lazarus/languages/lazaruside.it.po

22210 lines
691 KiB
Plaintext

# Giuliano Colla <giuliano.colla@fastwebnet.it>, 2014, 2015.
msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2015-01-12 00:43+0200\n"
"Last-Translator: Giuliano Colla <giuliano.colla@fastwebnet.it>\n"
"Language-Team: Lazarus\n"
"Language: it\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=2; plural=(n != 1);\n"
"X-Generator: Virtaal 0.6.1\n"
"X-Poedit-Language: Italian\n"
"X-Poedit-Country: ITALY\n"
"X-Poedit-SourceCharset: utf-8\n"
"X-Poedit-Bookmarks: 2233,2232,-1,-1,-1,-1,-1,-1,-1,-1\n"
#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr ""
#: lazarusidestrconsts.cocoamfstbijumpback
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr "Salta indietro"
#: lazarusidestrconsts.cocoamfstbijumpforward
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr "Salta avanti"
#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Usa schema predefinito"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Azzera preferenze"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Azzera preferenze del gutter"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Azzera preferenze del testo"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Aggiungi allo storico"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Menu contestuale"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Menu contestuale (debug)"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Menu contestuale (tab)"
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Salta all'implementazione"
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Salta all'implementazione/fine dell'altro blocco"
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Storico indietro"
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Storico avanti"
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Niente/Predefinito"
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Incolla"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Continua %0:s (Collegato a: %1:s)"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr "Continua %0:s"
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Selezione testo"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Selezione testo (righe)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Selezione testo (token)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Selezione testo (parole)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Selezione testo (modalità colonne)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Selezione testo (modalità righe)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
#, fuzzy
#| msgid "Set free bookmark"
msgid "Set a free bookmark"
msgstr "Imposta un segnalibri libero"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Seleziona la riga corrente(Completa)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Seleziona la riga corrente(Testo)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Seleziona il paragrafo corrente"
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Seleziona la parola corrente"
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Resetta lo zoom"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Questa pagina non mostra le vostre attuali preferenze: vedi preferenze avanzate. Usatela per azzerare cambiamenti alle preferenza avanzate"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Generale"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Standard: tutte le azioni su click del mouse (breakpoint, fold)"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Estesa: azioni (breakpoint, fold) su rilascio del click. Selezione con click e trascinamento"
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Gutter"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
#, fuzzy
#| msgid "Right mouse includes caret move"
msgid "Right button click includes caret move"
msgstr "Pulsante destro del mouse sposta il cursore"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Trascina selezione (copia/incolla)"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Pulsante Extra-1"
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Pulsante Extra-2"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Doppio"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Doppio"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Doppio"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Maiusc. Doppio"
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Quadruplo"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Pulsante centrale"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Centrale"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Sinistro 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Sinistro 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Pulsante destro"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Maius-Alt-Ctrl Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Maius-Alt-Ctrl "
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Maius-Alt Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Maius-Alt Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Maius-Ctrl Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Maius-Ctrl Rotella"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Maiusc. Pulsante"
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Rotella"
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Maiusc. Rotella"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Ci sono modifiche non salvate: usare questa pagina annullerà le modifiche fatte nella pagina avanzata"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Scorri in orizzontale (a velocità di sistema)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Scorri in orizzontale (una riga)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Scorri in orizzontale (una pagina)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Scorri in orizzontale (mezza pagina)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Scorri in orizzontale (una pagina, meno una riga)"
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Niente/Predefinito"
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Scorri (a velocità di sistema)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Scorri (una riga)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Scorri (una pagina)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Scorri (mezza pagina)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Scorri (una pagina, meno una riga)"
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Zoom"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Nessuno >"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Sola lettura"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minuscolo, prima lettera maiuscola"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr ""
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Aggiungi operatore di assegnazione :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Evidenziatura parentesi"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Albero di chiusura codice"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcustom
#, object-pascal-format
msgid "Custom %d"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Testo predefinito"
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Breakpoint disabilitati"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Breakpoint abilitati"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Riga dell'errore"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Punto di esecuzione"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Segnale di codice chiuso"
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Globale"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Riga"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edit sincrono"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Edita template"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlgaddhiattrgroupwrap
msgid "Wrapping"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_comment
msgid "Comments"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_declsection
msgid "Declaration Blocks"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_progheader
msgid "Procedure Header"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_custom
msgid "(Custom)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_entrytype
msgid "(entry type)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_extended
msgid "(Extended)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_nbrackets
msgid "(Nested Brackets)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Separatore gutter"
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Altre incrementali"
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Evidenzia la parola corrente"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Ricerca incrementale"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Breakpoint non valido"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Evidenzia la riga corrente"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Numero di riga"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Riga modificata"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Collegamento al mouse"
#: lazarusidestrconsts.dlgaddhiattrnestedbracket
#, object-pascal-format
msgid "Nested bracket %d"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevelcolor
#, object-pascal-format
msgid "Level %s"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Area selezionata"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Cella attiva"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Altre celle"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Celle sincronizzate"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Cella attiva"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Altre celle"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Celle sincronizzate"
#: lazarusidestrconsts.dlgaddhiattrtextblock
#, fuzzy
#| msgid "Text block"
msgid "Selected text"
msgstr "Blocco di testo"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Breakpoint sconosciuto"
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Parentesi alla parola"
#: lazarusidestrconsts.dlgaddhiattrwrapeol
msgid "EOL"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwrapindent
#, fuzzy
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapindent"
msgid "Indent"
msgstr "Rientro"
#: lazarusidestrconsts.dlgaddhiattrwrapsubline
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapsubline"
msgid "Sub-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Caratteri speciali visualizzati"
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Aggiungi punto e virgola"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Aggiusta linea in testa per il commento nel frontespizio"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabeticamente"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
#, fuzzy
#| msgid "Always visible cursor"
msgid "Always keep caret in visible area of editor"
msgstr "Cursore sempre visibile"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Azione sui file ambigua:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Avverti prima di compilare"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Davanti al messaggio è mostrata un'icona di errore/avvertimento/suggerimento. La stessa icona è comunque mostrata nell'editor."
#: lazarusidestrconsts.dlgansicommenttab
#, fuzzy
#| msgid "Ansi (* *)"
msgid "ANSI (* *)"
msgstr "Ansi (* *)"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Impostazioni dell'applicazione"
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Includere codice di asserzione"
#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr ""
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Creazione automatica form:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "La unit principale .lpr crea ogni form con Application.CreateForm(). Sono anche rilasciate automaticamente."
#: lazarusidestrconsts.dlgautocreatenewforms
#, fuzzy
#| msgid "When creating new forms, add them to auto-created forms"
msgid "Auto-create new forms"
msgstr "Alla creazione di nuove form, aggiungile a quelle auto-create"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Autocancellazione file"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Display automatico dei Prototipi di Funzione"
#: lazarusidestrconsts.dlgautohidecursor
#, fuzzy
#| msgid "Hide mouse when typing"
msgid "Hide mouse pointer when typing"
msgstr "Nascondi il mouse durante la scrittura"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Indenta automaticamente"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Imposta indentazione automatica)"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Rimuovi automaticamente metodi vuoti"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Rinomina automatica dei file in minuscolo"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr ""
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Form disponibili:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Queste form devono essere create e rilasciate nel codice del programma."
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Sfondo"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(nessuna sottocartella)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Stesso nome (nella cartella)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Dietro ai metodi"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Selezione"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Rientro del blocco"
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(tasti di correzione)"
#: lazarusidestrconsts.dlgblockindentspaces
msgid "Amount of spaces"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttabs
msgid "Amount of tabs (tab stops)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttabs2spaces
msgid "Amount of spaces (tab stops)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Spazi/tab come riga precedente"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Solo posizione"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Spazi"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Tab, taglia"
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Tab, poi spazi"
#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr ""
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
#, fuzzy
#| msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr "Lo spazio attorno può essere impostato nell'editor di Anchor. Se lo spazio è > 0 è mostrata una linea rossa."
#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Evidenzia parentesi"
#: lazarusidestrconsts.dlgbracketmatchgroup
#, fuzzy
#| msgid "Matching bracket pairs"
msgid "Matching bracket and quote pairs"
msgstr "Riconosci parentesi a coppie"
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr ""
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Secondary carets (multi-caret mode)"
msgstr ""
#: lazarusidestrconsts.dlgcaretcolor
#, fuzzy
#| msgid "Caret"
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr "Cursore"
#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr ""
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Main or primary caret"
msgstr ""
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr ""
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Distingui Maiuscolo/minuscolo"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Verifica opzioni del compilatore"
#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr "trovato un file orfano: %s"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Risultati"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Controllo compilatore ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Controllo configurazione compilatore ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Controllo data compilatore ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Compilazione di un file vuoto ..."
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Controllo sorgenti nei percorsi fpc ppu ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Compilazione di un file vuoto"
#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr "uso il file di configurazione %s"
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordine delle classi"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Ultima"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minuscolo"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Anteprima (Lunghezza massima riga = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Leggi il prefisso"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Posfisso memorizzato"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAIUSCOLO"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefisso variabile"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Scrivi il prefisso"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Salva come - auto rinomina i file Pascal in minuscolo"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Controlla e salva automaticamente i file"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Controlla i pacchetti quando crei la form"
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "La form può richiedere un pacchetto. Installarlo automaticamente."
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Scegliere il file modello di codice (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Mostra i pulsanti di chiusura negli appunti"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Schema colori"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Macro in stile C (globale)"
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Usa stringhe Ansi"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Stile dell'assembler"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Controlli e asserzioni"
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Comandi per il compilatore"
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Operatori stile C (*=, +=, /= e -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Crea il Makefile"
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Debugging"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Aggiunta percorso debugger (nessuno):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Creazione codice"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Entrambi"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Chiudi"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Nascondi"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Inverti ordine di chiusura nel Popup"
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Genera informazioni di debug per GDB (più lento/eseguibile più lungo)"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Usa la unit heaptrc (controllo di mem-leaks)"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Includi i file (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
#, fuzzy
#| msgid "Info for GDB"
msgid "Debugger info"
msgstr "Informazioni per GDB"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Librerie (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linking"
#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Le opzioni del compilatore possono essere salvate in un file XML"
#: lazarusidestrconsts.dlgcolorfeatpasteol
msgid "Extend past EOL"
msgstr ""
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Edita colore)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Non modificato"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Colori"
#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametri della riga di comando (senza il nome dell'applicazione)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
#, fuzzy
#| msgid "Make default indent for new line if comment opens at column:"
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Usa rientro predefinito per la nuova riga se il commento si apre alla colonna:"
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Limitare il rientro a"
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Prefisso ai commenti su fine riga"
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Corrispondenza con la riga corrente"
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Corrispondenza del testo incluso \"*\" del token \"(*\""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Corrispondenza dell'intera riga"
#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr "Corrispondenza del testo dopo il token \"%s\""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr "Corrispondenza del testo incluso il token \"%s\""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Prefisso su a capo"
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Allinea prefisso al rientro della riga precedente"
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Allinea prefisso sotto l'inizio dei commenti nella prima riga di commento"
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Non rientrare i prefissi"
#: lazarusidestrconsts.dlgcommentindentgroupoptions
#, fuzzy
#| msgid "Comments"
msgid "Comments and Strings"
msgstr "Commenti"
#: lazarusidestrconsts.dlgcommentshlashextendalways
#, fuzzy
#| msgid "Extend, if matched or not matched"
msgid "Extend if matched or not matched"
msgstr "Estendi, se corrisponde o no"
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
#, fuzzy
#| msgid "Extend, if matched or not matched (not at EOL)"
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Estendi, se corrisponde o no (non a fine riga)"
#: lazarusidestrconsts.dlgcommentshlashextendmatch
#, fuzzy
#| msgid "Extend, if matched"
msgid "Extend if matched"
msgstr "Estendi, se corrisponde"
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
#, fuzzy
#| msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "estendi, se corrisponde e il cursore è in mezzo al testo (non a fine riga)"
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Compilazione e link"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Messaggi del compilatore"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "File della lingua dei messaggi del compilatore (*.msg)"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completa le proprietà"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Il componente sotto il cursore del mouse è selezionato per primo, quindi i comandi del menu a comparsa agiscono su questo."
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Configurazione e Target"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "File di configurazione"
#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr ""
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Altre informazioni di debug"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Overflow"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analisi"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Mantieni chiusure durante copia/incolla"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
#, fuzzy
#| msgid "Copy word on copy none"
msgid "Copy current word when no selection exists"
msgstr "Copia la parola se non c'è selezione"
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Intervallo"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Riallocabile"
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Rendi predefinite le opzioni compilatore"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "&Mostra le opzioni"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Collegamenti intelligenti"
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Altri sorgenti (file .pp/.pas, usati solo dall'IDE e non dal compilatore)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stack"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Esegue strip sugli eseguibili"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Tipo di informazioni di debug"
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automatico"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
#, fuzzy
#| msgid "Dwarf2"
msgid "Dwarf 2"
msgstr "Dwarf2"
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
#, fuzzy
#| msgid "Dwarf with sets"
msgid "Dwarf 2 with sets"
msgstr "Dwarf con sets"
#: lazarusidestrconsts.dlgcosymboltypedwarf3
#, fuzzy
#| msgid "Dwarf3 (beta)"
msgid "Dwarf 3 (beta)"
msgstr "Dwarf3 (beta)"
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Elimina variabili"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Stile della unit"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Genera codice per valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Verbosità"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE in stile C++"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr ""
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Graffe { }"
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Attualmente rispettato dalla finestra dei messaggi, storico dei salti e risultato della ricerca"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursore oltre EOL"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
#, fuzzy
#| msgid "Cursor skips selection"
msgid "Caret skips selection"
msgstr "Il cursore salta la selezione"
#: lazarusidestrconsts.dlgcursorskipstab
#, fuzzy
#| msgid "Cursor skips tabs"
msgid "Caret skips tabs"
msgstr "Il cursore salta i tab"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Definita dall'utente (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Percorso editor"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Tipo di debugger e percorso"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Carattere dell'editor predefinito"
#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr ""
#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr ""
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valore predefinito"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr ""
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Cancella"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr ""
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Cancella il modello "
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Bottoni -"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Consigli:"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menu - "
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr ""
#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Direzione"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Disabilita l'antialiasing"
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "La distanza fra i punti della griglia è il passo più piccolo quando si muove un controllo."
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Usa il colore del margine destro"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Disegna livelli di separazione"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Colore delle righe nidificate"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Colore della riga"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (locali)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Sezioni unit"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Clausola uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (locali)"
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Scrivere sotto al componente il suo nome."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Indietro"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Grassetto"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sottocartella"
#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Modelli di codice"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Aggiungi istruzione di chiusura per blocchi pascal"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Definita dall'utente"
#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr "(ritardo di %s secondi)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Visualizza"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "File dell'editor"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Completamento dell'identificatore"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverti"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignora i lock e usa il più lungo editor non usato"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignora i lock se l'editor è quello corrente"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignora i lock se l'editor è nella finestra corrente"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Bloccato se c'è testo nella vista"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Sbloccato"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Sbloccato se c'è testo nella vista centrata"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nuovo tab, finestra esistente o nuova"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nuovo tab in nuova finestra"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nuovo tab in finestra esistente"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Questa opzione userà il più lungo editor inutilizzato per il file, anche se è bloccato o deve scorrere. L'ordine di focus delle finestre non viene considerato per decidere quale editor usare, anche nel caso in cui l'impostazione di \"ordina con lo stesso criterio\". Questa opzione avrà sempre successo e altre opzioni non sono testate."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Questa opzione controllerà se l'editor attivo attualmente ha il file destinazione, e se sì, userà l'editor attivo anche se è bloccato o se deve scorrere."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Questa opzione controllerà se c'è un editor nella finestra corrente per il file destinazione, e se c'è, userà quell'editor anche se è bloccato o se deve scorrere."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
#, fuzzy
#| msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Questa opzione userà un editor bloccato (e solo bloccato), che non deve scorrere per poter mostrare la destinazione del salto (se il punto di salto è già visibile sullo schermo)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Questa opzione userà un qualunque editor non bloccato."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
#, fuzzy
#| msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Questa opzione userà un editor non bloccato che non deve scorrere per mostrare la destinazione del salto (il punto di salto deve già essere visibile sullo schermo, tranne 2-5 righe in cima)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
#, fuzzy
#| msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Questa opzione aprirà un nuovo tab in una finestra esistente, o se sono tutte bloccate ne aprirà una nuova. Questa opzione avrà sempre successo e non ne saranno provate altre."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Se non ci sono tab sbloccati, questa opzione aprirà un nuovo tab in una nuova finestra (anche se si potrebbero usare altri tab in altre finestre). Questa opzione avrà sempre successo a non ne saranno provate altre."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#, fuzzy
#| msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Se non ci sono tab sbloccati, questa opzione aprirà un nuovo tab in una finestra esistente (e solo in una esistente). Verrà aperto un tab solo se esiste una finestra, e solo se non ha ancora un editor per il file destinazione."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Corsivo"
#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr ""
#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr ""
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Dimensione carattere"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opzioni dell'editor"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Opzioni globali di schema"
#: lazarusidestrconsts.dlgedmisc
#, fuzzy
#| msgid "Misc"
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Off"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "On"
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tab e rientro"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Sottolineato"
#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr ""
#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr ""
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Attributi dell'elemento"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Il tasto End salta all'end più vicino"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Chiede"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Nota: i file progetto sono tutti i file nella cartella del progetto"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "File"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Griglia"
#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr ""
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Lingua"
#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr ""
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Linee guida"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Altri file"
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Linguette del progetto"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
#, fuzzy
#| msgid "Extra char spacing"
msgid "Extra character spacing"
msgstr "Spazio caratteri extra"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Spazio riga extra"
#: lazarusidestrconsts.dlgextsymb
#, fuzzy
#| msgid "Use external gdb debug symbols file"
msgid "Use external debug symbols file"
msgstr "Usa file di simboli debug gdb esterno"
#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Estensione del file"
#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr ""
#: lazarusidestrconsts.dlgfilterall
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Tutti i file"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "File modelli di CodeTools"
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphipackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Pacchetto Delphi"
#: lazarusidestrconsts.dlgfilterdelphiproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Progetto Delphi"
#: lazarusidestrconsts.dlgfilterdelphiunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Unit Delphi"
#: lazarusidestrconsts.dlgfilterexecutable
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Eseguibile"
#: lazarusidestrconsts.dlgfilterfpcmessagefile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "File messaggi FPC"
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Settaggi Desktop di Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Tipi di file dell'editor"
#: lazarusidestrconsts.dlgfilterlazarusfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "File di Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusform
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "form di Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "File include di Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Altro file di Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruspackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Pacchetto di Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Progetto Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Sorgente del progetto Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Unit di Lazarus"
#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr ""
#: lazarusidestrconsts.dlgfilterpascalfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "File Pascal"
#: lazarusidestrconsts.dlgfilterprograms
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programmi"
#: lazarusidestrconsts.dlgfilterxml
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Files XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Trova il testo al cursore"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Pezzo"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Spezza sezione"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Commento:"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nodo"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Item"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "List <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Object (inherited, inline)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (locali)"
#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Commento (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (nidificati)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Commento { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Commenti nidificati"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedura)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Commento //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Sezione unit"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (globali)"
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Commento"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nodo"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Elaborazione istruzioni"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr ""
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr ""
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Colore primo piano"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Criterio di inserimento procedure"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Mantieni l'ordine delle procedure"
#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Eseguibile del compilatore (p.es. %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Cartella sorgente di FPC"
#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr ""
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Marcatesto"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor form"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Dall'&inizio"
#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From cursor"
msgid "From c&ursor"
msgstr "&Dal cursore"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Globale"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Genera codice per gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Reperisci il colore"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr ""
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Colore della griglia"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "La griglia consiste in puntini che aiutano ad allineare i controlli."
