "Full"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgid "Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgeneral
|
||
msgctxt "lazarusidestrconsts.lisgeneral"
|
||
msgid "General"
|
||
msgstr "عامّ"
|
||
|
||
#: lazarusidestrconsts.lisgeneratefppkgcfg
|
||
#, object-pascal-format
|
||
msgid "Fppkg configuration: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
|
||
#, object-pascal-format
|
||
msgid "Fppkg compiler configuration: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
|
||
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
|
||
msgid "Generate new Fppkg configuration files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
||
msgid "Get word at current cursor position."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisglobalsettings
|
||
msgid "Global settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgotoline
|
||
msgid "Goto Line"
|
||
msgstr "إذهب إلى السّطر "
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
||
"\n"
|
||
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
||
"\n"
|
||
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgrouplocalvariables
|
||
msgid "Group automatically defined local variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
||
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisheadercolors
|
||
msgid "Header colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "مساعد إختيار المعونة"
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for Free Pascal Compiler message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
||
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
||
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
||
msgid "Hide message by inserting IDE directive {%H-}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
||
#, object-pascal-format
|
||
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidesearch
|
||
msgid "Hide Search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidewindow
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.lishidewindow"
|
||
msgid "Hide window"
|
||
msgstr "إخف النّافذة"
|
||
|
||
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
||
#, object-pascal-format
|
||
msgid "Hide with package option (-vm%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
||
#, object-pascal-format
|
||
msgid "Hide with project option (-vm%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishint
|
||
msgctxt "lazarusidestrconsts.lishint"
|
||
msgid "Hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
||
msgid "Hint: A default value can be defined in the conditionals."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
||
msgid "A hint at property's name shows its description."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
||
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishints
|
||
#, object-pascal-format
|
||
msgid ", Hints: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
#, object-pascal-format
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "خيارات المعونة"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
||
msgid "Horizontal lines between properties."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisid
|
||
msgctxt "lazarusidestrconsts.lisid"
|
||
msgid "ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidcaddition
|
||
msgid "Addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidcopening
|
||
msgid "Opening"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidebuildoptions
|
||
msgid "IDE build options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidecompileandrestart
|
||
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
||
#, object-pascal-format
|
||
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
||
#, object-pascal-format
|
||
msgid "Creating Makefile for package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
||
msgid "Information about the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidemacros
|
||
msgid "IDE Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
||
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
||
msgid "The IDE maintains the title in main unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
||
msgid "IDE title shows selected build mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
||
msgid "IDE title shows project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
||
msgid "IDE title starts with project name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoallbuildmodes
|
||
msgid "All build modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecocompileroptionsof
|
||
msgid "Compiler options of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
||
msgid "Current build mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoerroropeningxml
|
||
msgid "Error opening XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
||
#, object-pascal-format
|
||
msgid "Error opening XML file \"%s\":%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
||
msgid "Export Compiler Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
#, object-pascal-format
|
||
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
||
msgid "Import Compiler Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
||
#, object-pascal-format
|
||
msgid "File \"%s\" does not contain compiler options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "إحفظ في الجذاذة"
|
||
|
||
#: lazarusidestrconsts.lisifnotchecked
|
||
msgid "If not checked:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
||
msgid "If only the session info changed, ask about saving it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
||
#, object-pascal-format
|
||
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignoreuseasancestor
|
||
#, object-pascal-format
|
||
msgid "Ignore, use %s as ancestor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
||
msgid "Imitate indentation of current unit, project or package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimplementationcommentforclass
|
||
msgid "Implementation comment for class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimport
|
||
msgctxt "lazarusidestrconsts.lisimport"
|
||
msgid "Import"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportant
|
||
msgctxt "lazarusidestrconsts.lisimportant"
|
||
msgid "Important"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportenvironmentoptions
|
||
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
||
msgid "Import environment options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportfromfile
|
||
msgid "Import from File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
||
msgid "Importing BuildModes is not supported for packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimportpackagelistxml
|
||
msgid "Import package list (*.xml)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisimpossible
|
||
msgid "Impossible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
||
#, object-pascal-format
|
||
msgid "In a source directory of the package \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
||
msgid "In a source directory of the project. Check for duplicates."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincluderecursive
|
||
msgid "Include, recursive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincompatibleppu
|
||
#, object-pascal-format
|
||
msgid ", incompatible ppu=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
||
msgid "Incorrect configuration directory found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
|
||
#, object-pascal-format
|
||
msgid "there is a problem with the Fppkg configuration. (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisindentationforpascalsources
|
||
msgid "Indentation for Pascal sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinformation
|
||
msgid "Information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
#, object-pascal-format
|
||
msgid "Information about %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
||
msgid "Information about used FPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
||
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
msgid "In front of related"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheritedparameters
|
||
msgid "Inherited parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
||
msgid "Inherited project component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinitialchecks
|
||
msgid "Initial Checks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinitializelocalvariable
|
||
msgid "Initialize Local Variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
#, object-pascal-format
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsert
|
||
msgctxt "lazarusidestrconsts.lisinsert"
|
||
msgid "Insert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertassignment
|
||
#, object-pascal-format
|
||
msgid "Insert Assignment %s := ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
||
msgid ""
|
||
"Insert header of current procedure.\n"
|
||
"\n"
|
||
"Optional Parameters (comma separated):\n"
|
||
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
||
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
||
"AddClassName, // extract/add ClassName.\n"
|
||
"WithoutClassName, // skip classname\n"
|
||
"WithoutName, // skip function name\n"
|
||
"WithoutParamList, // skip param list\n"
|
||
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
||
"WithParameterNames, // extract parameter names\n"
|
||
"WithoutParamTypes, // skip colon, param types and default values\n"
|
||
"WithDefaultValues, // extract default values\n"
|
||
"WithResultType, // extract colon + result type\n"
|
||
"WithOfObject, // extract 'of object'\n"
|
||
"WithCallingSpecs, // extract cdecl; inline;\n"
|
||
"WithProcModifiers, // extract forward; alias; external;\n"
|
||
"WithComments, // extract comments and spaces\n"
|
||
"InUpperCase, // turn to uppercase\n"
|
||
"CommentsToSpace, // replace comments with a single space\n"
|
||
" // (default is to skip unnecessary space,\n"
|
||
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
||
" // with this option you get 'Do ;')\n"
|
||
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
||
"WithoutSemicolon, // skip semicolon at end\n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertmacro
|
||
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
||
msgid "Insert Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
||
msgid "Insert semicolon if needed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
msgid "Insert time. Optional: format string."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinserturltag
|
||
msgid "Insert url tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsession
|
||
msgid "In session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstalled
|
||
msgid "installed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallitilikethefat
|
||
msgid "Install it, I like the fat"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallpackagesmsg
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"The following packages are not installed, but available in the main repository: %s.\n"
|
||
"Do you wish to install missing packages?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "ثبّت التّعيينات"
|
||
|
||
#: lazarusidestrconsts.lisinstalluninstallpackages
|
||
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
||
msgid "Install/Uninstall Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
||
msgid "Instead of compile package create a simple Makefile."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsufficientencoding
|
||
msgid "Insufficient encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinteractive
|
||
msgid "Interactive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinternalerror
|
||
#, object-pascal-format
|
||
msgid "internal error: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidexecutable
|
||
msgid "Invalid Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is not executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
#, object-pascal-format
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilename
|
||
msgid "Invalid file name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
||
#, object-pascal-format
|
||
msgid "Invalid line, column in message%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrosin
|
||
#, object-pascal-format
|
||
msgid "Invalid macros in \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
||
#, object-pascal-format
|
||
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
||
#, object-pascal-format
|
||
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
||
#, object-pascal-format
|
||
msgid "Invalid macro name \"%s\". The name is a keyword."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmask
|
||
msgid "Invalid Mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmode
|
||
#, object-pascal-format
|
||
msgid "Invalid mode %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiername
|
||
#, object-pascal-format
|
||
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidversionin
|
||
#, object-pascal-format
|
||
msgid "invalid version in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
#, object-pascal-format
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s أدمج مسبقا في المشروع"
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
#, object-pascal-format, fuzzy, badformat
|
||
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s ليس مقبولا كإسم مشروع. %s إختر إسما آخر رجاء"
|
||
|
||
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
||
#, object-pascal-format
|
||
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisisddirectorynotfound
|
||
msgid "directory not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisissues
|
||
msgid "Issues"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||
#, object-pascal-format
|
||
msgid "I wonder how you did that. Error in the %s:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||
msgid "I wonder how you did that: Error in the base directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisjhjumphistory
|
||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||
msgid "Jump History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisjumptoerror
|
||
msgid "Jump to error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
||
msgid "When an error in the sources is found at identifier completion, jump to it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisjumptoprocedure
|
||
#, object-pascal-format
|
||
msgid "Jump to procedure %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskb
|
||
#, object-pascal-format
|
||
msgid "%s KB"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeep2
|
||
msgid "Keep"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepfileopen
|
||
msgid "Keep converted files open in editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepfileopenhint
|
||
msgid "All project files will be open in editor after conversion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepopen
|
||
msgid "Keep open"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
||
msgid "Keep relative indentation of multi line template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepsubindentation
|
||
msgid "Keep indentation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskey
|
||
msgctxt "lazarusidestrconsts.liskey"
|
||
msgid "Key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "أوقف البناء"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpaddress
|
||
msgid "Add Address Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddbpsource
|
||
msgid "Add Source Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
||
msgid "Add Data/WatchPoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgctxt "lazarusidestrconsts.liskmaddwatch"
|
||
msgid "Add watch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmbuildmanymodes
|
||
msgid "Build many modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcleanupandbuild
|
||
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
||
msgid "Clean up and build"
|
||
msgstr "نضّف وإبن"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "أغلق المشروع"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcompileprojectprogram
|
||
msgid "Compile project/program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config \"Build File\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
msgid "Configure Custom Components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi Project to Lazarus Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi Unit to Lazarus Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM File to LFM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmdefaulttoosx
|
||
msgid "Default adapted to macOS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
msgid "Diff Editor Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
msgid "Find Incremental"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to bookmark 0"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to bookmark 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to bookmark 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to bookmark 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to bookmark 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to bookmark 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to bookmark 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to bookmark 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to bookmark 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to bookmark 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "macOS, Apple style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "macOS, Lazarus style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr "وحدة جديدة"
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmopenrecent
|
||
msgctxt "lazarusidestrconsts.liskmopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmopenrecentpackage
|
||
msgid "Open recent package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmopenrecentproject
|
||
msgid "Open recent project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
||
msgid "Remove Active File from Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "إحفظ الكلّ"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "إحفظ نسخة جديدة"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "إحفظ المشروع"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "إحفظ نسخة جديدة من المشروع"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
||
msgid "Select Line End"
|
||
msgstr "عيّن نهاية السّطر"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "عيّن بداية السّطر"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "عيّن نهاية الصّفحة"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "عيّن بداية الصّفحة"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "عيّن الكلمة الّتي على اليسار"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "عيّن الكلمة الّتي على اليمين"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set bookmark 0"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set bookmark 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set bookmark 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set bookmark 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set bookmark 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set bookmark 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set bookmark 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set bookmark 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set bookmark 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set bookmark 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
msgid "Stop Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle bookmark 0"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle bookmark 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle bookmark 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle bookmark 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle bookmark 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle bookmark 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle bookmark 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle bookmark 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle bookmark 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle bookmark 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewassembler
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
||
msgid "View Assembler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
msgid "View Breakpoints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
||
msgid "Toggle view Code Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
msgid "Toggle View Component Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
||
msgid "View Debuger Event Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
msgid "View Debugger Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewhistory
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
||
msgid "View History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
msgid "View Local Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
||
msgid "View Console In/Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewregisters
|
||
msgid "View Registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewthreads
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
||
msgid "View Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
msgid "View Watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
msgid "View Project Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislastopened
|
||
msgid "Last opened"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusdefault
|
||
msgid "Lazarus Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusdirhint
|
||
#, object-pascal-format
|
||
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusdiroverride
|
||
msgid "directory to be used as a basedirectory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
#, object-pascal-format
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuild
|
||
msgid "lazbuild"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
||
msgid "Are you sure you want to delete this build profile?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildmany
|
||
msgid "Build Many"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildcommonsettings
|
||
msgid "Common Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
msgid "Confirm before build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
||
msgid "Confirm deletion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilddebugide
|
||
msgid "Debug IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefines
|
||
msgid "Defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
||
msgid "Defines without -d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditdefines
|
||
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
||
msgid "Edit Defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
||
msgid "Edit list of defines which can be used by any profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
#, object-pascal-format
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
||
msgid "Manage Build Profiles"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
||
msgid "Manage profiles"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
||
msgid "Name of the active profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprof
|
||
msgid "Add New Profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
||
msgid "Current build options will be associated with:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildnormalide
|
||
msgid "Normal IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptimizedide
|
||
msgid "Optimized IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
||
msgid "Options passed to compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildprofile
|
||
msgid "Profile to build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprof
|
||
msgid "Rename Profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
||
msgid "New name for profile:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
msgid "Restart after building IDE"
|
||
msgstr "أعد التّشغيل بعد بناء بيئة التّطوير المدمجة"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
||
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
||
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
||
msgid "Select profiles to build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
||
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
||
msgid "Show confirmation dialog when building directly from Tools menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
||
msgid "Show options and defines for command line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
#, object-pascal-format
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
||
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
||
msgid "Update revision.inc"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
||
msgid "Update revision info in \"About Lazarus\" dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazcleanupbuildall
|
||
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
||
msgid "Clean Up + Build all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazver
|
||
msgid "Lazarus Version (e.g. 1.2.4)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
msgid "LCL widget type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
||
#, object-pascal-format
|
||
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
||
msgid "No valid FPDoc path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
#, object-pascal-format
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisless
|
||
msgctxt "lazarusidestrconsts.lisless"
|
||
msgid "Less"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgctxt "lazarusidestrconsts.lislevels"
|
||
msgid "Levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
||
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
||
"\n"
|
||
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
||
"\n"
|
||
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
||
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
#, object-pascal-format
|
||
msgid "Loading %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisloadmacrofrom
|
||
msgid "Load macro from"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislocal
|
||
msgid "&Local"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
|
||
msgid "Maximize compatibility of project files (LPI and LPS)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
|
||
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
|
||
msgid "Maximize compatibility of package file (LPK)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
|
||
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
||
#, object-pascal-format
|
||
msgid "lpk has vanished on disk. Using as alternative%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislpkismissing
|
||
msgid "lpk is missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislrsincludefiles
|
||
msgid "Lazarus resources (.lrs) include files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacpreferences
|
||
msgid "Preferences..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacro
|
||
#, object-pascal-format
|
||
msgid "Macro %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main unit has Uses section containing all units of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
msgid "Main unit is Pascal source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
||
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismajorchangesdetected
|
||
msgid "Major changes detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakecurrent
|
||
msgctxt "lazarusidestrconsts.lismakecurrent"
|
||
msgid "Current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
#, object-pascal-format
|
||
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
||
msgid "Make sure all ppu files of a package are in its output directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismanagesourceeditors
|
||
msgid "Manage Source Editors ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
||
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
||
#, object-pascal-format
|
||
msgid "Maximum parallel processes, 0 means default (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
||
#, object-pascal-format
|
||
msgid "%s Maybe you have to recompile the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismb
|
||
#, object-pascal-format
|
||
msgid "%s MB"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "أوقف البناء"
|
||
|
||
#: lazarusidestrconsts.lismenuaboutfpc
|
||
msgid "About FPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
msgid "Add &Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
||
msgid "Add Active File to Package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
msgid "Add Jump Point to History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
msgid "Add Editor File to Project"
|
||
msgstr "أضف الجذاذة للمشروع"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
msgid "Add &Watch ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
msgid "Break Lines in Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "ترجم الجذاذة"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
msgid "Build Lazarus with Current Profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarusprof
|
||
#, object-pascal-format
|
||
msgid "Build Lazarus with Profile: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
msgid "Check LFM File in Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
msgid "Clean Directory ..."