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Ampiezza X griglia"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Ampiezza passo orizzontale della griglia"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Ampiezza Y griglia"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Ampiezza passo verticale della griglia"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Browse del codice"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Annulla di Gruppo"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Mostra le linee guida"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Quando un controllo è allineato in orizzontale o in verticale con un altro, è mostrata una linea guida azzurra."
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Collassato"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Colore spaziatura laterale"
#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr ""
#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr ""
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Colore bordo spaziatura"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Indice separatori spaziatura"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Scorri mezza pagina"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Dimensioni di heap e stack"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Dimensione dell'Heap"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Altezza di una proprietà nella griglia."
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Altezza:"
#: lazarusidestrconsts.dlghideideonrun
#, fuzzy
#| msgid "Hide IDE windows on run"
msgid "Hide IDE windows on Run/Debug"
msgstr "Nascondi le finestre dell'IDE durante l'esecuzione"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Non mostrare del tutto l'IDE quando il programma è in esecuzione."
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Nascondi tab in finestre monopagina"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Marca il colore"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Marca il colore del font"
#: lazarusidestrconsts.dlghighlightleftofcursor
#, fuzzy
#| msgid "Left Of Cursor"
msgid "Left Of Caret"
msgstr "A sinistra del cursore"
#: lazarusidestrconsts.dlghighlightrightofcursor
#, fuzzy
#| msgid "Right Of Cursor"
msgid "Right Of Caret"
msgstr "Alla destra del cursore"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Mostra i consigli sul parametro \"Sender\" non usato"
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Mostra consigli per unit non usate nel main"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Il tasto home salta all'inizio più vicino"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Applicazione host"
#: lazarusidestrconsts.dlgiahadentifiercomplentryabstractprocfunc
msgid "Abstract proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrycodetemplate
msgid "Template"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryconst
msgid "Const"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryenum
msgid "Enum"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryfunc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryfunc"
msgid "Function"
msgstr "Funzione"
#: lazarusidestrconsts.dlgiahadentifiercomplentryident
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryident"
msgid "Identifier"
msgstr "Identificatore"
#: lazarusidestrconsts.dlgiahadentifiercomplentrykeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrykeyword"
msgid "Keyword"
msgstr "Parola chiave"
#: lazarusidestrconsts.dlgiahadentifiercomplentrylabel
msgid "Label"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrylowervisibilityprocfunc
msgid "Lower visibility proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrynamespace
msgid "Namespace"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryother
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryother"
msgid "Other"
msgstr "Varie"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryproc"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproperty
msgid "Property"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrytext
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytext"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlgiahadentifiercomplentrytype
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.dlgiahadentifiercomplentryunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgiahadentifiercomplentryvar
msgid "Var"
msgstr ""
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Completamento dell'identificatore"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Criterio degli identificatori"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Opzioni IDE:"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "codice con $IFDEF attivo"
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "codice $IFDEF inattivo"
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Codice incluso con $IFDEF misto"
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Nodo con $IFDEF attivo"
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Nodo con $IFDEF inattivo"
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Nodo incluso con $IFDEF misto"
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr ""
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr ""
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr ""
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Includi le variabili di sistema"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr ""
#: lazarusidestrconsts.dlgindentslineindentgroupoptions
msgid "Indent (New line)"
msgstr ""
#: lazarusidestrconsts.dlgindentstabindentgroupoptions
msgid "Indent (Tab key on Selection)"
msgstr ""
#: lazarusidestrconsts.dlgindentstabskeyoptions
msgid "Tab key"
msgstr ""
#: lazarusidestrconsts.dlgindentstabswidthsoptions
msgid "Tabs widths (Tab stop position)"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Davanti ai metodi"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Il costruttore deve chiamarsi 'init' (e il distruttore 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Insert class parts"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementation"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interface"
#: lazarusidestrconsts.dlginsertmethods
#, fuzzy
#| msgid "Insert methods"
msgid "Insert method implementations"
msgstr "Insert methods"
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Inserire nella sezione Uses di"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Inserisci spazio dopo di"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Inserisci spazio prima di"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervallo in secondi"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Salti (es. metodi di salto)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
#, fuzzy
#| msgid "Keep cursor X position"
msgid "Keep caret X position when navigating up/down"
msgstr "Mantieni la posizione X del cursore"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Edit Key)"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mappatura tasti"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Errori di mappatura tasti"
#: lazarusidestrconsts.dlgkeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgkeyword"
msgid "Keyword"
msgstr "Parola chiave"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Criterio delle parolechiave"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Consenti LABEL e GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Lingua"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Ultima (cioè alla fine del sorgente)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Cartella di Lazarus (predefinita per tutti i progetti)"
#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr ""
#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Linee Guida sinistra, alto"
#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "1 (quick, debugger friendly)"
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "1 (veloce, compatibile con debugger)"
#: lazarusidestrconsts.dlglevel2opt
#, fuzzy
#| msgid "2 (quick optimizations)"
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (ottimizzazione veloce)"
#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "3 (slow optimizations)"
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (ottimizzazione lenta)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "0 (no optimization)"
msgid "0 (no optimization, for debugging)"
msgstr "0 (nessuna ottimizzazione)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Separazione righe"
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Link intelligente"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Mostra i numeri di linea nelle backtrace degli errori di esecuzione"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Visualizza le form del progetto"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Visualizza i frames del progetto"
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Visualizza le unit del progetto"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Eseguibile di \"Make\""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margini e spaziatura laterale"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Colore marker"
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr ""
#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Highlight of Word under Caret"
msgid "Highlight all occurrences of Word under Caret"
msgstr "Evidenzia la parola sotto il cursore"
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Markup definito dall'utente"
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Cancella"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr "Cancellare la lista \"%s\"?"
#: lazarusidestrconsts.dlgmarkupuserdefineddivedit
msgid "Edit list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
#, fuzzy
#| msgid "Add Word or Term"
msgid "Add Word or Term by key"
msgstr "Aggiungi Parola o Temine"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
#, fuzzy
#| msgid "Remove Word or Term"
msgid "Remove Word or Term by key"
msgstr "Elimina Parola o Termine"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
#, fuzzy
#| msgid "Toggle Word or Term"
msgid "Toggle Word or Term by key"
msgstr "Commuta Parola o Termine"
#: lazarusidestrconsts.dlgmarkupuserdefineddivselect
msgid "Create or Select list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Termine duplicato"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "Il termine %s esiste già. I doppioni saranno eliminati quando la lista viene salvata"
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Aggiungi/togli in tutti gli editor"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Cancella lista"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Aggiungi lista"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Maiuscole e minuscole"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Poni il limite alla fine del termine"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Poni il limite all'inizio del termine"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Ignora i limiti per termini più lunghi di"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "Selezione"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "parola corrente"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Impostazioni per termini aggiunti da tasto"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Limiti per la scelta della corrispondenza intelligente"
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Nuova lista"
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Nessuna lista"
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Selezione ..."
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
#, fuzzy
#| msgid "Key Settings"
msgid "Key mappings"
msgstr "Impostazione Tasti"
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Impostazioni principali"
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
#, fuzzy
#| msgid "Match word boundaries for words up to this length:"
msgid "Match whole words, if length is less or equal to:"
msgstr "Trova i confini delle parole fino a questa lunghezza:"
#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Ignora parole chiave"
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Togli gli spazi (quando si evidenzia la selezione corrente)"
#: lazarusidestrconsts.dlgmatchwords
msgid "Match words"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Contatore massimo"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Lunghezza riga massima:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "File recenti massimi"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr ""
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "File di progetto recenti massimi"
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr ""
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr ""
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mescola metodi e proprietà"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr ""
#: lazarusidestrconsts.dlgmodifier
msgid "Modifier"
msgstr ""
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Azione del mouse"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Singolo"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Doppio"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Quadruplo"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Qualunque"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Centro"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Crea un fallback"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Rotella giù"
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Rotella su"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Cattura"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Muovi cursore (extra)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Azione su rilascio click del mouse"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Click"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Edita mouse"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Voce duplicata"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Questa voce è in conflitto con una esistente"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Bottone"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Cursore"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contesto"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Click"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Su/Giù"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Opzione"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Ordina"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Maiuscole"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Mouse"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avanzato"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Comando IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Tutto"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Albero collassature"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Collassato [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Espanso [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Numeri di linea"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Selezione"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opzione"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Altre azioni usando lo stesso pulsante"
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Questi possono essere eseguiti a seconda dei tasti modificatori, impostazioni di fallthrough, Singolo/Doppio, Su/Giù..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtra tasti modificatori"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Fatale"
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Consiglio"
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Importante"
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Nota"
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Panico"
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Prolisso"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Attenzione:"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Multiselezione"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find Editor for Jump Targets"
msgid "Jump target priority between multiple editors"
msgstr "Trova editor per bersagli di salto:"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Ordine da usare per editor che soddisfano gli stessi criteri"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Editor cliccato per ultimo per questo file"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (per il file) nella finestra cliccata più di recente"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Lista di priorità dei criteri per la scelta di un editor:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Pagine e finestre"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Linguette del notebook:"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Assegnazione nomi"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr ""
#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Nessuna rinomina automatica"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Nessuna unit disponibile da aggiungere."
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Nessuna evidenziazione"
#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Posizione dei tab del notebook nel sorgente"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Non spezzare le righe dopo"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Non spezzare le righe prima di"
#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr ""
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Analizzatore oggetti"
#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "Altezza dell'oggetto"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Impostazioni velocità"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Usa le impostazioni predefinite di Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Usa le impostazioni predefinite di Lazarus"
#: lazarusidestrconsts.dlgoptdebugbackendeditdebuggerbackend
msgid "Edit debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptdebugbackendselectdebuggerbackend
msgid "Select debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptdebugbackendtheprojectoptionshavebeen
msgid "The project options have been set to use a different debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Livelli di ottimizzazione"
#: lazarusidestrconsts.dlgoptwordwrap
msgid "Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapallhl
msgid "Select all"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapcheckfixedlength
msgid "Wrap at fixed column"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapdisplaycaretatwrappositio
msgid "Display caret at wrap-position..."
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapendofline
msgid "end of line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapfixedlinelength
msgid "Fixed line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwraphomeendkey
msgid "Force default home/end keys to subline start/end"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindent
msgid "Indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentisoffset
msgctxt "lazarusidestrconsts.dlgoptwordwrapindentisoffset"
msgid "Indent relative to text"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmax
msgid "Maximum indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmaxrel
msgid "Maximum indent width (percent)"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmin
msgid "Minimum indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapmaximumlinelength
msgid "Maximum line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapminimumlinelength
msgid "Minimum line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapnonehl
msgid "Clear selection"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapsectioncolumn
msgid "Wrap column settings"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapsectionindent
msgid "Indent settings"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapstartofnextline
msgid "start of next line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapusewordwrap
msgid "Use Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Altre ottimizzazione"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Altri file unit (-Fu):"
#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr ""
#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
#, fuzzy
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr "Pagina"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Sovrascrivi blocco"
#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Consigli per le palette componenti"
#: lazarusidestrconsts.dlgpascaselabelforotherwise
msgid "Color otherwise/else as case-label"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmode
msgid "Extend of type-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodeident
msgid "Identifier only"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeyandsym
msgid "All, including symbols"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeywords
msgid "Identifier, built-in and keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodenames
msgid "Identifier and built-in (types/values)"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemode
msgid "Extend of initial-value-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemodeliteral
msgid "Include literals (Number, String) in initial-value-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Estensione Pascal predefinita"
#: lazarusidestrconsts.dlgpasexthighlightgroup
msgid "Extended Pascal Highlight Options"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywords
#, fuzzy
#| msgid "Highlight control statements as keywords"
msgid "Highlight flow control statements (break, continue, exit) as keywords"
msgstr "Evidenzia istruzioni di controllo come parole chiave"
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Parole chiave corrispondenti"
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Passa le opzioni al linker con \"-k\", lo spazio è il delimitatore"
#: lazarusidestrconsts.dlgpasstringkeywords
#, fuzzy
#| msgid "Highlight \"String\" keyword(s)"
msgid "Highlight \"String\" types as keyword"
msgstr "Evidenzia parola/e chiave \"String\""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Predefinito"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Solo \"String\""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Blocco persistente"
#: lazarusidestrconsts.dlgpersistentcursor
#, fuzzy
#| msgid "Persistent cursor"
msgid "Visible caret in unfocused editor"
msgstr "Cursore persistente"
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr ""
#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Applicazione"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "del chiamante (asInvoker)"
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "&Cancella l'icona"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Crea un bundle di applicazioni"
#: lazarusidestrconsts.dlgpodebugger
#, fuzzy
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Carica i pre&definiti"
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Livello di esecuzione"
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Form"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "massimo disponibile (highestAvailable)"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Icona:"
#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(dimensioni: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(nessuna)"
#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "Carica &Icona"
#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness (Windows 10 1607+)"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "richiede administrator (requireAdministrator)"
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Risorse"
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "&Salva Icona"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessione"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titolo:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "UI Access (uiAccess)"
#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
msgid "Use Application Bundle for running and debugging"
msgstr "Usa Application Bundle per esecuzione e debug (solo Darwin)"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "Usa il file manifest per abilitare i temi (solo Windows)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Preferire doppio click al click singolo"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Priorità"
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Progetto"
#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Opzioni per il progetto: %s"
#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "File del progetto"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "Conferma il rim&piazzo"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Completamento della proprietà"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nome proprietà"
#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "Apertura ultimo progetto alla partenza"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Mostra lo spazio di contorno"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Mostra la griglia"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Griglia magnetica"
#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr ""
#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr ""
#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr ""
#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr ""
#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr ""
#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr ""
#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr ""
#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr ""
#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Riferimento"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "Espressione &regolare"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr ""
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Rinomina"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Sostituisci &Tutto"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace with"
msgid "Replace wit&h"
msgstr "&Sostituisci con"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapporto"
#: lazarusidestrconsts.dlgreset
#, fuzzy
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr "Ripristina"
#: lazarusidestrconsts.dlgresetactivedesktopbtncaption
msgid "Restore active"
msgstr ""
#: lazarusidestrconsts.dlgresetactivedesktopbtnhint
msgid "Restore window layout of active desktop"
msgstr ""
#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr ""
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Linee di riferimento destra, fondo"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Pulsante destro seleziona"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margine destro"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Cartella di lavoro"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Seleziona nipote"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Creazione elastico"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Selezione a elastico"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (non per win32, esempio 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Locale"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variabili di sistema"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Usa DISPLAY"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Override utente"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Parametri di esecuzione"
#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Righe salvate"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Salva informazioni dell'editor per i file chiusi"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "I file si ritrovano nella lista storica \"Aprire recenti\""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Salva informazioni dell'editor solo per i file di progetto"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Solo i file che appartengono a questo progetto."
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Scorrimento per uno di meno"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Scorrimento"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Mostra consigli per lo scorrimento"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Scorrimento fino alla fine del file"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Caret past end of line"
msgid "Allow Caret to move past the end of line"
msgstr "Cursore oltre il fine riga"
#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr "Cartella di ricerca \"%s\" non trovata."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Ricerca interrotta dall'utente."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Ricerca ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Percorsi"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr ""
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Selezionare tutti i controlli figli insieme al loro genitore."
#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "Testo &selezionato"
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Imposta tutti gli elementi come predefiniti"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Imposta l'elemento come predefinito"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Imposta la proprietà variabile"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Mostra tutte le unit"
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
#, fuzzy
#| msgid "Show captions of non-visual components"
msgid "Show captions of nonvisual components"
msgstr "Mostra le intestazioni dei componenti non visuali"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Mostra le procedure compilate"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Mostra numeri linee"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Mostra i condizionali"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Mostra le informazioni di debug"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Mostra i consigli del designer"
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "Il consiglio mostra la posizione o la dimensione del controllo, quando lo si sposta o ridimensiona."
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Mostra tutto"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Mostra info sll'eseguibile (solo Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Mostra le informazioni generali"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Mostra i consigli"
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Mostra i consigli"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Finestre visibili"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Mostra numeri di riga"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Mostra le icone dei messaggi"
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Mostra le note"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Mostra i file provati"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Mostra il file usati"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Mostra gli avvertimenti (warning)"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Mostra bottone singolo in TaskBar"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Ignora le forward class declarations"
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Barre //"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tab intelligenti"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Simbolo posposto (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Contatore (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Simbolo anteposto (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Linee guida magnetiche"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Quando un controllo è prossimo ad essere allineato con un'altro, scatta nella posizione allineata."
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr ""
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spazio"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Consigli per i principali bottoni veloci (apri, salva, ...)"
#: lazarusidestrconsts.dlgsrcedcolorlabelinthesourceareonlyco
msgid "Label in the source are only colored if the colon \":\" is placed immediately after the label."
msgstr ""
#: lazarusidestrconsts.dlgsrcedcolormembercolorisappliedtoany
msgid "\"Member\" color is applied to any identifier behind a dot \".\"."
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origine"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Dimensione dello stack"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Ferma dopo un certo numero di errori:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Aggiungi il testo alla string di chiusura"
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Aggiungi string sull'a capo"
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "String ''"
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineafterfirst
msgid "Align second line (after first break) with the position of the lowest matching group in the pattern, or the match position of the pattern itself."
msgstr ""
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineregex
msgid "Align second line (reg-ex):"
msgstr ""
#: lazarusidestrconsts.dlgstringcontalignmaxindentforsecondlineifb
msgid "Max indent for second line if based on reg-ex:"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Estendi le string sul fine riga"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sottoproprietà"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opzioni di sintassi"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab indenta i blocchi"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Mostra numeri di tab nel notebook"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulazioni in spazi"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Larghezza Tab"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Famiglia di CPU di destinazione"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "OS destinazione"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Piattaforma di destinazione"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processore destinazione"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Opzioni specifiche della Destinazione"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Cartella per costruire progetti di test"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr ""
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "&Testo da trovare"
#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr ""
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Consigli della Classe/Proc corrente"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Stile di pulitura spazi"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Cursore o edit"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Riga modificata"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Lascia riga"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Solo posizione"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Elimina gli spazi oltre le righe"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Annulla dopo il salvataggio"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Disfa /Rifai"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limite dell'Undo"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Aggiorna"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Cartella di output delle Unit (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Riga non salvata"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Collassatura del codice"
#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr ""
#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr ""
#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr ""
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Usa altri file di configurazione per il compilatore"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Disegno di separatori"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Usa file di configurazione compilatore standard (fpc.cfg)"
#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr ""
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr ""
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Lancia da un altro programma:"
#: lazarusidestrconsts.dlguseminimumime
#, fuzzy
#| msgid "Ime handled by System"
msgid "IME handled by System"
msgstr "Metodo di input gestito dal sistema"
#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr "Caricamento fallito del file schema utente %s"
#: lazarusidestrconsts.dlguseschemedefaults
#, fuzzy
#| msgid "Use (and edit) global scheme settings"
msgid "- Scheme globals -"
msgstr "Usa (e edita) impostazioni globali di schema"
#: lazarusidestrconsts.dlguseschemelocal
#, fuzzy
#| msgid "Use local scheme settings"
msgid "selected language"
msgstr "Usa impostazioni locali di schema"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Usa evidenziatura sintassi"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Usa storico tab quando vengono chiusi"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Aggiungi la unit alla sezione Uses"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valore"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Livello dei dettagli mostrati durante la compilazione:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Spaziatura laterale visibile"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Margine destro visibile"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "Solo parole &intere"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ampiezza:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Applicazione GUI Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Finestre"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Eccezioni"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Parole"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Anteprima"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Scrivi un logo FPC"
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr ""
#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr ""
#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr ""
#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr ""
#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr ""
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "I componenti selezionati piè¹ volte devono essere di una singola form"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Allinea ..."
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Cancella la selezione"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Speculare in orizzontale"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Speculare in verticale"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Indietro di uno"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Avanti di uno"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Sposta tutto indietro"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Sposta in primo piano"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Azzera ..."
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Salva form come xml"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Scala ..."
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Scala"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Seleziona tutto"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Ridimensiona ..."
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Ampiezza"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opzione: griglia magnetica"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opzione: linee guida magnetiche"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Ordine Z"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Su ambo i lati"
#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr ""
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugcurrent
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr ""
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr ""
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugignore
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr ""
#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugnew
#, fuzzy
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Nuovo"
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = no, 1 = disegna linee di divisione solo per livello principale, 2 = disegna linee per i primi due livelli ecc..."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Aggiungi file"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipo antenato ambiguo"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nome classe ambiguo"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nome unit ambiguo"
#: lazarusidestrconsts.lisa2pancestortype
#, fuzzy
#| msgid "Ancestor Type"
msgid "Ancestor type"
msgstr "Tipo antenato"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dipendenza errata"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Il nome della classe esiste già"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Crea un nuovo componente"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dipendenza"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr ""
#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr "File esistente: \"%s\""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Il file esiste già"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr "Il file \"%s\" è già presente nel pacchetto."
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Il file è in uso"
#: lazarusidestrconsts.lisa2pfilename2
#, fuzzy
#| msgid "Filename"
msgid "Filename/URL"
msgstr "Nome file"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Il file non è una unit"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr ""
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr ""
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipo antenato non valido"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Dipendenza circolare non valida"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nome classe non valida"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "File non valido"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nome file non valido"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nome unit non valida"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" non è un nome unit valido."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nome nuova classe:"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nuovo File"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Non è stato trovato un pacchetto per la dipendenza \"%s\".%sScegliere un pacchetto esistente."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr ""
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nome pagina troppo lungo"
#: lazarusidestrconsts.lisa2ppalettepage
#, fuzzy
#| msgid "Palette Page:"
msgid "Palette page:"
msgstr "Pagina palette:"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Riduci o espandi il nome del file"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Mostra tutto"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Il tipo di antenato \"%s\" ha lo stesso nome%sdella unit \"%s\"."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Il tipo antenato \"%s\" non è un identificatore pascal valido."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "In nome della classe \"%s\" e il tipo di antenato \"%s\" sono uguali."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "In nome classe \"%s\" esiste già nel%sPacchetto %s%sFile: \"%s\""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Il nome classe \"%s\" è lo stesso%sdella unit \"%s\". "
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Il nome classe \"%s\" non è un identificatore pascal valido."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Il file \"%s\" è parte del progetto corrente.%sNon è consigliato condividere file tra progetti e pacchetti."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format, fuzzy
#| msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Il nome del file \"%s\" è ambiguo dato che il pacchetto non possiede ancora una cartella predefinita.%sSpecificare un nomefile con un percorso completo."
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La versione massima è inferiore della versione minima"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Il pacchetto possiede già una dipendenza per il pacchetto \"%s\"."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Il nome pagina \"%s\" è troppo lungo (max 100 caratteri)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Il nome unit \"%s\" esiste già nel pacchetto:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in this package."
msgstr "In nome unit \"%s\" esiste già in questo pacchetto."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Il nome della unit \"%s\"%s ed il nome del file \"%s\" sono differenti."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Il nome della unit \"%s\" è lo stesso di un componente registrato.%sL'uso di questo può provocare messaggi di errore imprevedibili."
#: lazarusidestrconsts.lisa2punitname
#, fuzzy
#| msgid "Unit Name:"
msgid "Unit name:"
msgstr "Nome unit:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Il nome unit esiste già"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Abbandonare i cambiamenti?"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Interrompi tutto il caricamento"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Abortito"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Interrompi il caricamento del progetto"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "A proposito ..."
#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "A proposito di %s"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentazione"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Informazioni sull'IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Informazioni su Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format, fuzzy
#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Licenza: GPL/LGPL. Vedere i sorgenti Lazarus e Free Pascal per dettagli sulla licenza.%sLazarus è una IDE per creare programmi grafici e console con Free Pascal. Free Pascal è un compilatore Pascal e Object Pascal che gira su Windows, Linux, Mac OS X, FreeBSD e altri.%sLazarus è la parte mancante del puzzle vi permetterà di creare programmi in un ambiente simile a Delphi per tutte le piattaforme menzionate. L'IDE è uno strumento RAD che comprende un disegnatore di form.%sPiù Lazarus cresce, più ci servono nuovi sviluppatori."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Lista dei contributori non trovata"
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Ufficiale:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format, fuzzy
#| msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "Un %s non può avere TControls.%sPotete porvi sopra solo componenti non visuali."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Riconoscimenti"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Azione:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Attivare"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Attiva la sintassi delle espressioni regolari per il testo e per la sostituzione (quasi come in perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Attivare selezionato"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Attivo"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtri attivi"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr ""
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Aggiungere defines che simulano Delphi7"
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Utile quando il codice prevede il controllo delle versioni di compilatore supportate"
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr "Aggiunto l'oggetto mancante \"%s\" al sorgente pascal."
#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr "Aggiunta proprietà \"%s\" per %s."
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr ""
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Aggiungere un filtro ..."
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "L'aggiunta non può stare nel messaggio corrente"
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "L'aggiunta può stare nel messaggio corrente"
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Aggiunte"
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Aggiungere parola chiave \"do\""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Aggiungi nuova modalità di build e copia le impostazioni da \"%s\""
#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr ""
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Aggiungi nuova macro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Aggiungi nuovo insieme"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Aggiungi requisiti di pacchetto?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
#, fuzzy
#| msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "aggiungere pacchetto(i) alla lista dei pacchetti installati (unisci a --build-ide per ricompilare l'IDE)."
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Aggiungi il pacchetto al progetto"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Aggiungi parentesi ai parametri"
#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Aggiungere al percorso di ricerca degli include?"
#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "Aggiungere %s al progetto?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr ""
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Aggiungere al percorso di ricerca delle unit?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Aggiungi interfacce unit"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Aggiungi unit (sconsigliato)"
#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr "Aggiungi valore alla macro %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Aggiungi un file al pacchetto"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Pacchetto di destinazione"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Tipo file"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Pacchetto non valido"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "ID pacchetto non valido: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Il pacchetto è a sola lettura"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "Pacchetto \"%s\" non trovato."
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Mostra tutto"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "Il pacchetto %s è a sola lettura."
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr "Un filtro con nome \"%s\" esiste già."
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Dopo la pulizia (pulisci tutto o pulisci i file comuni), commuta a pulizia automatica"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Allineamento"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Tutti i blocchi sembrano ok."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Tutti i build modes>"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Tutte le opzioni ereditate"
#: lazarusidestrconsts.lisalloptions
#, object-pascal-format, fuzzy, badformat
#| msgid "All Options"
msgid "All options of FPC%s (\"%s\")"
msgstr "Tutte le Opzioni"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Permetti la ricerca per righe multiple"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Tutti i parametri di questa funzione sono già definiti. Niente da aggiungere."
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Tutte le modifiche a \"%s\"%ssaranno perse se il file viene riaperto"
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alfa"
#: lazarusidestrconsts.lisalreadycontainsthehe
#, object-pascal-format
msgid ""
"%s already contains the help:\n"
"%s"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Tasti alternativi"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Tasti alternativi (o sequenza di 2 tasti)"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Convertire sempre in minuscolo il nome di file suggerito"
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Disegna sempre l'elemento selezionato"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Ignora sempre"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Esiste già una macro con questo nome."
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Trovato file ambiguo"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Trovato file ambiguo: \"%s\"%sQuesto file può essere confuso con \"%s\"%sCancellare il file ambiguo?"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancora il lato inferiore al lato inferiore del figlio. Usare BorderSpacing per fissare la distanza. BorderSpacing del figlio è ignorato."
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancora il lato inferiore al lato superiore del figlio. La distanza è definita da BorderSpacing sia di questo oggetto che del figlio."
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Anchor Editor - nessun controllo selezionato"
#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr "Abilitato = Include %s è in Anchors"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancora il lato sinistro al lato sinistro del figlio. Usare BorderSpacing per fissare la distanza. BorderSpacing del figlio è ignorato."
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancora il lato sinistro al lato destro del figlio. La distanza è definita da BorderSpacing sia di questo oggetto che del figlio."
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancora il lato destro al lato sinistro del figlio. La distanza è definita da BorderSpacing sia di questo oggetto che del figlio."
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancora il lato destro al lato destro del figlio. Usare BorderSpacing per fissare la distanza. BorderSpacing del figlio è ignorato."
#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ancoraggi dei controlli selezionati"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancora il lato superiore al lato inferiore del figlio. La distanza è definita da BorderSpacing sia di questo oggetto che del figlio."
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancora il lato superiore al lato superiore del figlio. Usare BorderSpacing per fissare la distanza. BorderSpacing del figlio è ignorato."
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Si è verificato un errore all'ultimo avvio, nel caricare %s!%sCaricare di nuovo questo progetto?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr ""
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nome della classe dell'applicazione"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Una applicazione grafica in Free Pascal, che utilizza la libreria multi-piattaforma LCL per l'interfaccia grafica."
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Applica"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
#, fuzzy
#| msgid "apply build flags (-B) to dependencies too"
msgid "Apply build flags (-B) to dependencies too."
msgstr "Applica i flagi di build anche alle dipendenze"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Applica convenzioni"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Aggiusta l'estensione del nome e maiuscolo/minuscolo in funzione della piattaforma e del tipo di file."
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Una unit del progetto non può essere usata da altri pacchetti/progetti"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Spazio dal bordo attorno al controllo. Gli altri quattro spazi di bordo sono sommati a questo valore"
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Chiedi prima di sostituire ogni testo trovato"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Chiedi prima di salvare la sessione del progetto"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Chiedi il nome del componente dopo averlo messo su un form designer."
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Chiedi il nome del file per ogni nuovo file"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Chiedi il nome alla creazione"
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Completamento automatico: off"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Completamento automatico: on"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Markup e corrispondenze"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automatico"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automaticamente"
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Converti automaticamente i file .lfm in file di risorse .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "non completare la selezione"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Invoca automaticamente dopo il punto "
#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "Interruzione di riga"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "spazio"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tab"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "fine parola"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "non aggiungere caratteri"
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Completamenti e consigli"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Mostra automaticamente"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Disponibili per l'installazione"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
#, fuzzy
#| msgid "Available project build modes:"
msgid "Available project build modes"
msgstr "Build modes disponibili per il progetto:"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Fai un backup dei file modificati"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Backup file fallito"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Crea una sottocartella di backup nella cartella del progetto"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Cambiare il nome pacchetto o la versione interrompe le dipendenze. Si desidera cambiare anche le dipendenze?%sBattete Sì se volete cambiare tutte le dipendenze elencate%so Ignora per interrompere le dipendenze e continuare."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "inizia"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "dietro i correlati"
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "Be less verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "Be more verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Per un miglior risultato installare un controllo HTML come turbopoweriprodsgn"
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Fai sempre la build prima di eseguire"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Comando di costruzione"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Invece di costruisci progetto esegui il comando Costruisci File"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Invece di lancia progetto esegui il comando Lancia File"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Esegui comando"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Quando questo file è attivo nell'editor dei sorgenti"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Cartella di lavoro (lasciare vuoto per il percorso)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Grassetto per valori non predefiniti"
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Spazio del bordo"
#: lazarusidestrconsts.lisbottom
#, fuzzy
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Basso"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Spazio del bordo inferiore. Questo valore viene aggiunto al bordo inferiore, ed è usato per lo spazio sotto il controllo."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancora inferiore"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Code"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Questo è il controllo compagno a cui il bordo inferiore è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Stessa spaziature al fondo"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr ""
#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr ""
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Chiudi"
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Sostituire ..."
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Trova"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Esci"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Rimuovi"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr ""
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Sostituisci"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
#, fuzzy
#| msgid "build all files of project/package/IDE"
msgid "Build all files of project/package/IDE."
msgstr "Costruisci tutti i file del progetto/pacchetto/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr ""
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Costruisci la IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
#, fuzzy
#| msgid "build IDE with packages"
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr "Costruisci l'IDE con i pacchetti"
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Costruzione di Lazarus fallita"
#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Differenza fra modi di costruzione"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Differenza con altri modi di costruzione"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modo:"
#: lazarusidestrconsts.lisbuildmodes
#, fuzzy
#| msgid "Build modes"
msgid "Build mode"
msgstr "Modi di costruzione"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Costruisci un nuovo progetto"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Numero di costruzione"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Occupato"
#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr "%s bites"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Annulla il caricamento di questo componente"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Annulla il caricamento della unit"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Annulla rinomina"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Non posso compilare il progetto"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Impossibile copiare il componente principale."
#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "Impossibile creare il file \"%s\""
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr ""
#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr "impossibile eseguire \"%s\""
#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr "Impossibile trovare %s"
#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr "impossibile trovare l'eseguibile \"%s\""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Impossibile trovare esecutore di Lazarus:%s%s"
#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Impossibile provare il compilatore durante il debug o la compilazione."
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Si può cambiare solo la classe dei TComponents."
#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr "Impossibile trovare un valido %s.ppu"
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Paragona file (non per creare toppe)"
#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (%s file)"
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr "Eliminare veramente %s files sorgente%s%s"
#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "Cambia la Classe di %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "nessuna classe"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilatore ambiguo"
#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Controllare la cartella di test sotto %sAmbiente -> Opzioni ambiente -> Files -> Cartella per la build di progetti di prova"
#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Il compilatore \"%s\" non è un file eseguibile.%sDettagli: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contiene"
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copia l'output alla clipboard"
#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Le date dei file .ppu di FPC differiscono di oltre un'ora.%sÈ possibile che provengano da due diverse installazioni.%sFile1: %s%sFile2: %s"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERRORE: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Il percorso delle unit FPC contiene un sorgente: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "nuovi simboli di riga"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "CONSIGLIO: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilatore invalido"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Percorso di ricerca invalido"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Cartella di test invalida"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unit mancante"
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "trovate configurazioni multiple del compilatore:"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg non trovato"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "non ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "file .ppu doppio: %s, %s"
#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Uno dei file .ppu è più vecchio del compilatore stesso:%s%s"
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "C'è più di un compilatore FreePascal nel vostro path.%s%s%sAvete dimenticato di cancellare un vecchio compilatore?"
#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr "Salta"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caratteri speciali"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Tutti i test sono stati superati"
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Non posso creare il Test File"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Non posso creare il Test file pascal \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caratteri insoliti"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Attenzione:"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ATTENZIONE:"
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "Delimitatore di path errato"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Categorie"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complessità"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Costanti"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Blocchi vuoti"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Sezioni classe vuote"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Costruttori vuoti"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procedure vuote"
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Segui il cursore"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "E' un controllo principale"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "Conteggio parametri trattato come \"molti\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procedure lunghe"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Conteggio righe di procedura trattato come \"lunghe\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Molte procedure nidificate"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Molti parametri"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Mostra categorie"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Mostra nodi sorgente"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "Conteggio procedure nidificate trattato come \"molte\""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centrare una finestra perduta"
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centra il controllo orizzontalmente rispetto al controllo compagno. BorderSpacing è ignorato."
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centra il controllo verticalmente rispetto al controllo compagno. BorderSpacing è ignorato."
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Centra form"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centra nella finestra"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centra"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Modo preferito di visualizzazione"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Categoria"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Sorgente"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Mai, solo manualmente"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Usato solo in modalità categoria"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Se inutilizzato"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Aggiorna automaticamente"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Varie"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aggiorna"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Durante lo switch dei file nell'editor dei sorgenti"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedure"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Proprietà"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Proprietà pubblicate senza valore predefinito"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Mostra osservazioni su"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Stile"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Intorno"
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Cose da fare"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tipi"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Costanti anonime"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Membri non ordinati"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilità non ordinata"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variabili"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Indentazione errata"
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Si è verificato un errore nel cancellare%s\"%s:%s\"%s%s"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Non so come copiare questa selezione"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Non so come tagliare questa selezione"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Non so come cancellare questa selezione"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Errore nel creare il componente"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr "Errore nel creare il componente: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Errore nel distruggere il componente"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Errore nel distruggere il componente di tipo %s della unit %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Errore nel distruggere il mediatore"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Errore nel distruggere il mediatore %s della unit %s:%s%s"
#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr "Nel file %s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Proprietario del componente non valido"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm esiste già"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm tipo sconosciuto %s"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Dove è il TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator già registrato: %s"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "L' editor di componenti della classe \"%s\" ha generato l'errore:%s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Il componente di tipo %s non ha definito il suo proprietario come %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr "Impossibile azzerare la selezione%s%s"
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Cambia"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Cambia modo di build"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Cambia classe"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Modificate %s coordinate di %s da \"%d\" a \"%d\" in %s."