|
||
msgstr "نظّف الملفّ ..."
|
||
|
||
#: lazarusidestrconsts.lismenucleanupandbuild
|
||
msgid "Clean up and Build ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
#, fuzzy
|
||
#| msgid "Close A&ll Editor Files"
|
||
msgid "Close A&ll"
|
||
msgstr "أغلق كلّ الجذاذات المفتوحة في المحرّر"
|
||
|
||
#: lazarusidestrconsts.lismenucloseeditorfile
|
||
msgid "&Close Editor File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "أغلق المشروع"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
msgid "Comment Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucomparefiles
|
||
msgid "Compare files ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucompilemanymodes
|
||
msgid "Compile many Modes ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
||
msgid "Complete Code (with dialog)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
msgid "Configure Custom Components ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
msgid "Configure External Tools ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
msgid "Convert Delphi Package to Lazarus Package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
msgid "Convert Delphi Project to Lazarus Project ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
msgid "Convert Binary DFM to LFM ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
msgid "Convert Encoding of Projects/Packages ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
msgid "Debug Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenudelphiconversion
|
||
msgid "Delphi Conversion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "تغيير"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
msgid "Install/Uninstall Packages ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
||
#, object-pascal-format
|
||
msgid "Accelerator(&&) key \"%s\" needs changing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
||
msgid "Add a new item above selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
||
msgid "Add a new item after selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
||
msgid "Add a new item before selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
||
msgid "Add a new item below selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
||
msgid "Add a submenu at the right of selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
||
msgid "Add a submenu below selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
||
msgid "&Add from template ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
||
#, object-pascal-format
|
||
msgid "Add icon from %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
||
msgid "Add imagelist &icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
||
msgid "Add menu item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
||
msgid "&Add new item above"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
||
msgid "Add ne&w item after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
||
msgid "&Add new item before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
||
msgid "Add ne&w item below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
||
msgid "Add &OnClick handler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
||
msgid "Add separator &after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
||
msgid "Add separator &before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
||
msgid "Add submenu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
||
msgid "Add &submenu below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
||
msgid "Add &submenu right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
||
#, object-pascal-format
|
||
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
||
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
||
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
||
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
||
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaption
|
||
msgid "Caption"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
||
#, object-pascal-format
|
||
msgid "Captioned items: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
||
msgid "Caption should not be blank"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
||
#, object-pascal-format
|
||
msgid "Change conflicting accelerator \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
||
msgid "Change imagelist &icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
||
#, object-pascal-format
|
||
msgid "Change %s for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
||
#, object-pascal-format
|
||
msgid "Change shortcut conflict \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
||
#, object-pascal-format
|
||
msgid "Change the shortCut for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
||
#, object-pascal-format
|
||
msgid "Change the shortCutKey2 for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
||
msgid "Choose template to delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
||
msgid "Choose template to insert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
||
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
||
msgid "Component is unexpected kind"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
||
msgid "Component is unnamed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
||
msgid "<conflict resolution complete>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
||
#, object-pascal-format
|
||
msgid "Conflicts found initially: %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
||
#, object-pascal-format
|
||
msgid "Deepest nested menu level: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "&Delete item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
||
msgid "&Delete menu template ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
||
msgid "Delete saved menu template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
||
msgid "Delete selected menu template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
||
msgid "Delete this item and its subitems?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
||
msgid "Display preview as &Popup menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditcaption
|
||
msgid "Edit &Caption"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
||
#, object-pascal-format
|
||
msgid "Editing Caption of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingsdots
|
||
#, object-pascal-format
|
||
msgid "To resolve conflict edit %s.%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingsfors
|
||
#, object-pascal-format
|
||
msgid "Editing %s for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
||
#, object-pascal-format
|
||
msgid "Editing %s.%s - no menuitem selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
||
msgid "Enter a menu &Description:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
||
#, object-pascal-format
|
||
msgid "Enter a new ShortCut for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
||
#, object-pascal-format
|
||
msgid "Enter a new ShortCutKey2 for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
||
msgid "Existing saved templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
||
msgid "Further shortcut conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
||
msgid "Get help to use this editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorgrabkey
|
||
msgid "&Grab key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorgroupindexd
|
||
#, object-pascal-format
|
||
msgid "GroupIndex: %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
||
#, object-pascal-format
|
||
msgid "Values in use: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
||
msgid "Inadequate Description"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
||
#, object-pascal-format
|
||
msgid "Insert menu template into root of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
||
msgid "Insert selected menu template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorisnotassigned
|
||
msgid "is not assigned"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoritemswithicons
|
||
#, object-pascal-format
|
||
msgid "Items with icon: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
||
#, object-pascal-format
|
||
msgid "List shortcuts and &accelerators for %s ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
||
#, object-pascal-format
|
||
msgid "List shortcuts for %s ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormenuitemactions
|
||
msgid "Menu Item actions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
||
#, object-pascal-format
|
||
msgid "Menuitem shortcut conflicts in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemdown
|
||
msgid "Mo&ve item down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemleft
|
||
msgid "&Move item left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemright
|
||
msgid "Mo&ve item right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemup
|
||
msgid "&Move item up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
||
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
||
msgid "Move selected item down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
||
msgid "Move selected item to the left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
||
msgid "Move selected item to the right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
||
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
||
msgid "Move selected item up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorna
|
||
msgid "n/a"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditornomenuselected
|
||
msgid "(no menu selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditornone
|
||
msgid "<none>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditornonenone
|
||
msgid "<none>,<none>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
||
msgid "<no shortcut conflicts>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
||
msgid "No user-saved templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
||
#, object-pascal-format
|
||
msgid "Pick an icon from %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
||
#, object-pascal-format
|
||
msgid "Popup assignments: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorradioitem
|
||
msgid "RadioItem"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
||
#, object-pascal-format
|
||
msgid "Remaining conflicts: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
||
msgid "&Remove all separators"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
||
#, object-pascal-format
|
||
msgid "Resolved conflicts: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
||
msgid "Resolve selected conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
||
msgid "&Resolve shortcut conflicts ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
||
msgid "Saved templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
||
msgid "&Save menu as a template ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
||
msgid "Save menu as template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
||
msgid "Save menu as template for future use"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
||
msgid "Save menu shown as a new template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
||
#, object-pascal-format
|
||
msgid "%s conflicts with %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorseparators
|
||
msgid "Se¶tors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
||
#, object-pascal-format
|
||
msgid "Shortcut items: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
||
msgid "Shortcut not yet changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcuts
|
||
msgid "Shortcuts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcuts2
|
||
msgid "Shortc&uts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
||
msgid "Shortcuts and Accelerator keys"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsd
|
||
#, object-pascal-format
|
||
msgid "Shortcuts (%d)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
||
#, object-pascal-format
|
||
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
||
msgid "Shortcut,Source Property"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
||
#, object-pascal-format
|
||
msgid "Shortcuts used in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
||
#, object-pascal-format
|
||
msgid "Shortcuts used in %s (%d)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
||
msgid "ShowMenuEditor: TMenu parameter is nil"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsins
|
||
#, object-pascal-format
|
||
msgid "\"%s\" in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"\"%s\" is already in use in %s as a shortcut.\n"
|
||
"Try a different shortcut."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
||
#, object-pascal-format
|
||
msgid "Please expand: \"%s\" is not a sufficient Description"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
||
msgid "Some widgetsets do not allow separators in the main menubar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsshortcuts
|
||
#, object-pascal-format
|
||
msgid "%s: Shortcuts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
||
#, object-pascal-format
|
||
msgid "%s: Shortcuts and accelerator keys"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorsssonclicks
|
||
#, object-pascal-format
|
||
msgid "%s.%s.%s - OnClick: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
||
msgid "Standard templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatedescription
|
||
msgid "Template description:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplates
|
||
msgid "&Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatesaved
|
||
msgid "Template saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
||
msgid ""
|
||
"There are no user-saved menu templates.\n"
|
||
"\n"
|
||
"Only standard default templates are available."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
||
#, object-pascal-format
|
||
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"You have to change the shortcut from %s\n"
|
||
"to avoid a conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
||
msgid "You must enter text for the Caption"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuencloseinifdef
|
||
msgid "Enclose in $IFDEF ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
msgid "Enclose Selection ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
msgid "E&valuate/Modify ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
msgid "Extract Procedure ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "جذاذة"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "إبحث"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "إبحث"
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
msgid "Find Other End of Code Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
msgid "Find Start of Code Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find &in files ..."
|
||
msgid "Find &in Files ..."
|
||
msgstr "إبحث في الجذاذات"
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "إبحث عن التالي"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "إبحث عن السابق"
|
||
|
||
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
||
msgid "Find References Of Used Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
msgid "Goto Include Directive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
msgid "Goto Line ..."
|
||
msgstr "إذهب إلى السّطر ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
msgid "Guess Misplaced IFDEF/ENDIF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
msgid "Guess Unclosed Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "معونة"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
msgid "IDE Internals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
msgid "Indent Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
msgid "ChangeLog Entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
msgid "Insert from Character Map ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
msgid "Insert CVS Keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
msgid "Current Date and Time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertfilename
|
||
msgid "Insert Full Filename ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "Insert General"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
msgid "GPL Notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
||
msgid "GPL Notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
msgid "LGPL Notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
||
msgid "LGPL Notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmitnotice
|
||
msgid "MIT Notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
||
msgid "MIT Notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL Notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
||
msgid "Modified LGPL Notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
msgid "Current Username"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
msgctxt "lazarusidestrconsts.lismenuinspect"
|
||
msgid "&Inspect ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
msgid "Jump Back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
msgid "Jump Forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementation
|
||
msgid "Jump to Implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
||
msgid "Jump to Implementation uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoinitialization
|
||
msgid "Jump to Initialization"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptointerface
|
||
msgid "Jump to Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
||
msgid "Jump to Interface uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
msgid "Jump to Next Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
msgid "Jump to Next Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
msgid "Jump to Previous Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
msgid "Jump to Previous Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
||
msgid "Jump to Procedure begin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
||
msgid "Jump to Procedure header"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
msgid "Lowercase Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenumacrolistview
|
||
msgctxt "lazarusidestrconsts.lismenumacrolistview"
|
||
msgid "Editor Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenumultipaste
|
||
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
||
msgid "MultiPaste ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewcomponent
|
||
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
||
msgid "New Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewcustom
|
||
#, object-pascal-format
|
||
msgid "New %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "&شكل جديد"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "إصنع"
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
msgid "New Package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "مشروع &جديد ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
msgid "New Project from File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "وحدة جديدة"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "معونة على شبكة الإتصالات العالمية"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
#, fuzzy
|
||
#| msgid "Open ..."
|
||
msgid "&Open ..."
|
||
msgstr "إفتح ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
msgid "Open Filename at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenfolder
|
||
msgid "Open Folder ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
msgid "Open Loaded Package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
msgid "Open Package File (.lpk) ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
msgid "Open Package of Current Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "إفتح المشروع ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
#, fuzzy
|
||
#| msgid "Open &Recent ..."
|
||
msgid "Open &Recent"
|
||
msgstr "إفتح ملفا أستعمل حديثا ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
msgid "Open Recent Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
#, fuzzy
|
||
#| msgid "Open Recent Project ..."
|
||
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "إفتح مشروعا أستعمل حديثا ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenunit
|
||
msgid "Open Unit ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
msgid "Pa&ckage"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
msgid "Package Graph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
msgid "Package Links ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupastefromclipboard
|
||
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
||
msgid "Paste from clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
||
msgid "New package component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuprocedurelist
|
||
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
||
msgid "Procedure List ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "مشروع"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "&Run"
|
||
msgstr "تشغيل"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
msgid "Quick Compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
msgid "Quick Syntax Check"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
||
msgid "Reporting a Bug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
||
msgid "Resave forms with enabled i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC Source Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
msgid "Reset Debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "ألغ التّغييرات"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgctxt "lazarusidestrconsts.lismenurun"
|
||
msgid "&Run"
|
||
msgstr "تشغيل"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
msgid "Run &Parameters ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
||
msgid "Run to Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurunwithdebugging
|
||
msgid "Run with Debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
||
msgid "Run without Debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "إحفظ"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
msgid "Save &As ..."
|
||
msgstr "إحفظ في نسخة جديدة ..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "إخفظ المشروع"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "إحفظ نسخة جديدة من المشروع"
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "بحث"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "عيّن"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
msgctxt "lazarusidestrconsts.lismenuselectall"
|
||
msgid "Select All"
|
||
msgstr "عيّى الكلّ"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
msgid "Select Code Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
msgid "Select Line"
|
||
msgstr "عيّن سطرا"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
msgid "Select Paragraph"
|
||
msgstr "عيّن فقرة"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
msgid "Select to Brace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
msgid "Select Word"
|
||
msgstr "عيّن كلمة"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenushowexecutionpoint
|
||
msgid "S&how Execution Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenushowsmarthint
|
||
msgid "Context sensitive smart hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
msgid "Sort Selection ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenusource
|
||
msgid "S&ource"
|
||
msgstr "أمر"
|
||
|
||
#: lazarusidestrconsts.lismenuswapcaseselection
|
||
msgid "Swap Case in Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
msgid "Tabs to Spaces in Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
||
msgid "About"
|
||
msgstr "بطاقة التعريف"
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
msgid "Toggle Comment in Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "أدوات"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
msgid "Uncomment Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
msgid "Unindent Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
msgid "Uppercase Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuuseunit
|
||
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
||
msgid "Add Unit to Uses Section ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "هيأة"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
msgid "Anchor Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "عارض الأوامر"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "كاشف الأوامر"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
msgid "Component Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "عناصر"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugevents
|
||
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
||
msgid "Event Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
msgid "Debug Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
msgid "Forms ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewhistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
||
msgid "History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
||
msgid "Jump History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
|
||
msgid "Local Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewprojectsource
|
||
msgid "&View Project Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
|
||
msgid "Console In/Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "محرّر الأوامر"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtaborder
|
||
msgid "Tab Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewthreads
|
||
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
||
msgid "Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
msgid "Toggle Form/Unit View"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
msgid "Unit Information ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
msgid "Units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgctxt "lazarusidestrconsts.lismenuviewwatches"
|
||
msgid "Watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
||
msgid "What Needs Building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "نوافذ"
|
||
|
||
#: lazarusidestrconsts.lismeother
|
||
msgctxt "lazarusidestrconsts.lismeother"
|
||
msgid "Other tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismessageswindow
|
||
msgid "Messages Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingdirectory
|
||
#, object-pascal-format
|
||
msgid "missing directory \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingexecutable
|
||
#, object-pascal-format
|
||
msgid "missing executable \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitschoices
|
||
msgid "Your choices are:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitscomment
|
||
msgid "Comment Out"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||
msgid "For Delphi only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1
|
||
msgid "1) Comment out the selected units."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1b
|
||
msgid "1) Use the units only for Delphi."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo2
|
||
msgid "2) Search for units. Found paths are added to project settings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo3
|
||
msgid "3) Leave these units in uses sections as they are."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitssearch
|
||
msgid "Search Unit Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingunitsskip
|
||
msgctxt "lazarusidestrconsts.lismissingunitsskip"
|
||
msgid "Skip"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismitnotice
|
||
#, fuzzy
|
||
#| msgid ""
|
||
#| "<description>\n"
|
||
#| "\n"
|
||
#| "Copyright (c) <year> <copyright holders>\n"
|
||
#| "\n"
|
||
#| "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
||
#| "\n"
|
||
#| "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
||
#| "\n"
|
||
#| "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (c) <year> <copyright holders>\n"
|
||
"\n"
|
||
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
||
"\n"
|
||
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
||
"\n"
|
||
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
|
||
msgstr "<وصف>%sحقوق الطبع (ن) <سنة> <حاملوا حقوق النسخ>%sبهذا يتم منح الترخيص، بدون مقابل، لأي فرد يتحصّل على نسخة من هذا البرنامج وملفات التوثيق المرافقة (ال \"Software\"), للتعامل مع البرنامج بدون قيد متضمنا بلا حدود الحقوق للاستخدام، والنسخ، والتعديل، والدمج، والنشر، والتوزيع، والترخيص الفرعي، و/أو بيع نسخ من البرنامج، والسماح للأفراد الذين زؤّدوا بالبرنامج بالتصرّف بالمثل، مع الخضوع للشروط التالية: %sيجب تضمين إشعار حقوق الملكية أعلاه وإشعار الإذن هذا في كل نسخ البرنامج أو أجزاءه المهمة. %sالبرنامج مقدّم \"AS IS\"، بدون ضمانة من أي نوع، صراحة كانت أو تضمينا، بما في ذلك و بلا حدّ ضمانات الصلاحية السوقية، والملائمة لغرض معين، وعدم الاخلال. تحت أي طارئ لا يتحمّل المؤلفون أو حاملو حقوق الملكية مسؤولية أي ادّعاء، أو ضرر أو أية مسؤوليات أخرى، سواء كانت جرّاء عقد، أو خطأ أو غير ذلك، تنتج من، أو عن أو بالارتباط بالبرنامج أو الاستخدام أو أية تعاملات أخرى تخصّ البرنامج."
|
||
|
||
#: lazarusidestrconsts.lismmadditionsandoverrides
|
||
msgid "Additions and Overrides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmaddscustomoptions
|
||
msgid "Adds custom options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
||
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackages
|
||
msgid "Apply to all packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
||
msgid "Apply to all packages and projects."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
||
#, object-pascal-format
|
||
msgid "Apply to all packages matching name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoproject
|
||
msgid "Apply to project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
||
msgid "Create a new group of options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmcustomoption
|
||
msgid "Custom Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
||
msgid "Delete the selected target or option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
||
msgid "Does not add custom options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
||
#, object-pascal-format
|
||
msgid "Does not have IDE Macro %s:=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
||
msgid "Does not override OutDir (-FU)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
||
#, object-pascal-format
|
||
msgid "Exclude all packages matching name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
||
#, object-pascal-format
|
||
msgid "expected \":=\" after macro name but found \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
||
#, object-pascal-format
|
||
msgid "expected macro name but found \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmfromto
|
||
#, object-pascal-format
|
||
msgid "From %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmidemacro
|
||
msgid "IDE Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmidemacro2
|
||
#, object-pascal-format
|
||
msgid "IDE Macro %s:=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterat
|
||
#, object-pascal-format
|
||
msgid "invalid character \"%s\" at %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
||
#, object-pascal-format
|
||
msgid "invalid character in macro value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmissingmacroname
|
||
msgid "missing macro name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
||
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
||
msgid "Move selected item down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemup
|
||
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
||
msgid "Move selected item up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmnewtarget
|
||
msgid "New Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
||
#, object-pascal-format
|
||
msgid "Override OutDir (-FU): %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
||
msgid "Override output directory (-FU)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
||
msgid "Override output directory -FU of target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
||
msgid "Redo last undo to this grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
||
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmsets
|
||
#, object-pascal-format
|
||
msgid "Set \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
||
msgid "Stored in IDE (environmentoptions.xml)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
||
msgid "Stored in project (.lpi)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
||
msgid "Stored in session of project (.lps)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmtargets
|
||
msgid "Targets: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
||
msgid "Undo last change to this grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmusesystemencoding
|
||
msgid "Use system encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmusesystemencodinghint
|
||
msgid "Disable support for UTF-8 default string encoding."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmvalues
|
||
#, object-pascal-format
|
||
msgid "Value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmwas
|
||
#, object-pascal-format
|
||
msgid "(was \"%s\")"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
||
msgid "WidgetSet change is available only for LCL projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismode
|
||
#, object-pascal-format
|
||
msgid ", Mode: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
||
"\n"
|
||
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
||
"\n"
|
||
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
||
"\n"
|
||
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgctxt "lazarusidestrconsts.lismore"
|
||
msgid "More"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoresub
|
||
msgctxt "lazarusidestrconsts.lismoresub"
|
||
msgid "More"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismove
|
||
msgid "Move"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovedown
|
||
msgid "Move Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovefiles
|
||
msgid "Move Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovefiles2
|
||
msgid "Move files?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
||
#, object-pascal-format
|
||
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveonepositiondown
|
||
#, object-pascal-format
|
||
msgid "Move \"%s\" one position down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveonepositionup
|
||
#, object-pascal-format
|
||
msgid "Move \"%s\" one position up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveorcopyfiles
|
||
msgid "Move or Copy files?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
||
#, object-pascal-format
|
||
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
msgid "Move Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveselecteddown
|
||
msgid "Move selected item down (Ctrl+Down)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveselectedup
|
||
msgid "Move selected item up (Ctrl+Up)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveto
|
||
msgid "Move to: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismoveup
|
||
msgid "Move Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
||
msgid "Moving these units will break their uses sections. See Messages window for details."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismpcstyle
|
||
msgid "C style: \" => \\\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismpescapequotes
|
||
msgid "Escape "es"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismpmultipaste
|
||
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
||
msgid "MultiPaste"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismppascalstyle
|
||
msgid "Pascal style: ' => ''"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismppasteoptions
|
||
msgid "Paste &options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismppreview
|
||
msgid "&Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismptextaftereachline
|
||
msgid "Text &after each line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismptextbeforeeachline
|
||
msgid "Text &before each line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismptrimclipboardcontents
|
||
msgid "&Trim clipboard contents"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismsgcolors
|
||
msgid "Message colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
||
msgid "Multiple directories are separated with semicolons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismultiplepack
|
||
msgid ", multiple packages: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisname
|
||
msgctxt "lazarusidestrconsts.lisname"
|
||
msgid "Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnameofactivebuildmode
|
||
msgid "Name of active build mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgctxt "lazarusidestrconsts.lisnew"
|
||
msgid "New"
|
||
msgstr "جذاذة &جديدة"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
#, object-pascal-format
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
#, object-pascal-format
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
#, object-pascal-format
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
||
msgid "Inherit from a project form or component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "لم يقع تعيين أيّ عنصر"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "عيّن عنصرا أوّلا"
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname
|
||
#, object-pascal-format
|
||
msgid "Macro %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname2
|
||
msgid "New Macroname"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
||
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
||
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewpage
|
||
msgid "New page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
#, fuzzy
|
||
#| msgid "%s - (new project)"
|
||
msgid "(new project)"
|
||
msgstr "%s - مشروع جديد"
|
||
|
||
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
||
msgid "New recorded macros. Not to be saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
msgid "New units are added to uses sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoautosaveactivedesktop
|
||
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnobuildprofilesselected
|
||
msgid "No profiles are selected to be built."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "لم يقع تعيين أيّة أوامر"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnofppkgprefix
|
||
msgid "empty Free Pascal compiler prefix."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnohints
|
||
msgid "no hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr "لم يقع تعيين أية نافذة"
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnomacroselected
|
||
msgid "No macro selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnomessageselected
|
||
msgid "(no message selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoneclicktochooseone
|
||
msgid "none, click to choose one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoneselected
|
||
msgid "(None selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr "لم بقع تقيين أيّة عقدة"
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
msgid "No Pascal file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
#, object-pascal-format
|
||
msgid "No program file \"%s\" found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotadesigntimepackage
|
||
msgid "Not a designtime package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotaninstallpackage
|
||
msgid "Not an install package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotavalidfppkgprefix
|
||
msgid "Free Pascal compiler not found at the given prefix."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnote
|
||
msgctxt "lazarusidestrconsts.lisnote"
|
||
msgid "Note"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposbottom
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
||
msgid "Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposleft
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposright
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
||
msgid "Right"
|
||
msgstr "الأيمن"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabpostop
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
||
msgid "Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotemplateselected
|
||
msgid "no template selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnothingtodo
|
||
msgid "Nothing to do"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
#, object-pascal-format
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotinstalled
|
||
msgid "not installed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotinstalledpackages
|
||
msgid "Not installed packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnowloadedscheme
|
||
msgid "Now loaded: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
#, object-pascal-format
|
||
msgid "Number of files to convert: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
||
msgid "Object Inspector becomes visible when components are selected in designer."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
||
msgid "Switch to Object Inspector Favorites tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisofpackage
|
||
#, object-pascal-format
|
||
msgid " of package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoftheprojectinspector
|
||
msgid " of the Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
||
msgid "Add to favorite properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
||
#, object-pascal-format
|
||
msgid "Choose a base class for the favorite property \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
#, object-pascal-format
|
||
msgid "Class \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
||
msgid "Remove from favorite properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
#, object-pascal-format
|
||
msgid "%sDescription: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
#, object-pascal-format
|
||
msgid "Filename: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoiplicenselicense
|
||
#, object-pascal-format
|
||
msgid "%sLicense: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
msgid "Open Loaded Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgctxt "lazarusidestrconsts.lisoipstate"
|
||
msgid "State"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
#, object-pascal-format, fuzzy
|
||
#| msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgid "%sThis package is installed but the lpk file was not found"
|
||
msgstr "%sهذا ال"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
||
msgid "On break line (i.e. return or enter key)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlinepackage
|
||
msgid "available in the main repository"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonly32bit
|
||
msgid "only 32bit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
||
msgid "Only available on Windows. Run the tool hidden."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
||
msgid "Only available on Windows. Run tool in a new console."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
||
msgid "Only messages fitting this regular expression:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
||