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Cambia codifica"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Cambia file"
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Cambia padre..."
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Cambiamenti non salvati"
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Cambia in / di Unix"
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Cambia in \\ di Windows"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Controlla Tutto"
#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Controlla i cambiamenti dei file su disco dal contenuto invece che dal timestamp"
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Verifica che il pacchetto %s crei %s.ppu, che nessuno cancelli questo file e infine che non vi siano due pacchetti che accedono al sorgente della stessa unit."
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Verifica che il pacchetto %s sia tra le dipendenze"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
#, fuzzy
#| msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\""
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Controlla se il prossimo token nel sorgente è un END: se non lo è, mette un END su una nuova riga e va a capo"
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Controlla opzioni"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Verifica il percorso di ricerca del pacchetto %s, prova con un pulisci e ricostruisci, verifica la sezione uses in implementation."
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Verifica la destinazione (OS, CPU, tipo di LCL). Forse dovete ricompilare il pacchetto per la destinazione corretta, o modificare la destinazione del progetto."
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgctxt "lazarusidestrconsts.lischooseadifferentname"
msgid "Choose a different name"
msgstr "Scegliere un nome differente"
#: lazarusidestrconsts.lischooseadifferentname2
#, fuzzy
msgctxt "lazarusidestrconsts.lischooseadifferentname2"
msgid "Choose a different name"
msgstr "Scegliere un nome differente"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Scegliere un file con i modelli di CodeTools"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Scegli un link FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Scegli un tasto ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Scegli un nome per il componente"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Scegliere un file di esempio"
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Scegliere un file di messaggi di FPC"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Scegli un file pascal per esempi di indentazione"
#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Scegli l'eseguibile del compilatore (%s)"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Scegli un file di messaggi del compilatore"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Scegli l'eseguibile del debugger"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Scegli un pacchetto Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Scegli un pacchetto Lazarus (*.lpk)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Scegli la unit Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Scegliere la cartella"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr ""
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Scegliere la cartella sorgente FPC"
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Scegliere la cartella di Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Scegli l'eseguibile di \"make\""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Scegli una di queste voci per creare un nuovo File"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Scegli uno di queste voci per creare un nuovo pacchetto"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Scegli una di queste voci per creare un nuovo Progetto"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Scegli uno di questi oggetti quello da cui ereditare"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Scegliere sorgente programma (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Scegli la struttura per racchiudere la selezione"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Scegli la cartella per i test"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Rilevata dipendenza circolare"
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Completamento di classe"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Classi e proprietà esistono già. i valori non sono stati controllati."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "La classe \"%s\" non è una classe di componente registrata.%sImpossibile incollare."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe non trovata"
#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr "La Classe %s non trovata a %s(%s,%s)"
#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Classe \"%s\" del metodo \"%s\" non trovata."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Pulisci"
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Pulisci la cartella"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Pulisci le sottocartelle"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Mantieni tutti i file di testo"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Mantieni tutti i file che corrispondono al filtro"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Elimina tutti i file che corrispondono al filtro"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintassi semplice (cioè * invece di .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Pulisci tutto"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Pulisci sorgenti Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Dopo la costruzione commuta in automaticamente"
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Ripulisci"
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Ripulisci e costruisci"
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Ripulisci e costruisci il progetto"
#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr ""
#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Pulisco il percorso dei moduli?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Clear"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Pulisci cartella"
#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr ""
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Azzera il filtro delle opzioni"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Clicca qui per sfogliare i file"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr ""
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Clona"
#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Chiudi"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Chiudi tutti i selezionati"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Chiudi i file"
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Nascondi la finestra"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Chiusura di una finestra editor di sorgente. Vuoi chiudere tutti i file oppure nascondere la finestra?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Chiudi la finestra di editing sorgenti"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opzioni specifiche interfaccia LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parametro"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Componenti"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Eredità"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Tavolozza"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Pagine"
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "&Ripristina i valori predefiniti"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "File di configurazione del compilatore aggiuntivo ambiguo"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Chiamata su:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sClicca OK se sei sicuro di volerlo fare."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Codice"
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navigatore del codice"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialoglocation
#, fuzzy
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Indirizzo"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Opzioni di generazione del codice"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Aggiungi percorso"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Esplora"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Conferma sostituzione"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Crea oggetto di aiuto"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Rimuovi il percorso"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Descrizione"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Errori"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Esempio"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Impostazioni di FPDoc"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Inserisci tag di formattazione grassetto"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Inserisci il tag di formattazione codice"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Inserisci it tag di formattazione corsivo"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Inserisci il tag di formattazione evidenziato"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Inserisci il tag di formattazione sottolineato"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Inserisci il tag di formattazione Var"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Ereditati"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Inserisci un link ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Inserisci il tag di formattazione paragrafo"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nessuna descrizione ereditata trovata)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NESSUNO>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Vedi anche"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Breve descrizione di"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Breve"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgid "Ignore constants in next functions"
msgstr "Ignora le costanti nelle prossime funzioni"
#: lazarusidestrconsts.liscodeobscharconst
msgid "Search for unnamed char constants"
msgstr "Cerca costanti char anonime"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Osservatore del codice"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgid "Ignore next unnamed constants"
msgstr "Ignora le prossime costanti anonime"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Aggiungi modello"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Aggiungi modello di codice"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Completamento automatico attivo"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commento:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Modifica il modello di codice"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr ""
#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr ""
#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr ""
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Azione: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "I nodi auto creati non si possono modificare, %se non possono avere nodi figlio auto creati."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, auto generata"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "I nodi autogenerati non si possono modificare"
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blocco"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor dei define dei CodeTool"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Percorso del compilatore"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converti nodo"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Crea i define per la cartella %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Crea i define per il compilatore Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
#, fuzzy
#| msgid "Create Defines for Free Pascal SVN Sources"
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Crea i Define per il codice sorgente SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Crea i define per il progetto %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Crea Macro FPC e percorsi per una cartella progetto fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Define"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Define ricorsivamente"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Cancella nodo"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "La %s cartella principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: C:/Programmi/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "La %s cartella principale,%sdove Borland ha installato tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: C:/Programmi/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Descrizione:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "cartella %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
#, fuzzy
#| msgid "FPC SVN source directory"
msgid "FPC Git source directory"
msgstr "Cartella dei sorgenti SVN di FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Cartella"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Inserisci il modello di compilatore Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Inserisci modello di directory Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Inserisci modello di progetto Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Inserisci modello di directory Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Inserisci modello di directory Delphy 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Inserisci modello di progetto Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Inserisci modello di compilatore Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Inserisci modello di directory Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Inserisci modello di progetto Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Inserisci modello di compilatore Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Inserisci modello di progetto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
#, fuzzy
#| msgid "Insert Free Pascal SVN Source Template"
msgid "Insert Free Pascal Git Source Template"
msgstr "Inserisci il modello del sorgente SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Inserisci modello di compilatore Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Inserisci modello di directory Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Inserisci modello di progetto Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Inserisci nodo figlio"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Inserisci nodo qui sotto"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Inserisci modello"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Genitore non valido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nodo genitore non valido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nodo precedente non valido"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "La %s directory principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: /home/utente/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "La %s directory principale,%sdove Borland installa tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: /home/utente/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Sposta il nodo giù"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Sposta il nodo di un livello giù"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Sposta il nodo di un livello su"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Sposta il nodo su"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nuovo nodo"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Il nodo è in sola lettura"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nessuna selezionata"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Il nodo genitore non può contenere nodi figlio."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Il nodo precedente non può contenere nodi figli"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Cartella progetto"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "directory progetto %s"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Seleziona nodo"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "La cartella dei sorgenti SVN di Free Pascal (non richiesto). Questo migliora la ricerca delle dichiarazioni ed il debugging."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Cartella del progetto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
#, fuzzy
#| msgid "The Free Pascal SVN source directory."
msgid "The Free Pascal Git source directory."
msgstr "La cartella dei sorgenti SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Il percorso per il compilatore Free Pascal.%s Per esempio %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "Il percorso al compilatore Free Pascal per questo progetto. Richiesto unicamente se è stato settato il sorgente FPC SVN sottostante . Utilizzato per ricreare le macro."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Il percorso del compilatore Free Pascal per questo sorgente.%sUsato per autocreare le macro."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "La %s cartella del progetto,%sche contiene il file .dpr e dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Undefine"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Undefine a tutto"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Undefine ricorsivamente"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valore come path di file"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valore testo"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%sil valore \"%s\" non è valido."
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabile:"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Chiocciola"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parentesi"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Circonflesso (^)"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Duepunti"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Virgola"
#: lazarusidestrconsts.liscodetoolsoptscomment
#, fuzzy
msgctxt "lazarusidestrconsts.liscodetoolsoptscomment"
msgid "Comment"
msgstr "Commento:"
#: lazarusidestrconsts.liscodetoolsoptscommentansi
msgid "ANSI Comment: (*"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscommentbor
msgid "Curly Comment: {"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscommentslash
msgid "Slash Comment: //"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificatore"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgctxt "lazarusidestrconsts.liscodetoolsoptskeyword"
msgid "Keyword"
msgstr "Parola chiave"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "A capo"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Numero"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punto"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puntoevirgola"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spazio"
#: lazarusidestrconsts.liscodetoolsoptsstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Costante stringa"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Simbolo"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Esegui dopo"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Esegui prima"
#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr ""
#: lazarusidestrconsts.liscollapseall
#, fuzzy
#| msgid "Collapse All (/)"
msgid "Collapse All [Ctrl+Minus]"
msgstr "Comprimi Tutto(/)"
#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Comprimi tutte le classi"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Comprimi tutti i pacchetti"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Comprimi tutte le unit"
#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr ""
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parametri dalla linea di comando"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametri della riga di comando del programma"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compila"
#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr ""
#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr ""
#: lazarusidestrconsts.liscompilepackagetwiceandcheckifanyunitwascompiledaga
msgid "Compile package twice and check if any unit was compiled again."
msgstr ""
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Compila il progetto"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilatore"
#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr ""
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Il compilatore \"%s\" non supporta la destinazione %s-%s"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Errore: compilatore non valido: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nome file del compilatore"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Consiglio: imposta il percorso del compilatore in Strumenti-> Opzioni-> Files-> Percorso compilatore"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr "File di messaggi del compilatore non trovato:%s%s"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Nota: non è stato trovato il file configurazione codetools - uso valori predefiniti"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Nota: caricamento vecchio file opzioni codetools: "
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compila"
#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr ""
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
#, fuzzy
#| msgid "%s -> Compile with -vd for more details. Check for duplicates."
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "%s -> Compila con -vd per maggiori dettagli. Verifica che non vi siano duplicati."
#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (compilazione ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Mostra righe di consigli lunghe"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Estendi all'estrema sinistra"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Estendi un pò a sinistra"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Mai"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Estendi solo a destra"
#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "Il nome del componente \"%s\" è una parola chiave"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Vedere Tutto"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Apri pacchetto"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Apri unit"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr ""
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr ""
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condizione"
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Condizionali:"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Cartella della configurazione di Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "File di configurazione delle aggiunte:"
#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Configura la costruzione %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Configura \"Build Lazarus\""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Configura l'IDE di Lazarus"
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Confermare"
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Conferma"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus sarà ricostruito con i seguenti profili:%sContinuo?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Conferma i cambiamenti"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Conferma cancellazione"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Vuoi ricostruire Lazarus con il profilo: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Conferma il nuovo gruppo di pacchetti per la IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nuovo gruppo di pacchetti"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Vecchio gruppo di pacchetti"
#: lazarusidestrconsts.lisconfirmreplace
msgid "Confirm Replace"
msgstr ""
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Conflitto"
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Rilevato conflitto"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Applicazione console"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Un programma in Free Pascal a riga di comando, che usa TCustomApplication per agevolare la verifica delle opzioni da riga di comando, la gestione degli errori, ecc."
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Codice del costruttore"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contiene"
#: lazarusidestrconsts.liscontents
#, fuzzy
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Contenuti"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensibile al contesto"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continua e non chiedere più"
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continua senza caricare la form"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Contributors"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Il controllo necessita del genitore"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Aggiungi un commento dopo la sostituzione"
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr ""
#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Aggiungo il flag \"Registrare\"alla procedura nella unit %s"
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" manca nella funzione in sostituzione: %s"
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Parentesi non trovata"
#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr " { *Convertito da %s* }"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "E' stato aggiunto un offset alla coordinata Top nei contenitori visuali"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Offset delle coordinate"
#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr "Cancellato file %s"
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr "Aggiunte le definizioni %s nelle opzioni personalizzate"
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr "Aggiunto il Pacchetto %s alle dipendenze"
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "I file delle unit saranno cercati in tutte le sottocartelle"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools ha fallito!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Categorie:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr "Modificata codifica da %s a UTF-8"
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Conversione abortita."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversione pronta."
#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr "La conversione ha richiesto: %s"
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Converti pacchetto Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Converti progetto Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Converti unit Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Conversione dei files delle unit trovate nella conversione ***"
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Conversione dei files delle unità che appartengono al progetto/pacchetto ***"
#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr "Errore=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Si è verificato un errore nella conversione della unit. Continuo con i files delle form delle units già convertite..."
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Conversione di unit fallita"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr "Impossibile convertire la unit \"%s\""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Sistemato maiuscolo/minuscolo della unit \"%s\" in \"%s\"."
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Trovati tutti i files delle unit"
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Funzione Delphi"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) include file mancante"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nome Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Il nome del pacchetto esiste già"
#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Il pacchetto %s è richiesto ma non è installato in Lazarus. Installarlo in seguito."
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr "Unit %s omessa dal progetto"
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Aggiusto unit usate e riparo i file dei form ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Sostituita unit \"%s\" con \"%s\" nella sezione uses."
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "C'è già un pacchetto di nome\"%s\"%sPer favore chiudere questo pacchetto prima."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Il nome della unit esiste già in LCL"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr "Unit da sostituire in %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL ha già una unit con nome %s. Cancellare il file locale %s?"
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "Il file .dproj non è ancora supportato. Il file è usato da Delphi 2007 in poi. Selezionare un file .dpr per i progetti o un file .dpk per i pacchetti."
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Errore di conversione"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Converti"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Converti codifica"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Converti codifica dei progetti/pacchetti"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Altre opzioni riguardanti la conversione"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Converti progetto o pacchetto"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Destinazione"
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Multi-piattaforma"
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Multi-piattaforma invece di solo-Windows"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "La conversione aggiunge compilazione condizionale per supportare diverse piattaforme destinazione"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Usare lo stesso file DFM per la form"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Stesso file DFM per Lazarus e Delphi invece di copiarlo in LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Supporto per Delphi"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Usare compilazione condizionata per supportare Delphi"
#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr "Corretto il nome della unit da %s a %s"
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Sostituzione di funzione"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Alcune funzioni Delphi si possono sostituire con funzioni LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funzioni / procedure da sostituire"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Offset sinistro"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nuovo nome"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Container padre"
#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr "Problemi nel cercare di trovare tutte le unità del file di progetto %s"
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr "Problemi nel correggere i file inclusi dal file %s"
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr "Problemi nel riparare il file della form %s"
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Riparazione dei file inclusi:"
#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr "Sostituire la call %s con %s"
#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Il numero di parametri da sostituire nella funzione dovrebbe essere >= 1: %s"
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr "\"$\" dovrebbe essere seguito da un numero: %s"
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Fermato, perché c'è già un pacchetto con lo stesso nome"
#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr "Questo log è stato salvato in %s"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Offset Top"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Sostituzione di tipo"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Tipo sconosciuto in file del form (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Tipi da sostituire"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Sostituzione unit"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Nomi di unit nella sezione uses del sorgente di una unit"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unit da sostituire"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Proprietà sconosciute"
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr "L'utente ha deciso di terminare la conversione con il file %s"
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Singolo"
#: lazarusidestrconsts.liscoolbarcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Browser del codice"
#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Modelli di codice"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr ""
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Doppio"
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem5
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Bottone"
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""
#: lazarusidestrconsts.liscoolbarmessages
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourceeditor
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Sorgente editor"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr ""
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Copia tutte le voci negli appunti"
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Copiare i messaggi (Tutti/Originali) negli appunti"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copia tutti i messaggi mostrati negli appunti"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copia la descrizione negli appunti"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Errore di copia"
#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr "Copia nome del file %s"
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Copia il nome del file negli appunti"
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr ""
#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr "Copia \"%s\" negli appunti"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "La copia di una form intera non è stata implementata."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Copia voce negli appunti"
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Copia/Sposta il file nella Cartella"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Copia le voci selezionate negli appunti"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Copia i messaggi selezionati negli appunti"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Cerca i messaggi FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Cerca i messaggi Make"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Salta la chiamata al compilatore"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Attenzione: il file aggiuntivo di configurazione del compilatore ha lo stesso nome di un file di configurazione standard del compilatore Free Pascal. Verrà letto SOLO il file di configurazione aggiuntivo e non quello standard."
#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Apri il pacchetto %s"
#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Apri la unit %s"
#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ", CPU: %s"
#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Crea prima un progetto!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Creare cartella?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Crea un Filtro"
#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Crea funzione"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Crea nodo di aiuto"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Crealo"
#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr "Crea la variabile locale \"%s\""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Crea una nuova aggiunta"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Crea un nuovo pacchetto)"
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Crea un nuovo pacchetto componente"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Crea progetto"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Crea/aggiorna file .po quando si salva un file .lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr "Creazione del file indice %s dei sorgenti FPC..."
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Scegli la cartella"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Valori cartella CodeTool"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definisci modelli"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nessuna variabile selezionata>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Apri anteprima"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Strumenti"
#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Variabile: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nome variabile"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modelli"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Aggiorna le firme di tutti i metodi"
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Aggiorna le firme multiple delle procedure"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "prego selezionare una macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Seleziona la Code Macro"
#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Widgetset LCL corrente: \"%s\""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Stato corrente:"
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Colonna cursore nell'editor corrente"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Riga cursore nell'editor corrente"
#: lazarusidestrconsts.liscustomopthint
#, fuzzy
#| msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Queste opzioni sono passate al compilatore dopo aver eliminato i commenti ed espanso le macro."
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "opzioni personalizzate"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opzioni personalizzate"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programma personalizzato"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Un programma Free Pascal personalizzato."