msgid "Only messages with these FPC IDs (comma separated):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
||
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonpastefromclipboard
|
||
msgid "On paste from clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopen
|
||
msgctxt "lazarusidestrconsts.lisopen"
|
||
msgid "Open"
|
||
msgstr "إفتح"
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunit
|
||
msgid "Open designer on open unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
||
msgid "Form is loaded in designer always when source unit is opened."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
msgctxt "lazarusidestrconsts.lisopenfile"
|
||
msgid "Open File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
msgctxt "lazarusidestrconsts.lisopenfile2"
|
||
msgid "Open file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopeninfileman
|
||
msgid "Open in file manager"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopeninfilemanhint
|
||
msgid "Open destination directory in file manager"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
#, object-pascal-format
|
||
msgid "Open %s"
|
||
msgstr "إفتح %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
#, object-pascal-format
|
||
msgid "Open package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenpackage3
|
||
msgid "Open Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "إفتح المشروع؟"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "إفتح جذاذة المشروع"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
#, object-pascal-format
|
||
msgid "Open the package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
#, object-pascal-format
|
||
msgid "Open the project %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopentooloptions
|
||
msgid "Open Tool Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenunit
|
||
msgid "Open Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenurl
|
||
msgid "Open URL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenxml
|
||
msgid "Open XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoptions
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.lisoptions"
|
||
msgid "Options"
|
||
msgstr "خيارات"
|
||
|
||
#: lazarusidestrconsts.lisoptionvalueignored
|
||
msgid "ignored"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisos
|
||
#, object-pascal-format
|
||
msgid ", OS: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
||
#, object-pascal-format
|
||
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
||
#, object-pascal-format
|
||
msgid "output directory of %s contains Pascal unit source \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoutputfilenameofproject
|
||
msgid "Output filename of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
|
||
msgid "Override function result string types with the first parameter expression type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
#, object-pascal-format
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
||
#, object-pascal-format
|
||
msgid "%soverride the project or IDE build mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
#, object-pascal-format
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
#, object-pascal-format
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
#, object-pascal-format
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
||
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
#, object-pascal-format
|
||
msgid "package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackage3
|
||
#, object-pascal-format
|
||
msgid ", package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
msgid "Package info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
|
||
#, object-pascal-format
|
||
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
||
msgid "Package needs an output directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageoption
|
||
#, object-pascal-format
|
||
msgid "Package \"%s\" Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageoutputdirectories
|
||
msgid "Package output directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagesourcedirectories
|
||
msgid "Package source directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
||
#, object-pascal-format
|
||
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispage
|
||
msgctxt "lazarusidestrconsts.lispage"
|
||
msgid "Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispagename
|
||
msgid "Page name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispagenamealreadyexists
|
||
#, object-pascal-format
|
||
msgid "Page name \"%s\" already exists. Not added."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispanic
|
||
msgctxt "lazarusidestrconsts.lispanic"
|
||
msgid "Panic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisparsed
|
||
msgid ", parsed "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisparser
|
||
#, object-pascal-format
|
||
msgid "parser \"%s\": %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisparsers
|
||
msgid "Parsers:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
|
||
#, object-pascal-format
|
||
msgid "passing compiler define \"%s\" twice with different values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
|
||
#, object-pascal-format
|
||
msgid "passing compiler option -%s twice with different values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispastefromclipboard
|
||
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
||
msgid "Paste from clipboard."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispastelcolors
|
||
msgid "Pastel Colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "إعرض"
|
||
|
||
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
||
msgid "Delete Invalid Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
msgid "Move path down (Ctrl+Down)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
msgid "Move path up (Ctrl+Up)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditoraddhint
|
||
msgid "Add new path to the list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditordeletehint
|
||
msgid "Delete the selected path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
||
msgid "Remove non-existent (gray) paths from the list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditorreplacehint
|
||
msgid "Replace the selected path with a new path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditortempladdhint
|
||
msgid "Add template to the list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispathisnodirectory
|
||
msgid "is not a directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
||
msgid "path of the instantfpc cache"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispathofthemakeutility
|
||
msgid "Path of the make utility"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
msgid "Path to failed Instance:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispause
|
||
msgctxt "lazarusidestrconsts.lispause"
|
||
msgid "Pause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckcleartousethepackagename
|
||
msgid "Clear to use the package name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckdisablei18noflfm
|
||
msgid "Disable I18N of lfm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
||
msgid "Add Files from File System"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditavailableonline
|
||
msgid "(available online)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
#, object-pascal-format
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
|
||
msgid "Check availability online"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
||
msgid "Clean up dependencies ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
||
msgid "Clear default/preferred filename of dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcommonoptions
|
||
msgid "Common"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
#, object-pascal-format
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
||
msgid "Create fpmake.pp"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditdefault
|
||
#, object-pascal-format
|
||
msgid "%s, default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
#, fuzzy
|
||
#| msgid "Edit General Options"
|
||
msgid "Edit general options"
|
||
msgstr "غير الخيارات العامة"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditfpmakepackage
|
||
msgid "(fpmake)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
#, object-pascal-format
|
||
msgid "Modified: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
#, object-pascal-format
|
||
msgid "Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
#, object-pascal-format
|
||
msgid "Package \"%s\" has changed.%sSave package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
#, object-pascal-format
|
||
msgid "package %s not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
#, object-pascal-format
|
||
msgid "%s, Page: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
#, object-pascal-format
|
||
msgid "Read Only: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
msgid "Recompile All Required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
msgid "Recompile Clean"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
#, object-pascal-format
|
||
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfiles
|
||
msgid "Removed Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
#, object-pascal-format
|
||
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "إمح العناصر المعيّنة"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
msgid "Save Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
||
msgid "Store file name as default for this dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
||
msgid "Store file name as preferred for this dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
#, object-pascal-format
|
||
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
#, object-pascal-format
|
||
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackagesource
|
||
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
||
msgid "View Package Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexplbase
|
||
msgid "Base, cannot be uninstalled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
||
msgid "Installed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
#, object-pascal-format
|
||
msgid "%sState: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start (unless needed by an installed package)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallpackage
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
||
msgid "Uninstall package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
msgid "Author"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
msgid "Description / Abstract"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntime
|
||
msgid "Designtime"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and runtime"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
msgid "License"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
msgid "Package type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntime
|
||
msgid "Runtime"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
msgid "Update / Rebuild"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckpackage
|
||
msgid "Package:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
||
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckshowunneededdependencies
|
||
msgid "Show unneeded dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
||
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "أجهض"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispecollapsedirectory
|
||
msgid "Collapse directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeexpanddirectory
|
||
msgid "Expand directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispemissingfilesofpackage
|
||
#, object-pascal-format
|
||
msgid "Missing files of package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
||
msgid "New file not in include path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
||
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
||
msgid "No files missing. All files exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisperemovefiles
|
||
msgid "Remove files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisperevertpackage
|
||
msgid "Revert Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispesavepackageas
|
||
msgid "Save Package As ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
||
msgid "Show directory hierarchy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeshowmissingfiles
|
||
msgid "Show Missing Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
msgid "Sort Files Permanently"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispesortfilesalphabetically
|
||
msgid "Sort files alphabetically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
||
msgid "Use all units in directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeusenounitsindirectory
|
||
msgid "Use no units in directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
||
msgid "Clean up package dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgclearselection
|
||
msgid "Clear Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefsnamespaces
|
||
msgid "Namespaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdeletedependencies
|
||
msgid "Delete dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
#, object-pascal-format
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
||
msgid "More functions for the package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
||
msgid "Binary"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypemainunit
|
||
msgid "Main Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "نصّ"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
||
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
||
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
||
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
||
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
||
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
||
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
#, object-pascal-format
|
||
msgid "%sAdding new Dependency for package %s: package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
#, object-pascal-format
|
||
msgid "%sAdding new Dependency for project %s: package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
||
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
#, object-pascal-format
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
||
msgid "Circular dependencies found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangcompilepackage
|
||
#, object-pascal-format
|
||
msgid "Compile package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
#, object-pascal-format
|
||
msgid "Delete old package file \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
#, object-pascal-format
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
||
msgid "File \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
#, object-pascal-format
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
#, object-pascal-format
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
#, object-pascal-format
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
#, object-pascal-format
|
||
msgid "Package: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is not a designtime package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
||
msgid "Please compile the package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
#, object-pascal-format
|
||
msgid "Project: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
#, object-pascal-format
|
||
msgid "Replace existing file \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
||
msgid "One or more required packages were not found. See package graph for details."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
||
#, object-pascal-format
|
||
msgid ""
|
||
"The package %s is already open in the IDE.\n"
|
||
"You cannot save a package with the same name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
msgid "Save package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
#, object-pascal-format
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
#, object-pascal-format
|
||
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file \"%s\"%sis already in the package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is not a Lazarus package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
#, object-pascal-format
|
||
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
#, object-pascal-format
|
||
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
#, object-pascal-format
|
||
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" of package %s was not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
#, object-pascal-format
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
#, object-pascal-format
|
||
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
#, object-pascal-format
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
#, object-pascal-format
|
||
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
#, object-pascal-format
|
||
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
#, object-pascal-format
|
||
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
#, object-pascal-format
|
||
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
#, object-pascal-format
|
||
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
||
msgid "There is a circular dependency in the packages. See package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
#, object-pascal-format
|
||
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
#, object-pascal-format
|
||
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
#, object-pascal-format
|
||
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
#, object-pascal-format
|
||
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
#, object-pascal-format
|
||
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
#, object-pascal-format
|
||
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
#, object-pascal-format
|
||
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
#, object-pascal-format
|
||
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
#, object-pascal-format
|
||
msgid "Unable to delete file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
#, object-pascal-format
|
||
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
#, object-pascal-format
|
||
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
#, object-pascal-format
|
||
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
#, object-pascal-format
|
||
msgid "Uninstall package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
#, object-pascal-format
|
||
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmgrkeep
|
||
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
||
msgid "keep"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmgrnew
|
||
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
||
msgid "new"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmgrremove
|
||
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
||
msgid "remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgselectapackage
|
||
msgid "Select a package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Cannot register components without unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
#, object-pascal-format
|
||
msgid "Component Class \"%s\" already defined"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
#, object-pascal-format
|
||
msgid "%s%sFile Name: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
#, object-pascal-format
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyslpkfilename
|
||
#, object-pascal-format
|
||
msgid "%s%slpk file: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
||
msgid "Package registration error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called but no package is registering."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
||
#, object-pascal-format
|
||
msgid "%s%sThe lpk file was not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
#, object-pascal-format
|
||
msgid "%s%sUnit Name: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
||
#, object-pascal-format
|
||
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
||
msgid "Unit \"%s\" was removed from package (lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
||
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
||
#, object-pascal-format
|
||
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to read package file \"%s\".%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplay
|
||
msgid "Play"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgctxt "lazarusidestrconsts.lispldglobal"
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldonline
|
||
msgid "Online"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
|
||
msgid "Online packages cannot be deleted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinksin
|
||
msgid "Show global links in "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldshowonlinelinks
|
||
msgid "Show online links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinksin
|
||
msgid "Show user links in "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
|
||
msgid "Some packages cannot be deleted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
||
msgid "Please fix the error shown in the message window which is normally below the source editor."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
|
||
msgid "Please select at least one build mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgctxt "lazarusidestrconsts.lisplistall"
|
||
msgid "<All>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplistprocedurelist
|
||
msgid "Procedure List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "النّوع"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in .lps file in IDE config directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
||
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposition
|
||
msgid "Position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispositionoutsideofsource
|
||
#, object-pascal-format
|
||
msgid "%s (position outside of source)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisppuinwrongdirectory
|
||
#, object-pascal-format
|
||
msgid "ppu in wrong directory=%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
||
#, object-pascal-format
|
||
msgid "%s.ppu not found. Check your fpc.cfg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory where Lazarus stores its config files. Default is "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigpath
|
||
msgid "Primary config path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprior
|
||
#, object-pascal-format
|
||
msgid "prior %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispriority
|
||
msgctxt "lazarusidestrconsts.lispriority"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
#, object-pascal-format
|
||
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
||
msgid "A Free Pascal command line program with some useful settings added."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
msgid "Add Editor Files"
|
||
msgstr "أضف الجذاذات المفتوحة في المحرّر"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddlocalpkg
|
||
#, object-pascal-format
|
||
msgid "Local (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
|
||
msgid "New FPMake Requirement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddonlinepkg
|
||
#, object-pascal-format
|
||
msgid "Online (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagetype
|
||
msgid "Package Type:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
#, object-pascal-format
|
||
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
#, object-pascal-format
|
||
msgid "The project has already a dependency for the package \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
#, object-pascal-format
|
||
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
#, object-pascal-format
|
||
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproject
|
||