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Modulo dati"
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Elaborazione dei breakpoint"
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Breakpoint raggiunto"
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Messaggio del breakpoint"
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Stack al breakpoint"
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Colore predefinito"
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Errore sollevato"
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Carica Modulo"
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Scarica Modulo"
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Output Debug String"
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Uscita dal Processo"
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Avvio del Processo"
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Uscita dalla thread"
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Avvio della thread"
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Messaggio Windows appeso"
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Messaggio Windows spedito"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Non è stato specificato nessun debugger"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Imposta comunque un breakpoint"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Non è stato specificato un debugger.%sIl settaggio dei breakpoint non avrà effetto finché non scegli un Debugger nella dialog delle opzioni di debugger nel menu."
#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr ""
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format, fuzzy, badformat
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Errore del debugger%sOoops, il debugger è entrato in stato di errore%sSalvate subito il vostro lavoro!%sPremere stop e sperare..."
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger non valido"
#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (debug ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Typecast automatico degli oggetti"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Aggiungi eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Percorso di ricerca opzionale"
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Punto di interruzione"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Pulisci il log all'esecuzione"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opzioni generali del debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opzioni specifiche del debugger (dipendono dal tipo di debugger)"
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Nome di eccezione duplicato"
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Immetti il nome dell'eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Log degli eventi"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Modificato da"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Modificato dal Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Modificato dal Programma"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignora questa eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Eccezioni del linguaggio"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Limita il conteggio righe a"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modulo"
#: lazarusidestrconsts.lisdebugoptionsfrmname
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
#, fuzzy
#| msgid "Notify on Lazarus Exceptions"
msgid "Notify on Exceptions"
msgstr "Notifica le eccezioni di Lazarus"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Eccezioni del Sistema Operativo"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Output"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processo"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Azzerare il debugger dopo ogni esecuzione"
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Mostra messaggio alla fine"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Segno"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Usare i colori nel log degli eventi"
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Windows"
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Impossibile caricare il file"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "Impossibile caricare il file \"%s\"."
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Predefinito"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "Il predefinito è ComboBox con selezione \"Vero\" e \"Falso\""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(predefinito)"
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Ritarda per righe di consigli lunghe nel box di completamento"
#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr ""
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Cancellare?"
#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr "Cancellare l'aggiunta \"%s\"?"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Cancella tutto"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Cancellare tutti questi files?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Cancellare file ambiguo?"
#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "Cancella macro \"%s\""
#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Cancela modo \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "Cancellare il vecchio file \"%s\"?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Cancellare la macro selezionata?"
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Cancellare questa aggiunta"
#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr "Cancella valore \"%s\""
#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr "Cancella valore %s"
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Delimitatore punto e virgola."
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Risorse compatibili con Delphi. Raccomandato."
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
#, fuzzy
#| msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "I pacchetti \"Design time\" aggiungono componenti e voci di menu all'IDE. Possono essere usati dai progetti, ma non vengono compilati nei progetti. Il compilatore non troverà le units di questo pacchetto durante la compilazione del progetto."
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cartella di destinazione"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Codice del distruttore"
#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Insensibile alle maiuscole/minuscole"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "File1"
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "File2"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignora l'aggiunta o la rimozione di righe vuote"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignora differenze nei fineriga (cioè #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignora il numero dei caratteri spazio"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignora gli spazi (caratteri di avanzamento riga non inclusi)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignora spazi alla fine delle righe"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignora spazi all'inizio delle righe"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Solo selezione"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Apri Diff nell'editor"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr "una unit differente %s trovata alla nuova posizione \"%s\""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direttive"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Direttive per una nuova unit"
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Cartelle"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Cartella:"
#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr "Cartella \"%s\" non trovata."
#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr "cartella %s non trovata"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "La cartella dove l'IDE salva i file .po"
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Disabilita I18N per LFM"
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Disabilitare opzione -Xg?"
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Disabilitare opzione -Xg"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Annulla modifiche"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Annulla tutte le modifiche"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Scartare le modifiche e aprire il progetto"
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Scartare le modifiche e abbandonare"
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Scartare le modifiche e creare un nuovo progetto"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Fai clic su di una delle voci sopra per vedere il risultato di un diff"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Errore nella lettura file: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Alcuni file su disco sono cambiati:"
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr ""
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Distingui tra lettere maiuscole e minuscole per es. tra A e a"
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Tutte le opzioni ..."
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Cambiare classe ..."
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Definizioni ..."
#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Modifica ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Esporta ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importare ..."
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Apri ..."
#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s non esiste: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Non modificare"
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "Do not check if another IDE instance is already running."
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Non chiudere il progetto"
#: lazarusidestrconsts.lisdonotcompiledependencies
#, fuzzy
#| msgid "do not compile dependencies"
msgid "Do not compile dependencies."
msgstr "Non compilare le dipendenze"
#: lazarusidestrconsts.lisdonotshowsplashscreen
#, fuzzy
#| msgid "Do not show splash screen"
msgid "Do not show splash screen."
msgstr "Non mostrare lo splash screen"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Non mostrare questa dialog per questo progetto"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Non mostrare più questo messaggio"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""
#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Giù"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Retrocedere"
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Retrocedere la configurazione"
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Volete ancora creare il nuovo progetto?"
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Volete ancora aprire un altro progetto?"
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Volete ancora abbandonare?"
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Disegna linee griglia"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
#, fuzzy
#| msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Disegnare come se avesse il fuoco, anche se la finestra non ha il fuoco. Usare se il disegno del vostro tema è poco visibile quando non ha il fuoco."
#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr ""
#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copia i componenti selezionati negli appunti"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Taglia i componenti selezionati negli appunti"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Sposta il componente indietro di uno"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Sposta il componente avanti di uno"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Sposta indietro il componente"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Sposta il componente in primo piano"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Incolla componenti selezionati dagli appunti"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Seleziona componente genitore"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr ""
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr ""
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Duplicato"
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Voce duplicata"
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Nome file duplicato"
#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr "Trovato duplicato del valore \"%s\"."
#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr ""
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Nome duplicato"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Nome duplicato: Esiste già un componente chiamato \"%s\" nel componente ereditato %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Files ppu duplicate. Cancellarne una, o assicurarsi che tutti i percorsi di ricerca abbiano l'ordine corretto (attenzione: FPC usa per primo l'ultimo percorso)"
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Path di ricerca duplicato"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Files sorgenti duplicate. Cancellarne una, o assicurarsi che tutti i percorsi di ricerca abbiano l'ordine corretto (attenzione: FPC usa per primo l'ultimo percorso)"
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Unit duplicata"
#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Modifica"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Edita l'aiuto supplementare per i messaggi"
#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Edita aiuto contestuale"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Editare l'aiuto"
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Tasto di edit"
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Colori dell'editor"
#: lazarusidestrconsts.liseditormacros
#, fuzzy
#| msgid "Editor macros"
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr "Macro dell'editor"
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Caricare uno schema"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Progetto corrente"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Per creare uno strumento serve almeno un titolo e un nome file."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Modifica strumenti"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Tasto"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macro"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametri:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nome del programma:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Ricerca nel risultato di messaggi del compilatore Free Pascal"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Ricerca nel risultato di messaggi di make"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Sono richiesti un titolo ed un nome file"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Cartella di lavoro:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Tutto"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Metodi vuoti"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Trovati Metodi vuoti:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Manca classe"
#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr "Manca classe a %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Solamente pubblicato"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Pubblico"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Pubblicato"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Rimuovi i metodi"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Cercare in quete sezioni di Class:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Impossibile mostrare i metodi vuoti della classe corrente, perché%s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vuoto"
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr ""
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Abilitato solo per i pacchetti."
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Abilitare il flag \"Use Unit\" della unit %s nel pacchetto %s"
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Abilitare I18N per LFM"
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Abilita supporto a internazionalizzazione e traduzione"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Abilita le macro"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr ""
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
#, fuzzy
#| msgid "Enable = replace whole identifier, Disable = replace prefix"
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Abilita = sostituire l'intero identificatore, Disabilita = sostituire il prefisso"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Racchiudere in $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr "Numero di files falliti nella conversione: %d"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "La codifica del file \"%s\"%ssu disco è %s. La nuova codifica è %s."
#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr "Introdurre nuovo nome per la Macro \"%s\""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variabile ambiente, nome come parametro"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nome file del debugger non valido"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "Il file del debugger \"%s\" non è un eseguibile."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Cartella di test \"%s\" non trovata."
#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Opzione non valida a posizione %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "L'opzione alla posizione %d non permette un argomento: %s"
#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "L'opzione alla posizione %d richiede un argomento: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Errore: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Errore nella creazione del file"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Errore durante la cancellazione del file"
#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Errore in %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Errore nel nome file del compilatore:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Errore nelle opzioni personalizzate (Altro):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
#, fuzzy
#| msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Errore nelle opzioni personalizzate del linker (Linking / Passare opzioni al linker):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Errore in \"Debugger path addition\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Errore nel percorso di ricerca per \"Include files\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Errore nel percorso di ricerca per \"Librerie\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Errore nel percorso di ricerca per \"Files oggetto\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Errore nel percorso di ricerca per \"Altri sorgenti\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Errore nel percorso di ricerca per \"Altri files di unit\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Errore in \"cartella di uscita delle unit\":"
#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format, fuzzy
#| msgid "ERROR: invalid build mode \"%s\""
msgid "Error: invalid build mode \"%s\""
msgstr "ERRORE: modo di build non valido \"%s\""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Errore nel caricamento del file"
#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr "Errore caricando il file \"%s\":"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Errore nello spostamento del componente"
#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Errore nello spostamento del componente %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Errore nel dare un nome al componente"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Errore nell'apertura della componente"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Errore nell'elaborazione dello stream componente lfm."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Errore nella lettura dell'elenco pacchetti dal file%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Errore nella lettura XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Errore nella lettura del file XML \"%s\"%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Errore durante la rinomina file"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Errori"
#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", Errori: %s"
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr "Errore nell'impostare il nome del componente %s in %s"
#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr "Errore di scrittura file \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Errore nella scrittura dell'elenco pacchetti sul file%s%s%s%s"
#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number"
msgid "Show every n-th line number"
msgstr "Ogni N numeri di riga:"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "File di esempio:"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Esempi:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#Packagename.UnitName.Identifier"
#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr ""
#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr "%s escluso in esecuzione"
#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr ""
#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr "l'eseguibile \"%s\" è una cartella"
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr "l'eseguibile \"%s\" non ha i permessi di esecuzione"
#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr ""
#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr ""
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Esecuzione bloccata"
#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr ""
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Esci"
#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr "Codice di uscita %s"
#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr ""
#: lazarusidestrconsts.lisexpandall
#, fuzzy
#| msgid "Expand All (*)"
msgid "Expand All [Ctrl+Plus]"
msgstr "Espandere tutto(*)"
#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Espandi tutte le classi"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Espandi tutti i pacchetti"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Espandi tutte le unit"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nome file espanso del file dell'editor corrente"
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Esporta"
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr ""
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Esporta tutte le voci nel file"
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Esportare come HTML"
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr ""
#: lazarusidestrconsts.lisexportpackagelistxml
#, fuzzy
#| msgid "Export package list (*.xml)"
msgid "Export package list"
msgstr "Esportare la lista dei pacchetti (*.xml)"
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr ""
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Estrai"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Estrai procedura"
#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr ""
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Estremamente prolisso"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Strumenti esterni"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Raggiunto il massimo degli strumenti"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "C'è un massimo di %s strumenti."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr "Impossibile aggiungere %d risorse: non uniche"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Non posso creare l'Application bundle per \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Caricamento stato di collassatura fallito"
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "risoluzione delle macro fallita"
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Salvataggio file fallito."
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Fatale"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "File"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "File: "
#: lazarusidestrconsts.lisfilealreadyexists
#, object-pascal-format
msgid "File \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Estensione dei file di programma"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtro dei file"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Filtri file"
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Aggiungere Riga"
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Cancellare Riga"
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Inserire Riga"
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Maschera file"
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Imposta i valori predefiniti"
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Questi sono i filtri che appariranno in tutti i dialoghi di Apri File"
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr "Il file \"%s\" è cambiato. Salvarlo?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Il file non ha un progetto"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Il file è una cartella"
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Il file non è un eseguibile"
#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "Il file \"%s\" è virtuale."
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Stile dei nomi di file"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "File non trovato"
#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr "file %s non trovato"
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "file non trovato"
#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr "File non trovato:%s%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "File \"%s\" non trovato.%sVuoi crearlo?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "File non minuscolo"
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Impostazioni file"
#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr "Il file %s ha una sintassi non corretta."
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Files: %s, ha una procedura Register: %s, nella sezione \"uses\" del pacchetto: %s"
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Tutti i files trovati hanno già la codifica corretta ***"
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Files in codifica ASCII o UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format, fuzzy
#| msgid "File %s is converted to text format."
msgid "File %s was converted to text format."
msgstr "Il file %s viene convertito in formato testo."
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "I file non hanno codifica ASCII né UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgid "File where debug output is written to. Default is write to the console."
msgstr "file, dove viene scritto l'output di debug. Se non specificato, l'output di debug viene scritto sulla console."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtro"
#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr "Filtro: %s"
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Filtrare tutti i messaggi di un certo tipo"
#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr "Filtrare tutti i messaggi di tipo %s"
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Il filtro esiste già"
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtrare messaggi di debug, e inferiori"
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtrare consigli e inferiori"
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Filtrare consigli senza posizione nel sorgente"
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Non filtrare nulla, non filtrare per urgenza"
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Filtra messaggi non urgenti"
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Filtrare Note e inferiori"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Gruppi di filtri"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Filtrare la lista delle opzioni disponibili"
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Filtrare messaggi Prolissi e inferiori"
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtrare Avvertimenti e inferiori"
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Trova ..."
#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Trova dichiarazione di %s"
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "C&artella"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Maschera Fi&le"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Includi sottocartella"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Pattern &multiriga"
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
#, fuzzy
#| msgid "search all files in &project"
msgid "all files in &project"
msgstr "ricercare tutti i file nel &progetto"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
#, fuzzy
#| msgid "search all &open files"
msgid "all &open files"
msgstr "ricercare tutti i file &aperti"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
#, fuzzy
#| msgid "search in &active file"
msgid "&active file"
msgstr "ricercare nei file &attivi"
#: lazarusidestrconsts.lisfindfilesearchindirectories
#, fuzzy
#| msgid "search in &directories"
msgid "&directories"
msgstr "ricercare in &cartelle"
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "project &group"
msgstr ""
#: lazarusidestrconsts.lisfindfilewhere
#, fuzzy
#| msgid "Where"
msgid "Search location"
msgstr "Dove"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Trova combinazione di tasti"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Trova unit mancante"
#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr ""
#: lazarusidestrconsts.lisfindoverridestoo
msgid "Find overrides too"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Primo"
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Ripara file LFM"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Fuoco sui consigli"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forza rinomina"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
#, fuzzy
#| msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Per esempio mostrare in cima le variabili locali, poi i membri della classe corrente, poi gli antenati, poi l'unità corrente poi le unità usate"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Form"
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Errore di formato"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr ""
#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr "Trovata versione %s, attesa %s"
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Versione FPC come un solo numero (p.es. 20701)"
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "File messaggi FPC:"
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Messaggi FPC: Appendice"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Risorse FPC (.res)"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Sorgenti FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC troppo vecchio"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Versione FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Versione FPC (es. 2.2.4)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr "Errore nella scrittura di \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Errore di sintassi FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Nome pacchetto FPDoc:"
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Nome pacchetto FPDoc. Il valore predefinito è il nome del file del progetto."
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "C'è un errore di sintassi nell'elemento FPDoc \"%s\":%s%s"
#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr ""
#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr ""
#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr ""
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr ""
#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr ""
#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr ""
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Frame"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Ricerca indietro"
#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr "libero %s righe di buffer"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Messaggi del compilatore Free Pascal"
#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Cartella sorgente del Freepascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Ricerca avanti"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "File aggiuntivi da cercare (cioè /percorso/*.pas;/percorso2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Trova o rinomina identificatore"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Trova i riferimenti"
#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Identificatore: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "in tutti i pacchetti e i progetti aperti"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "nella unit corrente"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "nel progetto principale"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "nel progetto/pacchetto a cui appartiene la unit corrente"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificatore non valido"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Rinomina tutti i riferimenti"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr ""
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Cerca anche nei commenti"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Completo"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Funzione"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Generale"
#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr ""
#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr ""
#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "prendi la parola alla posizione attuale del cursore"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Impostazioni globali"
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Salta alla riga"
#: lazarusidestrconsts.lisgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
#| "\n"
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<descrizione>\n"
"\n"
"Copyright (C) <anno><nome dell'autore><contatto>\n"
"\n"
"Questo sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva. \n"
"\n"
"Queso codice è distribuito con la speranza che vi sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. \n"
"\n"
"Una copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Gruppo"
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
#, fuzzy
#| msgid "Enable or Disable groups of debug output. Valid Options are:"
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr "Abilita o disabilita i gruppi di uscita del debug. Le opzioni valide sono:"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Cresci fino al più grande"
#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr ""
#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr ""
#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Ha aiuto"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Intestazione commento per classe"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Voci di aiuto"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Selettore di aiuto"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Aiuto su un messaggio del Compilatore FreePascal"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Nascondi tutti i consigli e gli avvisi inserendo la direttiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Nascondi i messaggi a %s inserendo la direttiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Nascondi i messaggi inserendo la direttiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Nascondi la ricerca"
#: lazarusidestrconsts.lishidewindow
#, fuzzy
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Nascondi la finestra"
#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr "Nascondi con l'opzione di pacchetto (-vm%s)"
#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr "Nascondi con l'opzione di progetto (-vm%s)"
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Consiglio"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Consiglio: un valore predefinito può essere assegnato nei condizionali."
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Un consiglio sul nome della proprietà ne mostra la descrizione."
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Consiglio: Controlla se due pacchetti contengono una unit con lo stesso nome."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr ""
#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ", suggerimenti: %s"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Consiglio: la funzione \"Make Resourcestring\" vuole una stringa costante.%sSelezionare l'espressione e riprovare."
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Vista form"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Vista unit"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Database"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opzioni aiuto"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Proprietà:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualizzatori"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Percorso di FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Orizzontale"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Linee orizzontali fra le proprietà."
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr ""
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Opzioni di build dell'IDE"
#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr ""
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "L'IDE viene ricompilata e fatta ripartire per l'installazione/disinstallazione di pacchetti."