#, object-pascal-format
|
||
msgid "Project %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproject2
|
||
msgid "Project: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproject3
|
||
msgid "project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectchangedondisk
|
||
msgid "Project changed on disk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
||
msgid "Title in taskbar shows also directory path of the project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectinspectorshowprops
|
||
msgid "Show properties pane in Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnablehint
|
||
msgid "Generates a binary executable which can be run."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectmacro
|
||
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
||
msgid "Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectnamespaces
|
||
msgid "Project Namespaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectoption
|
||
msgid "Project Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectoutputdirectory
|
||
msgid "Project output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectpathhint
|
||
msgid "Directory where project's main file must be"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsession
|
||
msgid "Project Session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsessionchanged
|
||
msgid "Project session changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsourcedirectories
|
||
msgid "Project source directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
||
#, object-pascal-format
|
||
msgid "%0:s%0:s At address %1:x"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
||
#, object-pascal-format
|
||
msgid "Project %s raised exception class '%s'."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
||
#, object-pascal-format
|
||
msgid "Project %s raised exception class '%s' with message:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
||
#, object-pascal-format
|
||
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
||
#, object-pascal-format
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
||
#, object-pascal-format
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
#, object-pascal-format
|
||
msgid "Delete dependency for %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
#, object-pascal-format
|
||
msgid "Project Inspector - %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
#, object-pascal-format
|
||
msgid "Remove file %s from project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
||
#, object-pascal-format
|
||
msgid "Remove %s items from project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
#, object-pascal-format
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
#, object-pascal-format
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
||
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
#, object-pascal-format
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproperties
|
||
msgid "Properties (replace or remove)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproperty
|
||
#, object-pascal-format
|
||
msgid "%s property"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublishedto
|
||
#, object-pascal-format
|
||
msgid "Published to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublishmodulenote
|
||
msgid "Files belonging to project / package will be included automatically."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublishproject
|
||
msgid "Publish Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
||
msgid "The resource will be available for FPC."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A Pascal unit must have the extension .pp or .pas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid Pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
msgid "Convert &Delphi Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
msgid "&New Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
msgid "&Open Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
#, fuzzy
|
||
#| msgid "Open Recent Project"
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open &Recent Project"
|
||
msgstr "إفتح ملفا أستعمل حديثا"
|
||
|
||
#: lazarusidestrconsts.lispwviewexampleprojects
|
||
msgid "View &Example Projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
|
||
msgid "Quick check Fppkg configuration at start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquickfixerror
|
||
msgid "QuickFix error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquickfixes
|
||
msgid "Quick fixes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
||
msgid "Search identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquit
|
||
msgctxt "lazarusidestrconsts.lisquit"
|
||
msgid "Quit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
#, fuzzy
|
||
#| msgid "Quit Lazarus"
|
||
msgid "&Quit Lazarus"
|
||
msgstr "خروج من لازاروس"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreallydelete
|
||
msgid "Really delete?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrecenttabs
|
||
msgid "Recent tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrecord
|
||
msgctxt "lazarusidestrconsts.lisrecord"
|
||
msgid "Record"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrecordedmacros
|
||
msgid "Recorded"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisredo
|
||
msgctxt "lazarusidestrconsts.lisredo"
|
||
msgid "Redo"
|
||
msgstr "كرر"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrelative
|
||
msgid "Relative"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
msgctxt "lazarusidestrconsts.lisremove"
|
||
msgid "Remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremove2
|
||
msgid "Remove?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
||
msgid "Remove all message type filters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
||
msgid "Remove Compiler Option Hide Message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
||
#, object-pascal-format
|
||
msgid "Remove %s dependencies from package \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovedpropertys
|
||
#, object-pascal-format
|
||
msgid "Removed property \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovefilesfrompackage
|
||
#, object-pascal-format
|
||
msgid "Remove %s files from package \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
msgid "Remove from Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveincludepath
|
||
msgid "Remove include path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable3
|
||
#, object-pascal-format
|
||
msgid "Remove local variable \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovemessagetypefilter
|
||
msgid "Remove Message Type Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovenonexistingfiles
|
||
msgid "Remove nonexistent files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr "إمح الوحدات المعيّنة"
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
||
msgid "Remove the paths from \"Other sources\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveunitpath
|
||
msgid "Remove unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveuses
|
||
#, object-pascal-format
|
||
msgid "Remove uses \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrename
|
||
msgctxt "lazarusidestrconsts.lisrename"
|
||
msgid "Rename"
|
||
msgstr "أبدل الإسم"
|
||
|
||
#: lazarusidestrconsts.lisrename2
|
||
msgid "Rename ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenameshowresult
|
||
msgid "Show list of renamed Identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenameto
|
||
#, object-pascal-format
|
||
msgid "Rename to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreopenproject
|
||
msgid "Reopen project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrepeat
|
||
msgctxt "lazarusidestrconsts.lisrepeat"
|
||
msgid "Repeat"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplace
|
||
msgctxt "lazarusidestrconsts.lisreplace"
|
||
msgid "Replace"
|
||
msgstr "إستبدل"
|
||
|
||
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
||
#, object-pascal-format
|
||
msgid "Replaced property \"%s\" with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacedtypeswiths
|
||
#, object-pascal-format
|
||
msgid "Replaced type \"%s\" with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacement
|
||
msgid "Replacement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacementfuncs
|
||
msgid "Replacement functions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacements
|
||
msgid "Replacements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplaceremoveunknown
|
||
msgid "Fix unknown properties and types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacewholeidentifier
|
||
msgid "Replace whole identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreset
|
||
msgctxt "lazarusidestrconsts.lisreset"
|
||
msgid "Reset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
||
msgid "Reset all file filters to defaults?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
||
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
||
msgid "Resource name must be unique."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
||
msgid "Resource type of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrestart
|
||
msgctxt "lazarusidestrconsts.lisrestart"
|
||
msgid "Restart"
|
||
msgstr "أعد التّشغيل"
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreturnparameterindexedword
|
||
msgid ""
|
||
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
||
"\n"
|
||
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
||
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
||
"is always the current macro.\n"
|
||
"\n"
|
||
"Example line:\n"
|
||
"i 0 count-1 forb|\n"
|
||
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
||
"\n"
|
||
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid ""
|
||
"Return the list of all values of case variable in front of variable.\n"
|
||
"\n"
|
||
"Optional Parameters (comma separated):\n"
|
||
"WithoutExtraIndent // the case list will be generated without extra indentation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrevision
|
||
msgid "Revision: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "الأيمن"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrun
|
||
msgctxt "lazarusidestrconsts.lisrun"
|
||
msgid "Run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
||
msgid "\"Run and Design time\" packages have no limitations."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunning
|
||
#, object-pascal-format
|
||
msgid "%s (running ...)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
#, object-pascal-format
|
||
msgid "The host application \"%s\" is not executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunstage
|
||
msgctxt "lazarusidestrconsts.lisrunstage"
|
||
msgid "Run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
||
msgid "Runtime only, cannot be installed in IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
||
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
||
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract Methods - not yet overridden"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
#, object-pascal-format
|
||
msgid "Abstract methods of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
#, object-pascal-format
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
#, object-pascal-format
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
msgctxt "lazarusidestrconsts.lissave"
|
||
msgid "Save"
|
||
msgstr "إحفظ"
|
||
|
||
#: lazarusidestrconsts.lissaveall
|
||
msgctxt "lazarusidestrconsts.lissaveall"
|
||
msgid "Save All"
|
||
msgstr "إحفظ الكلّ"
|
||
|
||
#: lazarusidestrconsts.lissaveallchecked
|
||
msgid "Save All Checked"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
msgid "Save all modified files"
|
||
msgstr "إحفظ كلّ الجذاذات المتغيّرة"
|
||
|
||
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
||
msgid "Save All/Original Messages to File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavechangedfiles
|
||
msgid "Save changed files?"
|
||
msgstr "هل تريد حفظ الجذاذات المتغيّرة؟"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "هل تريد حفظ التّغييرات؟"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
#, object-pascal-format
|
||
msgid "Save changes to project %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
msgid "Save current editor file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavedwithidesettings
|
||
msgid "Saved with IDE settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavedwithprojectsession
|
||
msgid "Saved with project session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
#, object-pascal-format
|
||
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavemacroas
|
||
msgid "Save macro as"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavemessages
|
||
msgid "Save messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
#, object-pascal-format
|
||
msgid "Save project %s (*%s)"
|
||
msgstr "إحفظ البرنامج %s (*%s)"
|
||
|
||
#: lazarusidestrconsts.lissavesessionchangestoproject
|
||
#, object-pascal-format
|
||
msgid "Save session changes to project %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesessionfoldstate
|
||
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
||
msgid "Save fold info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
||
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesessionjumphistory
|
||
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
||
msgid "Save jump history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
||
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "إحفظ الخيارات"
|
||
|
||
#: lazarusidestrconsts.lissaveshownmessagestofile
|
||
msgid "Save Shown Messages to File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "إحفظ"
|
||
|
||
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
||
#, object-pascal-format
|
||
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscanfilesinparentdir
|
||
msgid "Scan files in parent directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
||
msgid "Search for source files in sibling directories (parent directory and its children)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscanning
|
||
msgid "Scanning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscanning2
|
||
#, object-pascal-format
|
||
msgid "%s. Scanning ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisscanparentdir
|
||
msgid "Scanning parent directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissearchpaths2
|
||
msgid "Search paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissearchunit
|
||
#, object-pascal-format
|
||
msgid "Search Unit \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory where Lazarus searches for config template files. Default is "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigpath
|
||
msgid "Secondary config path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissecondtest
|
||
msgid "&Second test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
#, object-pascal-format
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "عيّن عقدة"
|
||
|
||
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
||
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselected
|
||
msgctxt "lazarusidestrconsts.lisselected"
|
||
msgid "Selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedaddition
|
||
msgid "Selected addition:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedandchildcontrols
|
||
msgid "Selected and child controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedcommandsmapping
|
||
msgid "Selected Command's Mapping"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedforinstallation
|
||
msgid "selected for installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedforuninstallation
|
||
msgid "selected for uninstallation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
msgid "(selected left neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
||
msgid "Selected message in messages window:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedmodeswerecompiled
|
||
#, object-pascal-format
|
||
msgid "Selected %d modes were successfully compiled."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
msgid "(selected right neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
msgid "(selected top neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectfpcpath
|
||
msgid "Select the path where FPC is installed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
||
msgid "Select FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectframe
|
||
msgid "Select Frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
||
msgid "Select Lazarus source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectpathto
|
||
#, object-pascal-format
|
||
msgid "Select path to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselecttargetdirectory
|
||
msgid "Select target directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissetallcolors
|
||
msgid "Set all colors:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
||
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissetupdefaultindentation
|
||
msgid "(Set up default indentation)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshortnopath
|
||
msgid "Short, no path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
||
#, object-pascal-format
|
||
msgid "Should the component \"%s\" be auto created when the application starts?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowabstractmethodsof
|
||
#, object-pascal-format
|
||
msgid "Show abstract methods of \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
||
msgid "Show component tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowconsole
|
||
msgid "Show console"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowdeclarationhints
|
||
msgid "Show declaration hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
||
msgid "Show differences between modes ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
||
msgid "Show FPC message \"lines compiled\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowglyphsfor
|
||
msgid "Show Glyphs for"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowhelp
|
||
msgid "Show help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
||
msgid "Show hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowmessagetypeid
|
||
msgid "Show Message Type ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowmultiplelines
|
||
msgid "Show multiple lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowonlymodified
|
||
msgid "Show only modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
||
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowoutput
|
||
msgid "Show output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowoverviewgutter
|
||
msgid "Show overview gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||
msgid "Show position of source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
|
||
msgid "Show property filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
||
msgid "Show recently used identifiers at top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowrelativepaths
|
||
msgid "Show relative paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
||
msgid "Shows all controls in tree hierarchy."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
||
msgid "A box at the bottom shows description for the selected property."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
||
msgid "Show setup dialog for most important settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show statusbar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowunitswithinitialization
|
||
msgid "Show units with initialization/finalization sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
||
msgid "These units may initialize global data used by the program/application. Remove with care."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowunusedunits
|
||
msgid "Show unused units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
||
msgid "Show value hints while debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissimpleprogram
|
||
msgid "Simple Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
||
msgid "A most simple Free Pascal command line program."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
msgid "Simple syntax"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskiperrors
|
||
msgid "Skip errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskipfile
|
||
msgid "Skip file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskipstartupchecks
|
||
msgid "Skip selected checks at startup."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskipthesewarnings
|
||
msgid "Skip these warnings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
||
msgid "Slower but more accurate."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "Smaller rather than faster"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissorting
|
||
msgid "Sorting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortorderalphabetic
|
||
msgid "Alphabetic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortorderdefinition
|
||
msgid "Definition (Scoped)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortorderscopedalphabetic
|
||
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
|
||
msgid "Alphabetic (Scoped)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortordertitle
|
||
msgid "Order by"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "خيارات"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "إقبل"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationaresame
|
||
#, object-pascal-format
|
||
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
#, object-pascal-format
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
#, object-pascal-format
|
||
msgid "Source directory \"%s\" does not exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
||
msgid "Source Editor Window Manager"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
#, object-pascal-format
|
||
msgid "Source of page \"%s\" has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
||
#, object-pascal-format
|
||
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstartconversion
|
||
msgid "Start Conversion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstartide
|
||
msgid "Start IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
||
msgid "Statusbar shows the property's name and the class where it is published."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstop
|
||
msgctxt "lazarusidestrconsts.lisstop"
|
||
msgid "Stop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
||
msgid "Store path delimiters \\ and / as"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstrangelpifile
|
||
msgid "Strange lpi file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexported
|
||
#, object-pascal-format
|
||
msgid "Successfully exported to \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
||
#, object-pascal-format
|
||
msgid "Successfully exported %d BuildModes to \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
||
#, object-pascal-format
|
||
msgid "Successfully exported compiler options to \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimported
|
||
#, object-pascal-format
|
||
msgid "Successfully imported from \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
||
#, object-pascal-format
|
||
msgid "Successfully imported %d BuildModes from \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
||
#, object-pascal-format
|
||
msgid "Successfully imported compiler options from \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
||
msgid "Suggest default name of new file in lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuspiciousincludepath
|
||
msgid "Suspicious include path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuspiciousunitpath
|
||
msgid "Suspicious unit path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
#, object-pascal-format, fuzzy, badformat
|
||
#| msgid "%s%s%s is not a valid identifier."