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format, fuzzy
#| msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Benvenuti in Lazarus.%0:sLa configuration dell'IDE trovata era usata da un'altra installazione di Lazarus.%0:sSe avete due o più installazioni diverse di Lazarus, non dovrebbero condividere la stessa configurazione. Questo può indurre conflitti, e la vostra installazione di Lazarus può divenire inutilizzabile.%0:s%0:sSe avete una sola installazione e avete copiato o spostato l'eseguibile di Lazarus, potete aggiornare questa configurazione.%0:s%1:s%0:s%0:sScegliere:%0:s%0:s* Aggiornare: Usare questa configurazione aggiornandola per usarla con questo Lazarus anche in futuro. La vecchia installazione non l'userà più.%0:s* Ignorare: Usare questa configurazione, ma mantenere l'avviso. Questo può indurre conflitti con l'altra installazione.%0:s* Abortire: Terminare ora. Potete così risolvere il problema avviando questo Lazarus con la giusta configurazione.%0:s%0:sUlteriori informazioni:%0:sQuesta configurazione si trova in: %2:s%0:sAppartiene all'installazione di Lazarus in: %3:s%0:sQuesta IDE è stata avviata da: %4:s%0:s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informazioni sull'IDE"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Macro IDE"
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr ""
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "L'IDE gestisce il titolo nella unit principale."
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificatore"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "L'identificatore comincia con ..."
#: lazarusidestrconsts.lisidentifiercannotbedotted
#, object-pascal-format
msgid "Identifier \"%s\" cannot be dotted"
msgstr ""
#: lazarusidestrconsts.lisidentifiercannotbeempty
msgid "Identifier cannot be empty"
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "L'identificatore contiene ..."
#: lazarusidestrconsts.lisidentifierisalreadyused
#, object-pascal-format
msgid "Identifier \"%s\" is already used"
msgstr ""
#: lazarusidestrconsts.lisidentifierisalreadyused2
#, object-pascal-format
msgid "Identifier \"%s\" is already used."
msgstr ""
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerfunction
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler function."
msgstr ""
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerprocedure
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler procedure."
msgstr ""
#: lazarusidestrconsts.lisidentifierisinvalid
#, object-pascal-format
msgid "Identifier \"%s\" is invalid"
msgstr ""
#: lazarusidestrconsts.lisidentifierisreservedword
#, object-pascal-format
msgid "Identifier \"%s\" is a reserved word"
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opzioni IDE:"
#: lazarusidestrconsts.lisidetitlecustom
msgid "Custom IDE title"
msgstr ""
#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
#, fuzzy
#| msgid "IDE title starts with project name"
msgid "Show custom IDE title before built-in IDE title or info"
msgstr "Il titolo dell'IDE inizia con il nome del progetto"
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Tutti i modi di costruzione"
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Opzioni compilatore di"
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Modo di costruzione corrente"
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Errore nell'aprire XML"
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Errore nell'aprire il file XML \"%s\":%s%s"
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Esportare le opzioni del compilatore"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Il file di esportazione già esiste"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Il file di esportazione \"%s\" esiste già.%sAprire il file e sostituire solo le opzioni del compilatore?%s(le altre saranno mantenute.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importare le opzioni del compilatore"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Carica dal file"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr "Il file \"%s\" non contiene le opzioni del compilatore."
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Salva nel file"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Se non controllato:"
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Se sono cambiate solo i dati sulla sessione, chiedi prima di salvarli."
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Se volete usare due versioni diverse di Lazarus, dovete avviare la seconda da riga di comando, con il parametro \"primary-config-path\" o \"pcp\".%sPer esempio:"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignora tutto"
#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Imita l'indentazione della unit, progetto o pacchetto corrente"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Commento all'implementazione per classe"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importare"
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Importante"
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr ""
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importare da file"
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr ""
#: lazarusidestrconsts.lisimportpackagelistxml
#, fuzzy
#| msgid "Import package list (*.xml)"
msgid "Import package list"
msgstr "Importare la lista di pacchetti (*.xml)"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossibile"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr "In una cartella dei sorgenti del pacchetto \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "In una cartella dei sorgenti del progetto. Verificare duplicati."
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "percorso di inclusione"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Includi i percorsi"
#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr ""
#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ", ppu=%s incompatibile"
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Riscontrata cartella di configurazione non valida"
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Indentazione per sorgenti pascal"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informazione"
#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Informazioni su %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informazioni sull'FPC usato"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "Nel percorso di ricerca delle unit di FPC. Probabilmente installata dal pacchetto FPC. Verificare che il compilatore e il file ppu provengano dalla stessa installazione."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Di fronte al relativo"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Oggetto ereditato"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Parametri ereditati"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Componenti del progetto ereditati"
#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr ""
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Per poter creare una copia pulita del progetto/pacchetto, tutti i file nella seguente cartella saranno cancellati e il loro contenuto sarà perso.%sCancella tutti i file in \"%s\"?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Inserisci"
#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Inserisci la data"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Inserisci data e ora"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
#, fuzzy
#| msgid "Insert date and time. Optional: format string"
msgid "Insert date and time. Optional: format string."
msgstr "Inserisci data e ora. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
#, fuzzy
#| msgid "Insert date. Optional: format string"
msgid "Insert date. Optional: format string."
msgstr "Inserisci la data. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Inserisci end se serve"
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Inserisci Macro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
#, fuzzy
#| msgid "Insert name of current procedure"
msgid "Insert name of current procedure."
msgstr "Inserisci il nome della procedura corrente"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Inserisci tag PrintShort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "inserisci testa della procedura"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "inserisci il nome della procedura"
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "inserisci l'ora"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
#, fuzzy
#| msgid "Insert time. Optional: format string"
msgid "Insert time. Optional: format string."
msgstr "Inserisci l'ora. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Inserisci tag URL"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "In sessione"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "installato"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Installalo, mi piace il grasso"
#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installa selezione"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Installa/Disinstalla pacchetti"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
#, fuzzy
#| msgid "Instead of compile package create a simple Makefile."
msgid "Instead of compiling a package create a simple Makefile."
msgstr "Invce di compilare il pacchetto creare un semplice Makefile."
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interattivo"
#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr "errore interno: %s"
#: lazarusidestrconsts.lisinvaliddeclaration
msgid "Invalid Declaration"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Cancellazione non valida"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr ""
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Espressione non valida.%sConsiglio: la funzione \"Make Resourcestring\" vuole una stringa costante in un file singolo. Selezionare l'espressione e riprovare."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr ""
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtro non valido"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr "Riga non valida, colonna nel messaggio%s%s"
#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr "Macro non valide in \"%s\""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Macro non valide \"%s\" negli strumenti esterni \"%s\""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Macro non valida \"%s\". Il nome della macro deve essere un identificatore Pascal."
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Nome macro non valida \"%s\". È una parola chiave."
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Maschera non valida"
#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr "Modo %s non valido"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Multiselezione non valida"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificatore Pascal non valido"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr ""
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Nome proc non valido"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nome di file del progetto non valido"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Cartella di pubblicazione non valida"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Selezione non valida"
#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "versione non valida in %s"
#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s fa già parte del progetto."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" non è un nome progetto valido.%sScegliere un altro nome (es. progetto1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s è un %s.%sQuesta dipendenza circolare non è permessa."
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "cartella non trovata"
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Problemi"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr "Mi chiedo come hai fatto. Errore nel %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Mi chiedo come hai fatto: errore nella cartella base:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Storico dei salti"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr ""
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr ""
#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Salta alla procedura %s"
#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr "%s KB"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Conservare"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Tieni i file convertiti aperti nell'editor"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Tutti i file di progetto saranno aperti nell'editor dopo la conversione"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Mantieni il nome"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr ""
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
#, fuzzy
#| msgid "Keep relative indentation of multi line template"
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr "Conservare le rientranze relative del modello a più righe"
#: lazarusidestrconsts.liskeepsubindentation
#, fuzzy
#| msgid "Keep indentation"
msgid "Absolute indentation"
msgstr "Conservare rientranze"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ignora e continua"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Tasto"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Comandi personalizzati"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Comandi di progettazione"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Comando dell'Analizzatore Oggetti"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Tasto (o sequenza di 2 tasti)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Interrompi building"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Aggiungere un Breakpoint su indirizzo"
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Aggiungere un Breakpoint sul sorgente"
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Aggiungere un punto di osservazione sui dati"
#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Aggiungi watch"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Costruire più modi"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Costruisci l progetto/programma"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Scegli schema di mappatura tasti"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Classico"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Ripulire e costruire"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Chiudi il progetto"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor dei define per CodeTool"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Compilare progetto/programma"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Configura \"Build File\""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Configura componenti personali"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Aiuto relativo al contesto"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Converti un progetto Delphi in progetto Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Converti unit Delphi in unit Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Converti file DFM in LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
#, fuzzy
#| msgid "Copy selected Components to clipboard"
msgid "Copy selected components"
msgstr "Copia il Componente selezionato negli Appunti"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
#, fuzzy
#| msgid "Cut selected Components to clipboard"
msgid "Cut selected components"
msgstr "Taglia i Componebti selezionati negli Appunti"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Cancella l'ultimo carattere"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "File dell'editor Diff "
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Edita modelli di codice"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Edita aiuto sensibile al contesto"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Includi la selezione"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Valuta/Modifica"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Impostazioni Strumenti esterni"
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Trova incrementale"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Analizza"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schema della tastiera"
#: lazarusidestrconsts.liskmlazarusdefault
#, fuzzy
#| msgid "Lazarus (default)"
msgid "Lazarus default"
msgstr "Lazarus (predefinito)"
#: lazarusidestrconsts.liskmmacosxapple
#, fuzzy
#| msgid "Mac OS X (Apple style)"
msgid "macOS, Apple style"
msgstr "Mac OS X (stile Apple)"
#: lazarusidestrconsts.liskmmacosxlaz
#, fuzzy
#| msgid "Mac OS X (Lazarus style)"
msgid "macOS, Lazarus style"
msgstr "Mac OS X (stile Lazarus)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nuovo pacchetto"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nuovo progetto"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nuovo progetto da file"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nuova Unit"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nota: tutti i tasti saranno settati al valore dello schema scelto"
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Apri un pacchetto"
#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr ""
#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr ""
#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr ""
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "Incolla Componente dagli appunti"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Metti in pausa il programma"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Pubblica il progetto"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilazione veloce, niente linking"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Rimuovere il file attivo dal progetto"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Esegui programma"
#: lazarusidestrconsts.liskmsaveall
#, fuzzy
#| msgid "SaveAll"
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "SalvaTutto"
#: lazarusidestrconsts.liskmsaveas
#, fuzzy
#| msgid "SaveAs"
msgid "Save As"
msgstr "SalvaCome"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Salva progetto"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Salva progetto come"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Interrompi il programma"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Passa tra Unit e Form"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Vista assembler"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Vista breaskpoint"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Vista stack delle chiamate"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Commutare ls vista dell'Esploratore di Codice"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Inverti vista del browser di codice"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Commuta vista tavolozza dei componenti"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Mosta log eventi del debugger"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Mostra output del debugger"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Mostra/nascondi editor della documentazione"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Vedere lo storico"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Mostra/nascondi speed button dell'IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Mostra variabili locali"
#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Mostra/nascondi messaggi"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Mostra/nascondi Analizzatore oggetti"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
#, fuzzy
#| msgid "View Terminal Output"
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Vedere l'uscita su terminale"
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Mostra registri"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Mostra/nascondi risultati di ricerca"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Mostra/nascondi editor sorgente"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Vedere le threads"
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Mostra Osservazioni"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Mostra storico salti"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Mostra le opzioni del progetto"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Mostra il sorgente del progetto"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Mostra le informazioni sulla Unit"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Lancio applicazione fallito"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Esecuzione riga di comando di destinazione"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus predefiniti"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Cartella di Lazarus"
#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr ""
#: lazarusidestrconsts.lislazarusdiroverride
#, fuzzy
#| msgid "directory, to be used as a basedirectory"
msgid "Directory to be used as a basedirectory."
msgstr "cartella, da usare come cartella base"
#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "IDE Lazarus v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID della lingua di Lazarus (es.: en, de, br)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nome della lingua Lazarus (e.g. english, deutsch)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opzioni] <nomefile-progetto>"
#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Scegli la cartella di output dell'eseguibile dell'IDE"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "vuoi davvero cancellare questo profilo di costruzione?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Costruire Molti"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Impostazioni comuni"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Conferma prima di costruire"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Conferma la cancellazione"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "IDE di Debug"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Define"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Define senza -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Edita i define"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Edita la lista dei define che si possono usare da ogni profilo"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Errore nella scrittura del file"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild non è interattivo, sto terminando."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gestisci profili di costruzione"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gestisci i profili"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nome del profilo attivo"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Aggiungi nuovo profilo"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Le opzioni di costruzione attuali saranno associate a:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "IDE Normale"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "IDE ottimizzata"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opzioni:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Opzioni passate al compilatore"
#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Profilo da costruire"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Rinomina profilo"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nuovo nome per il profilo:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Rilancia l'IDE dopo averla costruita"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Rilancia automaticamente Lazarus dopo aver costruito l'IDE (non ha effetto se si costruiscono altre parti)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Seleziona profilo da costruire"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Chiedi conferma quando si costruisce direttamente dal menu Strumenti"
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Mostrare opzioni e definizioni per la riga di comando"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU di destinazione:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cartella di destinazione"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "SO di destinazione:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "Impossibile scrivere il file \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aggiorna revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Aggiorna informazioni di revisione nella dialog \"Informazioni su Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Pulisci e costruisci tutto"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Versione di Lazarus (p.es. 1.2.4)"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Tipo di widget LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Aggiungi link da ereditare"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copia dall'ereditato"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s non ha un percorso valido per FPDoc.%sImpossibile creare il file fpdoc per %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Muovi le voci a inherited"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Percorso FPDoc non valido"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "La unit %s non è parte di nessun pacchetto o progetto.%sAggiungere la unit a un pacchetto o a un progetto.%sImpossibile creare il file fpdoc."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Spazio del bordo sinistro. Questo valore viene aggiunto allo spazio bordo base, ed è usato per lo spazio a sinistra del controllo."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancoraggio a sinistra"
#: lazarusidestrconsts.lisleftgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Questo è il controllo compagno a cui il lato sinistro è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Lato sinistro"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Spazia a sinistra equidistante"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Meno"
#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Livelli"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "File LFM"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "Il file LFM contiene proprietà/classi sconosciute che non esistono in LCL. Possono essere o sostituite o eliminate."
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "File LFM danneggiato"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "File LFM funzionante"
#: lazarusidestrconsts.lislgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<descrizione>\n"
"\n"
"Copyright (C) <anno><nome dell'autore><contatto>\n"
"\n"
"Questo sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva. \n"
"\n"
"Queso codice è distribuito con la speranza che vi sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. \n"
"\n"
"Una copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "percorso libreria"
#: lazarusidestrconsts.lislibraryprogramdescriptor
#, fuzzy
#| msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr "Una libreria condivisa Free Pascal (.dll in Windows, .so in Linux, .dylib in MacOS X)."
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Link:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "opzioni compilatore"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Destinazione di link"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "elenco di tutti i valori CASE"
#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "Caricamento di %s fallito."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Caricare macro da"
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "stringa in minuscolo"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
#, fuzzy
#| msgid "Lowercase string given as parameter"
msgid "Lowercase string given as parameter."
msgstr "Stringa in minuscolo data come parametro"
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr ""
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk è scomparso dal disco. Uso in alternativa%s"
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk mancante"
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "File include di risorse di Lazarus (.lrs)"
#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr ""
#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr "Macro %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Inserire i dati"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Inserire i parametri di esecuzione"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "La sezione Uses della unit principale ha tutte le unità del progetto"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "La unit principale è sorgente Pascal"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Assumi che sia Pascal, anche se non termina con un suffisso .pas/.pp."
#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr ""
#: lazarusidestrconsts.lismakecurrent
#, fuzzy
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Corrente"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Crea l'eseguibile"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make non trovato"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Crea ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Aggiungi in fondo alla sezione"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "La resourcestring \"%s\" esiste già.%sScegliere un'altro nome.%sUsare Ignora per aggiungerlo comunque."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opzioni di conversione"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificatore personalizzato"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificatore"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Lunghezza identificatore:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefisso identificatore:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Inserisci in ordine alfabetico"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Inserisci in ordine di contesto"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Sezione Resourcestring non valida"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Scegliere una sezione resourcestring dalla lista."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "La resourcestring esiste già"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sezione resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Anteprima del sorgente"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Costante stringa nel sorgente"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Stringhe con lo stesso valore:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Gestire Editor sorgente ..."
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr ""
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Massimo numero di processi paralleli. 0 per il valore predefinito (%s("
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr "%s Forse dovete ricompilare il pacchetto"
#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr "%s MB"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Interrompi la costruzione"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Informazioni su FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Aggiungi &breakpoint"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Aggiungere il file attivo al pacchetto ..."
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Aggiungi punto di salto nello storico"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Aggiungi un file dell'editor al progetto"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Aggiungi &watch ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Spezza le righe nella selezione"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Costruisci il file"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Costruisci Lazarus con il profilo corrente"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Costruisci Lazarus con il profilo: %s"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Controlla file LFM nell'editor"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Pulisci cartella ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Ripulire e costruire ..."
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "&Chiudere file dell'editor"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Chiudi il progetto"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Editor dei define dei CodeTool ..."
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Commenta la selezione"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Paragonare files"
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completa codice"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr ""
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configura Costruisci+Lancia… "
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Configura componenti personalizzati ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Configura strumenti esterni ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configura \"Costruisci Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Aiuto sensibile al contesto"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Converti un progetto Delphi in progetto Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Converti unit Delphi in unit Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgid "Convert Binary DFM to LFM ..."
msgstr "Converti file DFM binario in LFM testuale + controllo sintattico..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Converti codifica dei progetti/pacchetti..."
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Finestre di debug"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Conversione Delphi"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Modifica"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Templates di codice ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Edita aiuto sensibile al contesto"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Installa/disinstalla pacchetti ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr ""
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteitem
#, fuzzy
#| msgid "Delete Item"
msgid "&Delete item"
msgstr "Cancella voce"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""
#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr ""
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Spostare voce selezionata in giù"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemup
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Spostare voce selezionata in su"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""
#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Racchiudere in $IFDEF ..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Racchiudi selezione ..."
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "&Valuta/modifica..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Estrai procedura ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&File"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Trova"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Trova..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Trova l'altro capo del blocco di codice"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Trova l'inizio del blocco di codice"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Trova dichiarazione al cursore"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Trova i riferimenti all'identificatore ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Trova &nei file ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Trova &successivo"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Trova &precedente"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Trova i riferimenti delle unit usate"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opzioni ..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Vai alla direttiva di include"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Vai alla linea ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Indovina IFDEF/ENDIF malposizionati"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Indovina blocco aperto"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Aiuto"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Meccanismi dell'IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Trova incrementale"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Indenta selezione"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Voce Changelog"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Inserire dalla mappa caratteri"
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Comando CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Data e ora correnti"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Inserire il nome del file completo ..."