|
||
msgid "\"%s\" is not a valid identifier."
|
||
msgstr "%s%s%sليس مقبولا كإسم "
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisswitchfiltersettings
|
||
msgid "Switch Filter Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
||
msgid "Switch to Favorites tab after asking for component name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
||
msgid "system.ppu not found. Check your fpc.cfg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderconfirmsort
|
||
#, object-pascal-format
|
||
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderdownhint
|
||
msgid "Move the selected control down in tab order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
#, object-pascal-format
|
||
msgid "Tab Order of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderrecursionhint
|
||
msgid "Calculate tab order recursively for child controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderrecursively
|
||
msgid "recursively"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listabordersorthint
|
||
msgid "Calculate tab order for controls by their X- and Y- positions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderuphint
|
||
msgid "Move the selected control up in tab order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listabsfor
|
||
#, object-pascal-format
|
||
msgid "Tabs for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listarget
|
||
msgid "Target:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listarget2
|
||
#, object-pascal-format
|
||
msgid ", Target: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
||
msgid "Target file name: (-o, empty = use unit output directory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetfilenameo
|
||
msgid "Target file name (-o):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetisreadonly
|
||
msgid "Target is read only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
#, object-pascal-format
|
||
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listemplatefile
|
||
msgid "Template file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listesturl
|
||
msgid "Test URL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
||
#, object-pascal-format
|
||
msgid "The Application Bundle was created for \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
#, object-pascal-format
|
||
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
#, object-pascal-format
|
||
msgid "The Codetools found an error:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
||
#, object-pascal-format
|
||
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
#, object-pascal-format
|
||
msgid "The component %s can not be deleted because it is not owned by %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
#, object-pascal-format
|
||
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
#, object-pascal-format
|
||
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
#, object-pascal-format
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
||
#, object-pascal-format
|
||
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
||
msgid "The configuration will be downgraded/converted."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
||
#, object-pascal-format
|
||
msgid "The %s contains a nonexistent directory:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
||
#, object-pascal-format
|
||
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
||
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
#, object-pascal-format
|
||
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
||
msgid "The default mode must be stored in project, not in session."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
#, object-pascal-format
|
||
msgid "The destination directory%s\"%s\" does not exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
||
#, object-pascal-format
|
||
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
||
#, object-pascal-format
|
||
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
#, object-pascal-format
|
||
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
||
#, object-pascal-format
|
||
msgid "The directory \"%s\" is not writable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
||
#, object-pascal-format
|
||
msgid "The file %s does not look like a lpi file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
||
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisinvalid
|
||
#, object-pascal-format
|
||
msgid "The file mask \"%s\" is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
||
#, object-pascal-format
|
||
msgid "The file mask \"%s\" is not a valid regular expression."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
#, object-pascal-format
|
||
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
#, object-pascal-format
|
||
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
#, object-pascal-format
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
||
#, object-pascal-format
|
||
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
||
#, object-pascal-format
|
||
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheideisstillbuilding
|
||
msgid "The IDE is still building."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
#, object-pascal-format
|
||
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
#, object-pascal-format
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
#, object-pascal-format
|
||
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
||
#, object-pascal-format
|
||
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
||
#, object-pascal-format
|
||
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelazarussourcesuse
|
||
#, object-pascal-format
|
||
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
||
#, object-pascal-format
|
||
msgid "The macro \"%s\" does not begin with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
||
#, object-pascal-format
|
||
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
||
#, object-pascal-format
|
||
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
#, object-pascal-format
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
||
msgid "The old configuration will be upgraded."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
||
#, object-pascal-format
|
||
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
#, object-pascal-format
|
||
msgid "The output directory \"%s\" is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
#, object-pascal-format
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
#, object-pascal-format
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
#, object-pascal-format
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
#, object-pascal-format
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheownerclasshasthisname
|
||
msgid "The owner class has this name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheownerhasthisname
|
||
msgid "The owner has this name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
||
#, object-pascal-format
|
||
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
||
#, object-pascal-format
|
||
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
||
#, object-pascal-format
|
||
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
||
#, object-pascal-format
|
||
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
||
#, object-pascal-format
|
||
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
||
#, object-pascal-format
|
||
msgid "The package %s is already in the list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
||
#, object-pascal-format
|
||
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackageisusedby
|
||
#, object-pascal-format
|
||
msgid "The package \"%s\" is used by"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
||
#, object-pascal-format
|
||
msgid "The path of \"make\" is not correct: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
#, object-pascal-format
|
||
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
||
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
|
||
msgid "Running your application with debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
|
||
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
|
||
msgid "Run with no debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
|
||
#, object-pascal-format
|
||
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
|
||
msgid "Choose Debug Information format"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
#, object-pascal-format
|
||
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
|
||
#, object-pascal-format
|
||
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
||
msgid "The project has no main source file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
#, object-pascal-format
|
||
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
||
#, object-pascal-format
|
||
msgid "The project information file \"%s\"%shas changed on disk."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
#, object-pascal-format
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
||
msgid "The project uses FPC resources which require at least FPC 2.4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
#, object-pascal-format
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
||
#, object-pascal-format
|
||
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
|
||
#, object-pascal-format
|
||
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
||
#, object-pascal-format
|
||
msgid "%sThere are additional notes for this message on%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listherearenoconflictingkeys
|
||
msgid "There are no conflicting keys."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
#, object-pascal-format
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
#, object-pascal-format
|
||
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
||
msgid "There is already a build mode with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
||
#, object-pascal-format
|
||
msgid "There is already a component class with the name %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
||
msgid "There is already a component with this name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyafilein
|
||
#, object-pascal-format
|
||
msgid "There is already a file%s%s%sin %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
||
#, object-pascal-format
|
||
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
#, object-pascal-format
|
||
msgid "There is already a form with the name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
||
#, object-pascal-format
|
||
msgid "There is already a macro with the name \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
||
#, object-pascal-format
|
||
msgid "There is already an IDE macro with the name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
||
#, object-pascal-format
|
||
msgid "There is already a package %s in the list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
||
#, object-pascal-format
|
||
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
#, object-pascal-format
|
||
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
#, object-pascal-format
|
||
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
||
#, object-pascal-format
|
||
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
|
||
#, object-pascal-format
|
||
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
||
msgid "There must be at least one build mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
#, object-pascal-format
|
||
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
#, object-pascal-format
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
#, object-pascal-format
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
#, object-pascal-format
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
msgid "The root component cannot be deleted."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhesefileswillbedeleted
|
||
msgid "These files will be deleted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
||
msgid "These settings are stored with the project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheseunitswerenotfound
|
||
msgid "These units were not found:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
||
#, object-pascal-format
|
||
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhetargetdirectoryisafile
|
||
#, object-pascal-format
|
||
msgid "The target directory is a file:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhetargetfilenameisadirectory
|
||
msgid "The target file name is a directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhetargetisnotwritable
|
||
#, object-pascal-format
|
||
msgid "The target %s is not writable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
||
#, object-pascal-format
|
||
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexists
|
||
#, object-pascal-format
|
||
msgid "The unit \"%s\" already exists."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitbelongstopackage
|
||
#, object-pascal-format
|
||
msgid "The unit belongs to package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
#, object-pascal-format
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunithasthisname
|
||
msgid "The unit has this name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
#, object-pascal-format
|
||
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
||
#, object-pascal-format
|
||
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
#, object-pascal-format
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
#, object-pascal-format
|
||
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
#, object-pascal-format
|
||
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
#, object-pascal-format
|
||
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
||
#, object-pascal-format
|
||
msgid "This component already contains a class with the name %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
||
msgid "This is a test project for a design time package, testing it outside the IDE."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
#, object-pascal-format
|
||
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
||
msgid "This project has no main source file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
||
msgid "This project has only the default build mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
||
#, object-pascal-format
|
||
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
#, object-pascal-format
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
||
msgid "This will allow changing all build modes at once. Not implemented yet."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
||
msgid "This will create a circular dependency."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
||
#, object-pascal-format
|
||
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
||
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolbarconfiguration
|
||
msgid "Toolbar Configuration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolhasnoexecutable
|
||
#, object-pascal-format
|
||
msgid "tool \"%s\" has no executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolheaderfailed
|
||
msgid "Tool Header: Failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolheaderrunning
|
||
msgid "Tool Header: Running"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolheaderscrolledup
|
||
msgid "Tool Header: Scrolled up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolheadersuccess
|
||
msgid "Tool Header: Success"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
||
#, object-pascal-format
|
||
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
|
||
#, object-pascal-format
|
||
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listop
|
||
msgctxt "lazarusidestrconsts.listop"
|
||
msgid "Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopinfoview
|
||
msgid "Show Class/Procedure hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listotalpages
|
||
#, object-pascal-format
|
||
msgid "Total Pages: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listranslatetheenglishmessages
|
||
msgid "Translate the English Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listreeneedsrefresh
|
||
msgid "Tree needs refresh"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
||
#, object-pascal-format
|
||
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listypes
|
||
msgid "Types (not removed if no replacement)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudadditionaldirectories
|
||
msgid "Additional directories:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallpackageunits
|
||
msgid "All package units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallsourceeditorunits
|
||
msgid "All source editor units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallunits
|
||
msgid "All units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
||
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudcollapseallnodes
|
||
msgid "Collapse all nodes"
|
||
msgstr "أخف كلّ العقد"
|
||
|
||
#: lazarusidestrconsts.lisudexpandallnodes
|
||
msgid "Expand all nodes"
|
||
msgstr "إعرض كلّ العقد"
|
||
|
||
#: lazarusidestrconsts.lisudfile
|
||
#, object-pascal-format
|
||
msgid "File: %s"
|
||
msgstr "خذاذة: %s"
|
||
|
||
#: lazarusidestrconsts.lisudfilter
|
||
msgid "(Filter)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses
|
||
#, object-pascal-format
|
||
msgid "Implementation Uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses2
|
||
#, object-pascal-format
|
||
msgid "implementation uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses
|
||
#, object-pascal-format
|
||
msgid "Interface Uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses2
|
||
#, object-pascal-format
|
||
msgid "interface uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudprojectsandpackages
|
||
msgid "Projects and packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudscanning
|
||
msgid "Scanning ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudscanningunits
|
||
#, object-pascal-format
|
||
msgid "Scanning: %s units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearch
|
||
msgid "(Search)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
||
msgid "Find next occurrence of this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
||
msgid "Find next unit with this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
||
msgid "Find previous occurrence of this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
||
msgid "Find previous unit with this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudselectedunits
|
||
msgid "Selected units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudshownodesfordirectories
|
||
msgid "Show nodes for directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
||
msgid "Show nodes for project and packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudunits
|
||
msgid "Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudunits2
|
||
#, object-pascal-format
|
||
msgid "Units: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations
|
||
#, object-pascal-format
|
||
msgid "Used by Implementations: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations2
|
||
#, object-pascal-format
|
||
msgid "used by implementations: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces
|
||
#, object-pascal-format
|
||
msgid "Used by Interfaces: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
||
#, object-pascal-format
|
||
msgid "used by interfaces: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
msgid "Goto line:"
|
||
msgstr "إذهب إاى السّطر:"
|
||
|
||
#: lazarusidestrconsts.lisuemodeseparator
|
||
msgid "/"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
#, object-pascal-format
|
||
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
#, object-pascal-format
|
||
msgid "Searching: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
||
msgid "Continue search from the beginning?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
||
msgid "Continue search from the end?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
#, object-pascal-format
|
||
msgid "Search string '%s' not found!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
#, object-pascal-format
|
||
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
#, object-pascal-format
|
||
msgid "%s bytes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "In project:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
#, object-pascal-format
|
||
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
#, object-pascal-format
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