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Inserimenti Generali"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Licenza GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Licenza GPL (Tradotta)"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Nota LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Licenza LGPL (tradotta)"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Licenza MIT"
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Licenza MIT (tradotta)"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Licenza LGPL modificata"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Licenza LGPL modificata (tradotta)"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Nome utente corrente"
#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Analizza ..."
#: lazarusidestrconsts.lismenujumpback
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Salta indietro"
#: lazarusidestrconsts.lismenujumpforward
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Salta avanti"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Salta a"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Salta a Implementation"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Salta al prossimo segnalibro"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Salta al prossimo errore"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Salta al precedente segnalibro"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Salta all'errore precedente"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr ""
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Selezione in minuscolo"
#: lazarusidestrconsts.lismenumacrolistview
#, fuzzy
#| msgid "Editor Macros ..."
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr "Editor delle macro ..."
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Crea stringa risorse ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr ""
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nuovo componente"
#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr ""
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nuova form"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nuovo ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Nuovo pacchetto ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nuovo progetto ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Nuovo progetto da file ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nuova unit"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Aiuto in linea"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Apri ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "A&pri nomefile al cursore"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr ""
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Apri pacchetto caricato ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Apri il file del pacchetto (.lp&k) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Apri pacchetto della unit corrente"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Apri pro&getto ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Apri &recenti ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Apri pacchetto recente ..."
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Apri progetto recente ..."
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr ""
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "&Pacchetto"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Grafo pacchetti"
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Link del pacchtto"
#: lazarusidestrconsts.lismenupastefromclipboard
#, fuzzy
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Incolla dagli Appunti "
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Nuovo componente del pacchetto"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "&Elenco procedure ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Progetto"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "&Analizzatore progetti"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "&Opzioni progetto ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Esegui"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "&Pubblica progetto ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "&Compilazione veloce"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Controllo veloce di sintassi"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Controllo veloce di sintassi OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "&Togli dal progetto ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Rinomina identificatore ..."
#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Segnalare un baco..."
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Rileggi la cartella dei sorgenti FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Inizializza debugger"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "&Ripristina"
#: lazarusidestrconsts.lismenurevertconfirm
#, object-pascal-format
msgid ""
"Discard all unsaved changes in\n"
"\"%s\"?\n"
"\n"
"This action cannot be undone and will affect all editor tabs with the file."
msgstr ""
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Esegui"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Esegui il file"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "&Parametri di esecuzione..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Step over to &Cursor"
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Esegui fino al &cursore"
#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr ""
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr ""
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Salva"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Salva &come ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Salva progetto"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Salva progetto come ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Cerca"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Seleziona"
#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Seleziona tutto"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Seleziona in blocco di codice"
#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Seleziona riga"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Seleziona paragrafo"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Seleziona in graffe"
#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Seleziona la parola"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Imposta un segnalibro libero"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "&Mostra punto di esecuzione"
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Ordina selezione ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "S&orgente"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Commuta maiuscolo/minuscolo nella selezione"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Trasforma tabulazioni nella selezione in spazi"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Informazioni"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Mostra/nascondi commenti"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "S&trumenti"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "De-commenta la selezione"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "De-indenta selezione"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Selezione in maiuscolo"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Aggiungi la unit alla sezione uses ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Visualizza"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "mostra editor àncore"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Browser del codice"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Ispettore del codice"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Tavolozza dei componenti"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componenti"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Log degli eventi"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Segnalazioni di debug"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Form..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Storico"
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Visualizza storico salti ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Variabili locali"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Analizzatore oggetti"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Vedere il sorgente del progetto"
#: lazarusidestrconsts.lismenuviewpseudoterminal
#, fuzzy
#| msgid "Terminal Output"
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Uscita sul terminale"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registri"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Registro delle restrizioni"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Risultati della ricerca"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor sorgente"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Ordine dei Tab"
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Thread"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Commuta vista form/unit"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Visualizza dipendenze unit"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Informazioni sulla unit ..."
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Unit..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Viste di watch"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Che cosa occorre costruire"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Finestre"
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Altre linguette"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor di messaggi"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Finestra Messaggi"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Metodo di classe non trovato"
#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr "manca cartella \"%s\""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eventi non trovati"
#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr "manca eseguibile \"%s\""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificatori non trovati"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Mancano pacchetti"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Potete scegliere fra:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Commenta via"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Solo per Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Commentare le unit selezionate"
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Usare le unit solo per Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Cercare le unit. I path trovati saranno aggiunti alle impostazioni di progetto."
#: lazarusidestrconsts.lismissingunitsinfo3
#, fuzzy
#| msgid "3) Abort now, install packages or fix paths and try again."
msgid "3) Leave these units in uses sections as they are."
msgstr "3) Abbandonare ora, installare pacchetto o correggere il percorso e riprovare."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Path di ricerca delle unit"
#: lazarusidestrconsts.lismissingunitsskip
#, fuzzy
#| msgid "Skip this Unit"
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr "Salta questa unit"
#: lazarusidestrconsts.lismitnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (c) <year> <copyright holders>\n"
#| "\n"
#| "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
#| "\n"
#| "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
#| "\n"
#| "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Aggiunte e Override"
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Aggiungere opzioni personali:"
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Inserire altre opzioni fpc, come -O1 -ghtl -dFlag"
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Applicare a tutti i pacchetti"
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Applicare a tutti i pacchetti e progetti"
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr "Applicare a tutti i pacchetti corrispondenti al nome \"%s\""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Applicare al progetto."
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Creare un nuovo gruppo di opzioni"
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Opzioni personalizzate"
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Cancellare le destinazioni o opzioni selezionate"
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Non aggiunge una opzione personalizzata:"
#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr "Non contiene la macro IDE %s:=%s"
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Non sostituisce OutDir (-FU)"
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr "Escludere tutti i pacchetti corrispondenti al nome \"%s\""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format, fuzzy
#| msgid "expected \":=\" after macro name, but found \"%s\""
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "dopo il nome della macro, atteso \":=\", ma trovato \"%s\""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format, fuzzy
#| msgid "expected macro name, but found \"%s\""
msgid "expected macro name but found \"%s\""
msgstr "atteso il nome della macro, ma trovato \"%s\""
#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr "Da %s a %s"
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "IDE Macro"
#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr "IDE Macro %s:=%s"
#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr "carattere non valido \"%s\" in %s"
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr "carattere non valido nel valore della macro \"%s\""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "nome macro mancante"
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Spostare voce selezionata in giù"
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Spostare voce selezionata in su"
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Nuovo Target"
#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr "Sostituire OutDir (-FU): %s"
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Sostituire cartella di uscita (-FU)"
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Sostituire cartella di uscita -FU del target"
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Rifai l'ultimo \"disfa\" in questa griglia"
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Imposta una IDE macro, p.es.: LCLWidgetType:=win32"
#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr "Assegna \"%s\""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Salvato nell'IDE (environmentoptions.xml)"
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Salvato nel progetto (.lpi)"
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Salvato nella sessione del progetto (.lps)"
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Target:"
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Disfa l'ultimo cambiamento in questa griglia"
#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr "Valore \"%s\""
#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr "(era \"%s\")"
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""
#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", Modalità: %s"
#: lazarusidestrconsts.lismodifiedlgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
#| "\n"
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<descrizione>\n"
"\n"
"Copyright (C) <anno><nome dell'autore><contatto>\n"
"\n"
"Questo sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva con le seguenti modifiche:\n"
"\n"
"Come eccezione speciale, i detentori del copyright di questa libreria vi accordano il permesso di linkare questa libreria con moduli indipendenti per produrre un eseguibile, a prescindere dai termini di licenza dei suddetti moduli indipendenti, e di copiare e distribuire l'eseguibile prodotto sotto una licenza di vostra scelta, posto che essa soddisfi, per ciascun modulo indipendente linkato, i termini e condizioni della licenza di quel modulo. Un modulo indipendente è un modulo che non è derivato da o basato su questa libreria.Se modificate questa libreria, potete estendere questa eccezione alla vostra versione della libreria, ma non siete obbligati a farlo. Se non volete farlo, cancellate questa dichiarazione di eccezione dalla vostra versione.\n"
"\n"
"Questo codice è distribuito con la speranza che sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. \n"
"\n"
"Una copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Altro"
#: lazarusidestrconsts.lismoresub
#, fuzzy
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Altro"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Sposta"
#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr ""
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Sposta file"
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Spostare file?"
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Spostare %s file da %s alla cartella%s%s%sdi %s?"
#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Sposta \"%s\" una posizione più giù"
#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Sposta \"%s\" una posizione più su"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Spostare o copiare i file?"
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Spostare o copiare %s file da %s alla cartella%s%s%sdi %s?"
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Spostare pagina ..."
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Sposta in giù la voce scelta (Ctrl+Freccia giù)"
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Sposta in su la voce scelta (Ctrl+Freccia su)"
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Sposta in: "
#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr ""
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Spostare queste units è incoerente con la loro sezione \"uses\". Vedi la finestra Messaggi."
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr ""
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr ""
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr ""
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr ""
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr ""
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr ""
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Cartelle multiple sono separate da punto e virgola"
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", pacchetti multipli: "
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Salva i messaggi in un file (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflitto di nomi"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Nome del build mode attivo"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nome della nuova procedura"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nuovo"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nuova classe"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nuova applicazione console"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Crea un nuovo file.%sScegliere il tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Crea un file di testo vuoto."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Crea un nuovo progetto.%sScegliere il tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Crea un nuovo packege standard.%sUn pacchetto è un insieme di unit e componenti."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Crea una nuova unit con un modulo dati."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Crea una nuova unit con un frame."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Crea una nuova unit con una form LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Eredita dalla form o dal componente di un progetto"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nessuna voce selezionata"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Selezionare prima una voce."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nuova codifica:"
#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Macro %d"
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Nuovo Macroname"
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Nuova pagina"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nuovo progetto)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Nuove macro registrate. Da non salvare"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Aggiunte nuove unit alla sezione uses:"
#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Non fare il backup dei file"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Non è selezionato alcun profilo da costruire."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Nessun cambiamento"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nessun codice selezionato"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nessuna opzione di compilazione ereditata."
#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr ""
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "Nessun consiglio"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nessuna finestra IDE selezionata"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Nessun file LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Nessuna macro selezionata"
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(nessun messaggio selezionato)"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "senzanome"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "nessuno, clicca per sceglierne uno"
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Nesuno selezionato)"
#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "nessun nodo selezionato"
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Nessun file Pascal"
#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr "Nessun file programma \"%s\" trovato."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nessuna sezione ResourceString trovata"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalmente il filtro è un'espressione regolare. Nella Simple Syntax un . è un normale carattere, un * sta per qualsiasi cosa, un ? sta per qualsiasi caratterre singolo, e la virgola ed il punto e virgola separano le alternative. Per esempio: la Simple Syntax *.pas *pp corrisponde all'espressione regolare ^(.*\\pas|.*\\.pp)$ "
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nessuna stringa costante trovata"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Non è un pacchetto da progetto"
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Non è un pacchetto installato"
#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr ""
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Nota"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Basso"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Cima"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Nota: impossibile creare il modello define per sorgenti Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Nota: impossibile creare il modello define per sorgenti Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "nessun modello selezionato"
#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr ""
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "non installato"
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Non ora"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Ora caricato:"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Crea un nuovo progetto"
#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Numero di files da convertire: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "L'analizzatore oggetti viene mostrato quando si selezionano componenti nel designer."
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - predefinito"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "percorso oggetto"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Passa ai tab Favorites dell'analizzatore oggetti"
#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr " del pacchetto %s"
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " dell'Analizzatore Progetti"
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Aggiungere alle proprietà preferite"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Scegliere una classe base per la proprietà preferita \"%s\"."
#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "Classe \"%s\" non trovata."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Togliere dalle proprietà preferite"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "autoinstallato dinamico"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "autoinstallato statico"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Descrizione: "
#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription: %s"
msgstr "%sDescrizione: %s"
#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename: %s"
msgstr "Nome file: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "installato dinamico"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "installato statico"
#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense: %s"
msgstr "%sLicenza: %s"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "mancante"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modificato"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Apri pacchetto caricato"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nome pacchetto"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Selezionare un pacchetto"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "solalettura"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Stato"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format, fuzzy
#| msgid "%sThis package is installed, but the lpk file was not found"
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sQuesto pacchetto è installato ma il file lpk non è stato trovato"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Vecchia classe"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Su riga di break (es. tasto return o enter)"
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr ""
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Solo i messaggi che sodisfano questa espressione regolare:"
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Solo i messaggi con questi ID FPC (separati da virgola):"
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Ricerca solo parole intere"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Su incolla da appunti"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Apri"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Apri come file XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Apri il designer quando apri una unit"
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "La form viene sempre caricata nel designer quando si apre la unit del sorgente."
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Apri un file già esistente"
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Apri file"
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Apri file"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr ""
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr ""
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr ""
#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Apri %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Aprire il pacchetto?"
#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "Aprire il pacchetto %s"
#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Apri file pacchetto"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Aprire il progetto?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Apri progetto"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Apri di nuovo il progetto"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Apri file progetto"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Apri il file come sorgente normale"
#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format, fuzzy
#| msgid "Open the package %s?"
msgid ""
"Open the package \"%s\"?\n"
"\n"
"The \"Package\" menu has separate commands for opening packages and a list of recent ones."
msgstr "Aprire il pacchetto %s?"
#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format, fuzzy
#| msgid "Open the project %s?"
msgid ""
"Open the project \"%s\"?\n"
"\n"
"The \"Project\" menu has separate commands for opening projects and a list of recent ones."
msgstr "Aprire il progetto %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Aprire opzioni strumenti"
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Apri URL"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Apri XML"
#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Opzioni"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""
#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ", OS: %s"
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format, fuzzy
#| msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "il percorso altri sorgenti del pacchetto \"%s\" contiene la cartella \"%s\", che è già nel percorso di ricerca della unit."
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr ""
#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
#, fuzzy
#| msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Imposta la lingua usata. Per esempio --language=de. Per i possibili valori vedi i files nella cartella languages."
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, fuzzy
#| msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr "%sscavalca il compilatore predefinito (es. ppc386 ppcx64 ppcppc ecc.). il valore è salvato in environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy
#| msgid "%soverride the project or IDE build mode."
msgid "Override the project or IDE build mode."
msgstr "%sscavalca il modo di costruzione del progetto."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr "%signora la CPU del progetto (es. i386 x86_64 powerpc ecc.). Predefinito: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr "%signora il sistema operativo del progetto (es. win32, linux). Predefinito: %s"
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetsetegdefault
#, object-pascal-format
msgid "Override the project widgetset. For example: %s. Default: %s."
msgstr ""
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' è già usato da TReader/TWriter. Scegliete un altro nome."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pacchetto"
#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "pacchetto %s"
#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", pacchetto %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Informazioni sul pacchetto"
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr ""
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Il nome del pacchetto inizia con ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Il nome del Pacchetto contiene ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Il pacchetto necessita di installazione"
#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr "Opzione del pacchetto \"%s\""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Cartelle di uscita del pacchetto"
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Cartelle sorgenti del pacchetto"
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "unit del pacchetto "
#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr "Pagina"
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Nome della pagina"
#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr "Il nome della pagina \"%s\" esiste già. Non agggiunta."
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Panico"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analizzato"
#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr "parser \"%s\": %s"
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr ""
#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr ""
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "incolla dagli appunti"
#: lazarusidestrconsts.lispastefromclipboard
#, fuzzy
#| msgid "Paste from clipboard"
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Incolla dagli Appunti "
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Percorso"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Esplora"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Cancella percorso non valido"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Sposta il percorso in giù (Ctrl+Freccia giù)"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Sposta il percorso in su (Ctrl+Freccia su)"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Aggiungi percorso alla lista"
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Cancella il percorso selezionato"
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Rimuovere i percorsi inesistenti (grigi) dalla lista"
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Sostituire il percorso selezionato con un nuovo"
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Aggiungere un modello alla lista"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Modelli di percorso"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Percorsi di ricerca:"
#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr ""
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "percorso della cache di instantfpc"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Cartella dell'utility make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Cartella della Instance fallita:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "&Pausa"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Svuota per usare il nome del pacchetto"
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Disabilita I18N dell'lfm"
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr ""
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Aggiungere al progetto"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Applica i cambiamenti"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr ""
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Chiama %sregistra%s la procedura della unit selezionata"
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr ""
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Ripulire le dipendenze ..."
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Cancella nome del file delle dipendenze preferito/predefinito"
#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr ""
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Compilare tutto?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compila il pacchetto"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Creare fpmake.pp"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Crea il Makefile"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Proprietà delle dipendenze"
#: lazarusidestrconsts.lispckediteditgeneraloptions
#, fuzzy
#| msgid "Edit General Options"
msgid "Edit general options"
msgstr "Modifica opzioni generali"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Proprietà del file"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installa"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versione massima non valida"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versione minima non valida"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versione massima:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versione minima:"
#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Modificato: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Sposta dipendenza in giè¹"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Sposta dipendenza in su"
#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr ""
#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Pacchetto %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Il pacchetto \"%s\" è cambiato.%sSalvare il pacchetto?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "pacchetto %s non salvato"
#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Pagina: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Ri-aggiungi dipendenza"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Ri-aggiungi file"
#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Sola lettura: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Ricompila tutto quello che serve"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Ricompila dopo un clean"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Ri-compilare questo e tutti i pacchetti richiesti?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Plugin registrati"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registra la unit"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Rimuovi dipendenza"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Rimuovere le dipendenze \"%s\"%sdal pacchetto \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "File rimossi"
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacchetti richiesti rimossi"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Rimuovi file"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Rimuovere il file?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Rimuovere il file \"%s\"%sdal pacchetto \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Rimuovi voce selezionata"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Pacchetto richiesto"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Salva il pacchetto"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Salva il nome del file come predefinito per questa dipendenza"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Salva il nome del file come preferito per questa dipendenza"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versione massima \"%s\" non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versione minima \"%s\" non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Disinstalla"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Mostra sorgente del pacchetto"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Base, non può essere disinstallato"
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Installato"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installa alla prossima partenza"
#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sStato: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Disinstalla alla prossima partenza (se non richiesto da un pacchetto installato)"
#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Disinstallare il pacchetto %s"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Aggiungi opzioni ai pacchetti e progetti dipendenti"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Aggiungi percorsi ai pacchetti/progetti dipendenti"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Autore:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Esegui automaticamente il build se necessario"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Quando ricostruisci tutto, fallo automaticamente"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personalizzato"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Descrizione/Sommario"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Progettazione"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Progettazione e esecuzione"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrazione IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipo pacchetto non valido"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Libreria"
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licenza:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Maggiore"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilazione manuale (mai automaticamente)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minore"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Oggetto"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Tipo pacchetto"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Fornisce"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Versione"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Esecuzione"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Il pacchetto \"%s\" ha la flag di auto installazione.%sCiò significa che sarà installato nell'IDE.%sI pacchetti di installazione sdevono essere pacchetti di progettazione."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Questo pacchetto fornisce lo stesso dei pacchetti seguenti:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Aggiorna/Ricostruisci"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Uso"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Pacchetto"
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Percorsi di ricerca per i file xml di fpdoc. Separati da punto e virgola."