||
#, object-pascal-format
|
||
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
||
#, object-pascal-format
|
||
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
#, object-pascal-format
|
||
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
#, object-pascal-format
|
||
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
#, object-pascal-format
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
||
#, object-pascal-format
|
||
msgid "Unable to change project scaled in source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
||
#, object-pascal-format
|
||
msgid "Unable to change project title in source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
#, object-pascal-format
|
||
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
#, object-pascal-format
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to convert file \"%s\"%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
#, object-pascal-format
|
||
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
||
#, object-pascal-format
|
||
msgid "Unable to convert to encoding \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
#, object-pascal-format
|
||
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
#, object-pascal-format
|
||
msgid "Unable to create directory \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
#, object-pascal-format
|
||
msgid "Unable to create file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
#, object-pascal-format
|
||
msgid "Unable to create file%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
#, object-pascal-format
|
||
msgid "Unable to create link \"%s\" with target \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
||
msgid "Unable to create new file because there is already a directory with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
||
msgid "Unable to create new method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
#, object-pascal-format
|
||
msgid "Unable to delete ambiguous file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoexecute
|
||
#, object-pascal-format
|
||
msgid "unable to execute: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
#, object-pascal-format
|
||
msgid "Unable to find a valid classname in \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
#, object-pascal-format
|
||
msgid "Unable to find file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
#, object-pascal-format
|
||
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
#, object-pascal-format
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethod
|
||
msgid "Unable to find method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
#, object-pascal-format
|
||
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
||
#, object-pascal-format
|
||
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile2
|
||
#, object-pascal-format
|
||
msgid "unable to load file %s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
#, object-pascal-format
|
||
msgid "Unable to load package \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
#, object-pascal-format
|
||
msgid "Unable to load the component class \"%s\" because it depends on itself."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopen
|
||
#, object-pascal-format
|
||
msgid "Unable to open \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
#, object-pascal-format
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
#, object-pascal-format
|
||
msgid "Unable to read %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
#, object-pascal-format
|
||
msgid "Unable to read file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to read file \"%s\"%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadlpi
|
||
msgid "Unable to read lpi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
||
msgid "unable to read process ExitStatus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
||
#, object-pascal-format
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
||
msgid "Unable to read the project info file%s\"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
#, object-pascal-format
|
||
msgid "Unable to remove old backup file \"%s\"!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
||
#, object-pascal-format
|
||
msgid "Unable to remove project scaled from source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
||
#, object-pascal-format
|
||
msgid "Unable to remove project title from source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
#, object-pascal-format
|
||
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
#, object-pascal-format
|
||
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
#, object-pascal-format
|
||
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorun2
|
||
#, object-pascal-format
|
||
msgid "Unable to run \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethod
|
||
msgid "Unable to show method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
#, object-pascal-format
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
#, object-pascal-format
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
#, object-pascal-format
|
||
msgid "Unable to write \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile2
|
||
#, object-pascal-format
|
||
msgid "Unable to write file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write file \"%s\"%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile2
|
||
#, object-pascal-format
|
||
msgid "Unable to write to file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
#, object-pascal-format
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuncheckall
|
||
msgid "Uncheck All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisundo
|
||
msgctxt "lazarusidestrconsts.lisundo"
|
||
msgid "Undo"
|
||
msgstr "تراجع"
|
||
|
||
#: lazarusidestrconsts.lisuninstall
|
||
#, object-pascal-format
|
||
msgid "Uninstall %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuninstallfail
|
||
msgid "Uninstall failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuninstallimpossible
|
||
msgid "Uninstall impossible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuninstallthemtoo
|
||
msgid "Uninstall them too"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunit
|
||
msgctxt "lazarusidestrconsts.lisunit"
|
||
msgid "Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
#, object-pascal-format, fuzzy, badformat
|
||
#| msgid "Unit %s%s%s has changed. Save?"
|
||
msgid "Unit \"%s\" has changed. Save?"
|
||
msgstr "الوحدة %s%s%s تغيّرت هل تريد حفظها؟"
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
#, object-pascal-format
|
||
msgid "%s unit %s in package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
|
||
#, object-pascal-format
|
||
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnotfound
|
||
#, object-pascal-format
|
||
msgid "unit %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
||
#, object-pascal-format
|
||
msgid "unit %s not found at new position \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundinfile
|
||
#, object-pascal-format
|
||
msgid "A unit not found in file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitrequirespackage
|
||
#, object-pascal-format
|
||
msgid "unit %s requires package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfoundinfile
|
||
#, object-pascal-format
|
||
msgid "Units not found in file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunusedunitsof
|
||
#, object-pascal-format
|
||
msgid "Unused units of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
||
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
|
||
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisup
|
||
msgctxt "lazarusidestrconsts.lisup"
|
||
msgid "Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateapplicationcreateform
|
||
msgid "Update Application.CreateForm statements in main unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
|
||
msgid "Update Application.Scaled statement in main unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
|
||
msgid "Update Application.Title statement in main unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateinfo
|
||
msgid "Update info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
||
msgid "Update other procedure signatures when only letter case has changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
||
#, object-pascal-format
|
||
msgid "Updating PO files failed for package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupgrade
|
||
msgid "Upgrade"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupgradeconfiguration
|
||
msgid "Upgrade configuration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
||
#, object-pascal-format
|
||
msgid "URL on wiki (the base url is %s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuse
|
||
msgid "Use"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseansistrings
|
||
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
||
msgid "Use Ansistrings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
||
msgid "Use CheckBox for Boolean values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
||
msgid "Use comments in custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusedby
|
||
#, object-pascal-format
|
||
msgid " used by %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusedesigntimepackages
|
||
msgid "Use design time packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusedforautocreatedforms
|
||
msgid "Used for auto-created forms."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusefilterforextrafiles
|
||
msgid "Use filter to include extra files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
#, object-pascal-format
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
#, object-pascal-format
|
||
msgid "Use package %s in package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
#, object-pascal-format
|
||
msgid "Use package %s in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
||
#, object-pascal-format
|
||
msgid "Add to list \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
||
msgid "User defined text markup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
||
#, object-pascal-format
|
||
msgid "Remove from list \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
||
#, object-pascal-format
|
||
msgid "Toggle on list \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseunit
|
||
msgctxt "lazarusidestrconsts.lisuseunit"
|
||
msgid "Add Unit to Uses Section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
#, object-pascal-format
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
msgctxt "lazarusidestrconsts.lisvalue"
|
||
msgid "Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
#, object-pascal-format
|
||
msgid "Value%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalue3
|
||
msgid "Value: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
||
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvariable
|
||
msgctxt "lazarusidestrconsts.lisvariable"
|
||
msgid "Variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisverbose
|
||
msgctxt "lazarusidestrconsts.lisverbose"
|
||
msgid "Verbose"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisversionmismatch
|
||
msgid "Version mismatch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisveryverbose
|
||
msgid "Very Verbose"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswarning
|
||
msgid "Warning: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswarnings
|
||
#, object-pascal-format
|
||
msgid ", Warnings: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
||
#, object-pascal-format
|
||
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswelcometolazaruside
|
||
#, object-pascal-format
|
||
msgid "Welcome to Lazarus IDE %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
||
#, object-pascal-format
|
||
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhatneedsbuilding
|
||
msgid "What needs building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
msgid "When a unit is renamed, update references"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
||
msgid "When enabled the current options are saved to the template which is used when creating new projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
||
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
||
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
||
msgid "Window menu shows designed form's name instead of caption"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
||
msgid "Useful especially if the caption is left empty."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswindowstaysontop
|
||
msgid "Window stays on top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithincludes2
|
||
msgid ", with includes "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
||
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
||
msgid "Without a proper debugger, debugging will be disappointing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
||
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
||
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
||
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
#, object-pascal-format
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswritepackageinfofailed
|
||
msgid "Writing the package info file failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswriteprojectinfofailed
|
||
msgid "Writing the project info file failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswrongversionin
|
||
#, object-pascal-format
|
||
msgid "wrong version in %s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
#, object-pascal-format
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
||
msgid "You can disable this for individual forms via the package editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
||
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
||
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You cannot build Lazarus while debugging or compiling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
|
||
msgid "You cannot change the build mode while compiling."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
||
msgid "You can select items by simply pressing underscored letters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lis_all_
|
||
msgctxt "lazarusidestrconsts.lis_all_"
|
||
msgid "<All>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "محرّر الأوامر"
|
||
|
||
#: lazarusidestrconsts.lrsplddeleteselected
|
||
msgid "Delete selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrspldinvalid
|
||
msgid "invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
||
#, object-pascal-format
|
||
msgid "lpk file invalid (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfilevalid
|
||
#, object-pascal-format
|
||
msgid "lpk file valid (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrspldunabletodeletefile
|
||
#, object-pascal-format
|
||
msgid "Unable to delete file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrspldvalid
|
||
msgid "valid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lrsrescanlplfiles
|
||
msgid "Rescan lpl files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
|
||
msgid "Add horizontal spacing between columns"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
|
||
msgid "Add vertical spacing around nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphextraspacing
|
||
msgid "Extra spacing (x/y)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphnamesabovenode
|
||
msgid "Names above node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
|
||
msgid "Absolute limit for height of levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptcrossings
|
||
msgid "Crossings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptedgelen
|
||
msgid "Edge len"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptedges
|
||
msgid "Edges"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptinfo
|
||
msgid "Info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptlevels
|
||
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
|
||
msgid "Levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
|
||
msgid "Limit height of Levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
|
||
#, object-pascal-format
|
||
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphoptsplitpoints
|
||
msgid "Splitpoints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphreducebackedges
|
||
msgid "Reduce backedges"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapecalculatelay
|
||
msgid "Calculate layout from high-edge"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapecurved
|
||
msgid "Curved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapeedgesshape
|
||
msgid "Edges shape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
|
||
msgid "Edges split mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
|
||
msgid "Minimize edges len"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapenodes
|
||
msgid "Nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphshapestraight
|
||
msgid "Straight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
|
||
msgid "Merge at highest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
|
||
msgid "Merge at source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
|
||
msgid "Merge at target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphsplitnone
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
|
||
msgid "None"
|
||
msgstr "لا شيء"
|
||
|
||
#: lazarusidestrconsts.lvlgraphsplitseparate
|
||
msgid "Separate"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lvlgraphstraightengraph
|
||
msgid "Straighten graph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsaddnewterm
|
||
msgid "Add new term"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsattributes
|
||
msgid "Attributes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
||
msgid "Increased every time the project is compiled."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
#, fuzzy
|
||
#| msgid "Build:"
|
||
msgid "&Build:"
|
||
msgstr "بناء:"
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscloseall
|
||
msgid "Close all pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscloseleft
|
||
msgid "Close page(s) on the left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscloseothers
|
||
msgid "Close other page(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscloseright
|
||
msgid "Close page(s) on the right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwithstring
|
||
msgid "Filter the lines in list with a string (Ctrl+F)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found but not listed here: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18nexcluded
|
||
msgid "Excluded"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
|
||
msgid "Force update PO files on next build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18nidentifiers
|
||
msgid "Identifiers:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18noriginals
|
||
msgid "Originals:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfohint
|
||
msgid "Version info is stored if the executable format supports it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
msgid "Include version info in executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
msgid "Automatic (or English)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "صيني"
|
||
|
||
#: lazarusidestrconsts.rslanguagecorsican
|
||
msgid "Corsican"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageczech
|
||
msgid "Czech"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagehungarian
|
||
msgid "Hungarian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguese
|
||
msgid "Portuguese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguesebr
|
||
msgid "Brazilian Portuguese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsmajorversion
|
||
msgid "&Major version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsminorversion
|
||
msgid "Mi&nor version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
|
||
msgid "New search with same criteria (Ctrl+N)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsrefreshthesearch
|
||
msgid "Refresh the search (F5)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresource
|
||
msgid "Resource"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourceclear
|
||
msgid "Delete all resources?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourcefilename
|
||
msgctxt "lazarusidestrconsts.rsresourcefilename"
|
||
msgid "File name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourcetype
|
||
msgctxt "lazarusidestrconsts.rsresourcetype"
|
||
msgid "Type"
|
||
msgstr "النّوع"
|
||
|
||
#: lazarusidestrconsts.rsrevision
|
||
msgid "&Revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsshowabspath
|
||
msgid "Absolute path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsshowfilename
|
||
msgctxt "lazarusidestrconsts.rsshowfilename"
|
||
msgid "File name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsshowpathmode
|
||
msgid "Path display mode (Ctrl+P)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsshowrelpath
|
||
msgid "Relative path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.showoptions
|
||
msgid "Show options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatmacrorecording
|
||
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
||
msgid "Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text bookmark commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatmulticaret
|
||
msgid "Multi caret commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecabstractmethods
|
||
msgid "Abstract Methods ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpaddress
|
||
msgid "add address breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpsource
|
||
msgid "add source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
||
msgid "add data/watchpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
msgid "Add Jump Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecattach
|
||
msgid "Attach to program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
#, fuzzy
|
||
#| msgid "Build lazarus"
|
||
msgid "Build Lazarus"
|
||
msgstr "إبن لازاروس"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildmanymodes
|
||
msgid "build many modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccleanupandbuild
|
||
msgid "clean up and build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecclearallbookmark
|
||
msgid "Clear all Bookmarks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
||
msgid "Clear Bookmarks for current file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccompile
|
||
msgid "compile program/project"
|
||
msgstr "ترجم المشروع"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.srkmeccopy"
|
||
msgid "Copy"
|
||
msgstr "إنسخ"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyadd
|
||
msgid "Copy (Add to Clipboard)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopyaddcurrentline
|
||
msgid "Copy current line (Add to Clipboard)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopycurrentline
|
||
msgid "Copy current line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
||
msgid "Copy editor to new window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
||
msgid "Copy editor to next free window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
||
msgid "Copy editor to prior free window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.srkmeccut"
|
||
msgid "Cut"
|
||
msgstr "قص"
|
||
|
||
#: lazarusidestrconsts.srkmeccutadd
|
||
msgid "Cut (Add to Clipboard)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccutaddcurrentline
|
||
msgid "Cut current line (Add to Clipboard)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccutcurrentline
|
||
msgid "Cut current line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdetach
|
||
msgid "Detach from program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecdown
|
||
msgid "Move cursor down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecduplicateline
|
||
msgid "Duplicate line (or lines in selection)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecduplicateselection
|
||
msgid "Duplicate selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecemptymethods
|
||
msgid "Empty Methods ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
msgid "IDE options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "إستخرج الطّريقة"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
#, object-pascal-format
|
||
msgid "External tool %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
msgid "Find Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
msgid "Find Declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
msgid "Find Identifier References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find in files"
|
||
msgid "Find in Files"
|
||
msgstr "إبحث في الجذاذات"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
#, fuzzy
|
||
#| msgid "Find next"
|
||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||
msgid "Find Next"
|
||
msgstr "إبحث عن التالي"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
msgid "Find Next Word Occurrence"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
msgid "Find Overloads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
||
msgid "Find Overloads ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
#, fuzzy
|
||
#| msgid "Find previous"
|
||
msgid "Find Previous"
|
||
msgstr "إبحث عن السابق"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
msgid "Find Previous Word Occurrence"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
msgid "Find Procedure Definiton"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
msgid "Find Procedure Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
#, object-pascal-format
|
||
msgid "Fold to Level %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
#, object-pascal-format
|
||
msgid "Go to editor %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
msgid "Go to include directive of current include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
msgid "Go to Line Number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
#, object-pascal-format
|
||
msgid "Go to bookmark %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
msgid "Guess Misplaced $IFDEF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordleft
|
||
msgid "Move cursor part-word left (e.g. CamelCase)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordright
|
||
msgid "Move cursor part-word right (e.g. CamelCase)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertfilename
|
||
msgid "Insert Full Filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
||
msgid "Insert GPL notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
||
msgid "Insert LGPL notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmitnotice
|
||
msgid "Insert MIT notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
||
msgid "Insert MIT notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
||
msgid "Insert modified LGPL notice (translated)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeckeymapleft
|
||
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeckeymapright
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
||
msgid "Right"
|
||
msgstr "الأيمن"
|
||
|
||
#: lazarusidestrconsts.srkmecleft
|
||
msgid "Move cursor left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeclockeditor
|
||
msgid "Lock Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
msgid "Make Resource String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
||
msgid "Move editor to new window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
||
msgid "Move editor to next free window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
||
msgid "Move editor to prior free window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmovelinedown
|
||
msgid "Move line down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmovelineup
|
||
msgid "Move line up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveselectdown
|
||
msgid "Move selection down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveselectleft
|
||
msgid "Move selection left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveselectright
|
||
msgid "Move selection right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveselectup
|
||
msgid "Move selection up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmultipaste
|
||
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
||
msgid "MultiPaste"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
||
msgid "Go to next editor in history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnextsharededitor
|
||
msgid "Go to next editor with same Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnextwindow
|
||
msgid "Go to next window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
msgid "Open File at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
#, fuzzy
|
||
msgctxt "lazarusidestrconsts.srkmecpaste"
|
||
msgid "Paste"
|
||
msgstr "ألصق"
|
||
|
||
#: lazarusidestrconsts.srkmecpasteascolumns
|
||
msgid "Paste (as Columns)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
||
msgid "Clear all extra carets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
||
msgid "Cursor keys clear all extra carets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
||
msgid "Cursor keys move all extra carets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
||
msgid "Add extra caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
||
msgid "Toggle extra caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
||
msgid "Remove extra caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
||
msgid "Go to previous editor in history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecprevsharededitor
|
||
msgid "Go to prior editor with same Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecprevwindow
|
||
msgid "Go to prior window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
msgid "remove breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
msgid "Remove Empty Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
msgid "Remove Unused Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
msgid "Replace Text"
|
||
msgstr "بدّل نصّا"
|
||
|
||
#: lazarusidestrconsts.srkmecreportingbug
|
||
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
||
msgid "Reporting a bug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecright
|
||
msgid "Move cursor right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrunwithdebugging
|
||
msgid "run with debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
||
msgid "run without debugging"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "عيّن الكلّ"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordleft
|
||
msgid "Select part-word left (e.g. CamelCase)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordright
|
||
msgid "Select part-word right (e.g. CamelCase)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
msgid "Select Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
||
msgid "Select Line End"
|
||
msgstr "عيّن نهاية السّطر"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "عيّن بداية السّطر"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "عيّن نهاية الصّفحة"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "عيّن بداية الصّفحة"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
msgid "Select Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselsmartwordleft
|
||
msgid "Smart select word left (start/end of word)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselsmartwordright
|
||
msgid "Smart select word right (start/end of word)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselsticky
|
||
msgid "Start sticky selecting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselstickycol
|
||
msgid "Start sticky selecting (Columns)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselstickyline
|
||
msgid "Start sticky selecting (Line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselstickystop
|
||
msgid "Stop sticky selecting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendleft
|
||
msgid "Select word-end left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendright
|
||
msgid "Select word-end right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "عيّن الكلمة الّتي على اليسار"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "عيّن الكلمة الّتي على اليمين"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
#, object-pascal-format
|
||
msgid "Set bookmark %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
msgid "Show Abstract Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
msgid "Show Code Context"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
||
msgid "show execution point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsmartwordleft
|
||
msgid "Smart move cursor left (start/end of word)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsmartwordright
|
||
msgid "Smart move cursor right (start/end of word)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacroplay
|
||
msgid "Play Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacrorecord
|
||
msgid "Record Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
||
msgid "Next Cell (rotate / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
||
msgid "Next Cell (rotate / all selected / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
msgid "Syntax Check"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggleassembler
|
||
msgid "View assembler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
msgid "toggle breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpointenabled
|
||
msgid "enable/disable breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
#, object-pascal-format
|
||
msgid "Toggle bookmark %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectoggleregisters
|
||
msgid "View registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "أظهر محرّر الأوامر"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunusedunits
|
||
msgid "Unused Units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecup
|
||
msgid "Move cursor up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecvieweditormacros
|
||
msgid "View editor macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewhistory
|
||
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
||
msgid "View History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
||
msgid "View console in/output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewtaborder
|
||
msgid "View Tab Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewthreads
|
||
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
||
msgid "View Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
msgid "Word Completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecwordendleft
|
||
msgid "Move cursor word-end left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecwordendright
|
||
msgid "Move cursor word-end right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeczoomin
|
||
msgid "Zoom in"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeczoomout
|
||
msgid "Zoom out"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
||
msgid "Continue with next mouse up action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldcomments
|
||
msgid "Fold comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldcommentsinselection
|
||
msgid "Fold comments in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdef
|
||
msgid "Fold inactive Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
||
msgid "Fold inactive Ifdef (exclude mixed state)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
||
msgid "Fold inactive Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
||
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfhidecomments
|
||
msgid "Hide comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfhidecommentsinselection
|
||
msgid "Hide comments in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
||
msgid "Match action button of mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
||
msgid "Match action line of mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
||
msgid "Match action modifiers of mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
||
msgid "Match action pos of mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
||
msgid "Search all action of mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdef
|
||
msgid "Unfold active Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
||
msgid "Unfold active Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldall
|
||
msgctxt "lazarusidestrconsts.synfunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdef
|
||
msgid "Unfold all Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
||
msgid "Unfold all Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallinselection
|
||
msgid "Unfold all in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldcomments
|
||
msgid "Unfold comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
||
msgid "Unfold comments in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
||
msgid "Unfold inactive Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
||
msgid "Unfold inactive Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uelocked
|
||
msgid "Locked"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemacrorecording
|
||
msgid "Recording"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemacrorecordingpaused
|
||
msgid "Rec-pause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
||
msgid "Add Watch&Point At Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uembookmarknset
|
||
#, object-pascal-format
|
||
msgid "Bookmark &%s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uembookmarknunset
|
||
#, object-pascal-format
|
||
msgid "Bookmark &%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uembookmarknunsetdisabled
|
||
#, object-pascal-format
|
||
msgid "Bookmark %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpagesplain
|
||
msgid "Close All Other Pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpagesright
|
||
msgid "Close Pages on the &Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpagesrightplain
|
||
msgid "Close Pages on the Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "أغلق الصفحة"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
#, fuzzy
|
||
#| msgid "Copy filename"
|
||
msgid "Copy Filename"
|
||
msgstr "إنسخ إسم الجذاذة"
|
||
|
||
#: lazarusidestrconsts.uemcopytonewwindow
|
||
msgid "Clone to New Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindow
|
||
msgid "Clone to Other Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
||
msgid "New Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgctxt "lazarusidestrconsts.uemdebugword"
|
||
msgid "Debug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
msgid "&Evaluate/Modify ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "إبحث عن الإصدار"
|
||
|
||
#: lazarusidestrconsts.uemfindinotherwindow
|
||
msgid "Find in other Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemgotobookmarks
|
||
msgid "Goto Bookmark ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.ueminspect
|
||
msgctxt "lazarusidestrconsts.ueminspect"
|
||
msgid "&Inspect ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemlineending
|
||
msgid "Line Ending"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemlockpage
|
||
msgid "&Lock Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
msgid "Move Page Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
msgid "Move Page Leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
msgid "Move Page Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
msgid "Move Page Rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovetonewwindow
|
||
msgid "Move to New Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindow
|
||
msgid "Move to Other Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
||
msgid "New Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
msgid "Goto Next Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
#, fuzzy
|
||
#| msgid "&Open file at cursor"
|
||
msgid "&Open File at Cursor"
|
||
msgstr "إفتح الجذاذة التي تحت المؤشرة"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
msgid "Goto Previous Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgctxt "lazarusidestrconsts.uemreadonly"
|
||
msgid "Read Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemsource
|
||
msgctxt "lazarusidestrconsts.uemsource"
|
||
msgid "Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmarknset
|
||
#, object-pascal-format
|
||
msgid "Toggle Bookmark &%s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmarknunset
|
||
#, object-pascal-format
|
||
msgid "Toggle Bookmark &%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmarks
|
||
msgid "Toggle Bookmark ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
msgid "Toggle &Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.unitdepoptionsforpackage
|
||
msgid "Options for Package graph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.unitdepoptionsforunit
|
||
msgid "Options for Unit graph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr ""
|
||
|