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Mostra dipendenze inutili"
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Quando la form viene salvata, l'IDE può scrivere tutte le proprietà TTranslateString nel file po del pacchetto. Per farlo dovete abilitare I18N per questo pacchetto, indicare la cartella per il po, e lasciare questa opzione non marcata."
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Interrompi"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progressione"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Collassare la cartella"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Trovato un conflitto"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Edita unit virtuale"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Espandere la cartella"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nome del file:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Ripara il case dei file"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nome del file della unit non valido"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nome della unit non valido"
#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr "File mancanti del pacchetto %s"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Il nuovo file non è nel percorso include"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgid "No files missing. All files exist."
msgstr "Nessun file mancante. Tutti i file esistono."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Rimuovi file"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Ripristina pacchetto"
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Salva il pacchetto come ..."
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Mostra la gerarchia delle cartelle"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Mostrare i file mancanti"
#: lazarusidestrconsts.lispeshowpropspanel
msgid "Show properties panel"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Ordina i file definitivamente"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Ordina i file alfabeticamente"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Il file \"%s\"non è attualmente nel percorso unit del pacchetto.%sAggiungere \"%s\" al percorso unit?"
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nome della Unit:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Usa tutte le unità nella cartella"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Non usare nessuna unit nella cartella"
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Ripulire le dipendenze del pacchetto"
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Pulisci selezione"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Cancellare le dipendenze"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Vuoi veramente eliminare tutti i cambiamenti al pacchetto %s e ricaricarlo dal file?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nuova unit non nel percorso unit"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Pubblica pacchetto"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Ripristina pacchetto?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Il file \"%s\"%snon è attualmente nel percorso unit del pacchetto.%sAggiungere \"%s\" al percorso unit?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sAggiunta nuova dipendenza per il pacchetto %s: pacchetto %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sAggiunta nuova dipendenza per il progetto %s: pacchetto %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Trovata unit ambigua"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Pacchetti installati automaticamente"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sEntrambi i pacchetti sono connessi. Ciè² significa che un pacchetto usa l'altro o che entrambi sono usati da un terzo pacchetto."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dipendenza errata"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Trovate dipendenze circolari"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Cancellare il vecchio file pacchetto?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "Cancellare il vecchio file pacchetto \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Dipendenza senza proprietario: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Errore durante la lettura del pacchetto"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Errore nella scrittura del pacchetto"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Il file è già nel pacchetto"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Il file è nel progetto"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Il nome del file differisce dal nome del pacchetto"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Il nome del file è in uso da un altro pacchetto"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Il nome del file è in uso dal progetto"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "File \"%s\" non trovato."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "File non salvato"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "L'installazione del pacchetto %s installerà automaticamente il pacchetto:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "L'installazione del pacchetto %s installera automaticamente i seguenti pacchetti:"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Estensione del file non valida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Estensione file pacchetto non valida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nome file pacchetto non valido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nome pacchetto non valido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nome pacchetto non valido"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Caricando il pacchetto %s si sostituirà il pacchetto %s%sdal file %s.%sIl vecchio pacchetto è stato modificato.%sSalvare il vecchio pacchetto %s?"
#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Pacchetto: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflitti di pacchetto"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Il pacchetto non è un pacchetto di progettazione"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Il pacchetto è necessario"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Il nome del pacchetto esiste già"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Il pacchetto deve avere l'estensione .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Compilare prima il pacchetto."
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Salvare il file prima di aggiungerlo ad un pacchetto."
#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Progetto: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Ricostruire Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Rinominare il file in minuscolo?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "Sostituire file esistente \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Sostituisci file"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Uno o più pacchetti richiesti non sono stati trovati. Vedere il grafico dei pacchetti per i dettagli."
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Salvare il pacchetto?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Salva il pacchetto %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Rinomina del pacchetto in minuscolo in\"%s\"%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Salta questo pacchetto"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Il file \"%s\"%sè già nel pacchetto %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Il file \"%s\" non è un pacchetto lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Il nome del file \"%s\" non corrisponde ad un nome pacchetto \"%s\" nel file.%sCambiare il nome del pacchetto in \"%s\"?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Il nome file \"%s\" è parte del progetto corrente.%sProgetti e pacchetti non devono condividere file."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Il nome del file \"%s\" è in uso dal%spacchetto \"%s\"%snel file \"%s\"."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Il seguente pacchetto non è stato caricato: "
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "I seguenti pacchetti non sono stati caricati:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sLe seguenti unit saranno aggiunte alla sezione uses di%s%s:%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Il nome del file del pacchetto \"%s\" in%s\"%s\" non è un nome di pacchetto valido per Lazarus."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Il pacchetto %s è un pacchetto di sola esecuzione.%s Questi pacchetti non possono essere installati nell'IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format, fuzzy
#| msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "Il pacchetto \"%s\" è compilato automaticamente e la sua cartella di uscita è \"%s\", che è nel percorso predefinito di ricerca delle unit del compilatore. Il pacchetto usa altri pacchetti che a loro volta usano il percorso predefinito di ricerca del compilatore. Questo crea un circolo vizioso.%sPotete risolvere questo problema rimuovendo il percorso dalla configurazione del compilatore (p.es. fpc.cfg)%soppure disabilitando l'auto-aggiornamento di questo pacchetto oppure rimuovendo le dipendenze."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format, fuzzy
#| msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Il pacchetto \"%s\" è marcato per l'installazione ma non lo trovo.%sTolgo la dipendenza dall'elenco installazione pacchetti?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format, fuzzy
#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Il pacchetto %s è richiesto da %s, che è marcato per l'installazione.%sVedere il grafico pacchetto."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Il nome del pacchetto \"%s\" non è valido.%sScegliere un altro nome (es. pacchetto1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Il nome del pacchetto \"%s\" del%sfile \"%s\" non è valido."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Il pacchetto \"%s\" è stato marcato.%sAttualmente lazarus supporta solo pacchetti con link statico. La vera disinstallazione necessita della ricostruzione e del rilancio di Lazarus.%sVuoi ricostruirlo ora?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Il pacchetto \"%s\" è marcato per l'installazione.%sAttualmente lazarus supporta solo pacchetti con link statico. L'installazione dovà ricostruire Lazarus e riavviarlo.%sVuoi ricostruire Lazarus ora?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Il progetto richiede il pacchetto \"%s\".%sMa non è stato trovato, Vedere progetto -> Analizzatore progetti."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Ci sono due unit con lo stesso nome:%s1. \"%s\" da %s%s2. \"%s\" da %s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "C'è una dipendenza circolare nei pacchetti. Vedere il grafico pacchetti."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Esiste una unit FPC con lo stesso nome del pacchetto:%s\"%s\""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Esiste una unit FPC con lo stesso nome di:%s\"%s\" da %s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "C'è già un pacchetto con il nome \"%s\".%sConflitto fra pacchetti. \"%s\"%sFile: \"%s\""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Esiste già un pacchetto \"%s\" caricato%sdal file \"%s\".%sVedere Componenti -> Grafico pacchetto.%sImpossibile sostituirlo."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "C'è un pacchetto non salvato fra quelli richiesti. Vedere il grafico pacchetti."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "C'è una unit con lo stesso nome di un pacchetto:%s1. \"%s\" da %s%s2. \"%s\""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Questo è un pacchetto virtuale. Non ha ancora sorgente. Salvare prima il pacchetto."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Impossibile creare la cartella destinazione per lazarus:%s\"%s\".%sLa cartella è necessaria per il nuovo IDE lazarus ricostruito con i pacchetti personalizzati."
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Impossibile scrivere il pacchetto \"%s\"%snel file \"%s\".%sErrore: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Disinstallare pacchetto?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Disinstallare pacchetto %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Pacchetto non salvato"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Usa unit"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Attenzione: il file \"%s\"%sappartiene al progetto corrente."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "mantieni"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nuovo"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "rimuovere"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Selezionare un pacchetto"
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
#, fuzzy
#| msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "Le seguenti dipendenze non sono necessarie, per la transitività automatica delle dipendenze fra pacchetti."
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format, fuzzy
#| msgid "The project overrides the output directory of the following packages.%sSee Project / Compiler Options / Additions and Overrides%s%s"
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "Il progetto scavalca la cartella di uscita dei seguenti pacchetti%sVedi Progetto / Opzioni Progetto / Aggiunte e Overrides%s%s"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Questo file non è in nessun pacchetto caricato."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Non riesco a leggere il file del pacchetto \"%s\".%sErrore: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Riproduci"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Globale"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Riferimenti del pacchetto"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr ""
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr ""
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Utente"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
#, fuzzy
#| msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Correggere l'errore mostrato nella finestra messaggi, che si trova normalmente sotto alla finestra dell'editor"
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Aprire una unit prima di eseguire."
#: lazarusidestrconsts.lispleaseplacetheeditorcaretonanidentifierifthisisane
msgid "Please place the editor caret on an identifier. If this is a new unit, please save the file first."
msgstr ""
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Selezionare codice per estrarre una nuova procedura/metodo."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<TUTTI>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Cambia Carattere"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copia nome del metodo negli Appunti"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtra confrontando ogni parte del metodo"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtra confrontando l'inizio del metodo"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Salta alla Selezione"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nessuno>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Oggetti"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Elenco procedure"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Scegliere la cartella dei file .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Non salvare alcuna informazione di sessione"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Salva in un file .lps nella cartella IDE config"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Salva nel file .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Salva nel file .lps nella cartella del progetto"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Salva l'informazione di sessione in "
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi è il file principale di informazioni sul progetto, .lps è un file separato per i soli dati della sessione."
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr ""
#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr "%s (posizione fuori dal sorgente)"
#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr ""
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Parola precedente"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format, fuzzy, badformat
#| msgid "primary config directory, where Lazarus stores its config files. Default is "
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "cartella di configurazione primaria, sede dei file di configurazione di Lazarus. Predefinita è "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Percorso di configurazione primario"
#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr "precedente %s"
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privato"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Metodo privato"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format, fuzzy
#| msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Probabilmente devi installare alcuni pacchetti prima di continuare.%sAttenzione:%sIl progetto usa i seguenti pacchetti in fase di progetto, che potrebbero essere necessari per aprire la form nel progetto. Se continui adesso, potresti ricevere errori di componenti mancanti e il caricamento della form mostrerà controlli incompleti o impossibili.%sSi consiglia di annullare l'operazione, installare nell'IDE i pacchetti mancanti e riprovare."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedura"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedura con interfaccia"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Rilevato programma"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Un programma in Free Pascal a riga di comando, con alcune utili predisposizioni aggiunte"
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "I sorgenti del programma devono avere un'estensione tipo pascal come .pas, .pp o .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "La dipendenza esiste già"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Aggiungi file editor"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versione Min-Max non valida"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versione non valida"
#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versione massima (opzionale):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versione minima (opzionale):"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr ""
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nuovo requisito"
#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nome pacchetto:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pacchetto non trovato"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr ""
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "La dipendenza \"%s\" non è stata trovata.%sScegliere un pacchetto esistente."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La versione massima \"%s\" non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La versione massima è più bassa della versione minima."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La versione minima \"%s\" non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Il progetto ha già una dipendenza per il pacchetto \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Il nome unit \"%s\" esiste già nel progetto%scon file: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Il nome unit \"%s\" esiste già nella selezione%scon file: \"%s\"."
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Il nome unit esiste già"
#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Progetto %s"
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Progetto:"
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "Progetto"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Il progetto è cambiato"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "I file del progetto su disco sono cambiati"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Cartella progetto"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nome file progetto"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Percorso degli include del progetto"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Rilevato file di informazioni sul progetto"
#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Il progetto è eseguibile"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Generare un binario eseguibile che può essere lanciato."
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Progetto"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Proprietà delle macro del progetto"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Opzione del progetto"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Cartella di output del progetto (es. la cartella ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Cartella di output del progetto"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Cartella del file principale del progetto"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Sessione del progetto"
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Sessione del progetto cambiata"
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Cartelle sorgenti del pacchetto"
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s All'indirizzo %1:x"
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr "Il progetto %s ha sollevato una eccezione di classe '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Il progetto %s ha sollevato una eccezione di classe '%s' con messaggio:%s%s."
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s Nel file '%1:s' all'indirizzo %2:x"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s Nel file '%1:s' alla riga %2:d"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s Nel file '%1:s' alla riga %2:d:%0:s%3:s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Percorso dei sorgenti del progetto"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "unit del progetto"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Percorso della unit del progetto"
#: lazarusidestrconsts.lisprojectver
msgid "Project version"
msgstr ""
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Wizard dei progetti"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Conferma la cancellazione della dipendenza"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Conferma la rimozione del file"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Cancella la dipendenza di %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Analizzatore progetti - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacchetti richiesti rimossi"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Rimuovo il file %s dal progetto?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr "Rimuovi %s voci dal progetto?"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Costruisci sempre (anche se nulla è cambiato)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Può essere necessario se c'è un baco nel controllo delle dipendenze, normalmente non serve."
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Impossibile cambiare l'elenco form autogenerate nei sorgenti del programma.%sCorreggere prima gli errori."
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Prompt di richiesta dato"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Proprietà (togli o cambia)"
#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protetto"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Metodo protetto"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Metodo pubblico"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Metodo pubblicato"
#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr ""
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr ""
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Pubblica cartella progetto"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Pubblica il progetto"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Salva file .lrs nella cartella di output"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "La risorsa sara disponibile per FPC."
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Una unit pascal deve avere un'estensione .pp o .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Edita unit virtuale"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "C'è già una unit con questo nome.%sFile: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Il nome della unit non è un identificatore pascal valido"
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Il nome della Unit e del file non corrispondono.%sEsempio: unit1.pas e Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Convertire un progetto Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Nuovo Progetto"
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "&Apri progetto"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Apri progetto &recente"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Mostra &esempi di progetto"
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr ""
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Errore di QuickFix"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Rimedi veloci"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Cerca l'identificatore"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Esci"
#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "&Esci da Lazarus"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Conferma eliminazione?"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Linguette recenti"
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Registrato"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Ripristina"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Espressione regolare"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relativa"
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Rimuovere"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Rimuovere?"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Elimina tutte le proprietà non valide"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Rimuovi tutti i filtri di tipo di messaggio"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Togli tutte le unit"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Rimuovere l'opzione del compilatore \"nascondi messaggio\" "
#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Rimuovere %s dipendenze dal pacchetto \"%s\"?"
#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr "Proprietà «%s» rimossa."
#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "Rimuovere %s file dal pachetto \"%s\"?"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Togli dal progetto"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Togli dal percorso di ricerca"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Rimuovere il percorso degli include?"
#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr "Elimina la variabile locale \"%s\""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Rimuovi il filtro di tipo di messaggio"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Rimuovi file non esistenti"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Rimuovi le unit scelte"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Rimuovili"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Rimuovi i cammini da \"Altri sorgenti\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Rimuovere il percorso delle unit?"
#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr "Rimuovere uses \"%s\""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Rinomina"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Rinomina ..."
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Rinomina il file?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Rinomina del file fallita"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Mostra la lista degli identificatori rinominati"
#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Rinomina a %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Rinomina in minuscolo"
#: lazarusidestrconsts.lisrenamingaborted
msgid "Renaming aborted"
msgstr ""
#: lazarusidestrconsts.lisrenamingconflict
msgid "Renaming conflict"
msgstr ""
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Riapri il progetto"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Riaprire con altra codifica"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "&Sostituisci"
#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Proprietà \"%s\" sostituita con \"%s\"."
#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Tipo \"%s\" sostituito con \"%s\"."
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Sostituzione"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Sostituisci funzioni"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Sostituzioni"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Ripara unità e tipi sconosciuti"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Sostituire l'intero identificatore"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Sostituzione della selezione fallita."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Ri-ricerca"
#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr "Ripristina"
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Ripristinare tutti i filtri di file ai valori predefiniti?"
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Ripristina i valori Left, Top, Width, Height del componente riportandoli a quelli del componente padre?"
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Ogni nome di risorsa deve essere unico."
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Errore di salvataggio risorsa"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Tipo delle risorse del progetto:"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "&Riavvia"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Risultato:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
#, fuzzy
#| msgid ""
#| "returns list of all values of case variable in front of variable\n"
#| "\n"
#| "Optional Parameters (comma separated):\n"
#| "WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation"
msgstr "ritorna lalista di tutti i valori della variabile case a fronte della variabile"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Ripristino fallito"
#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr ""
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancoraggio a destra"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Spazio del bordo destro. Il valore è sommato allo spazio base del bordo e usato per lo spazio a sinistra del controllo."
#: lazarusidestrconsts.lisrightgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Questo è il controllo compagno a cui il lato destro è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Lato destro"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Spazia a destra equidistante"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Esegui"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "I pacchetti \"Progettazione e Esecuzione\" non hanno limitazioni."
#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr "%s (in esecuzione...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "File non eseguibile"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format
msgid "The host application \"%s\" is not executable."
msgstr "L'applicazione host \"%s\" non è eseguibile"
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Esegui"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Solo esecuzione, non può essere installato nell'IDE"
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "I pacchetti \"Solo esecuzione\" possono essere usati solo dai progetti. Non possono essere installati nell'IDE, neppure indirettamente"
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
#, fuzzy
#| msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "I pacchetti \"esecuzione\" possono essere usati dai progetti. Non possono essere installati nell'IDE, se non nel caso in cui un pacchetto \"progettazione\" li richieda."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Fallito \"esegui fino a\""
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Metodo astratto - non ancora scavalcato"
#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "Metodo astratto di %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Il cursore non è nella dichiarazione di classe"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "L'IDE è occupata"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s è una classe astratta e ha %s metodi astratti."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nessun metodo astratto trovato"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Sovrascrivi tutta la selezione"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Sovrascrivi il primo selezionato"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Selezione nulla"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Ci sono %s metodi astratti da sovrascrivere.%sScegliere i metodi per cui creare degli stub:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Non ci sono altri metodi astratti da sovrascrivere"
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Non si può sovrascrivere un metodo con un altro nella stessa classe"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Non posso mostrare i metodi astratti della classe attuale, perché"
#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Salva"
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Salva tutto"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Salva tutti i selezionati"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Salva tutti i file modificati"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Copiare i messaggi (Tutti/Originali) nel file ..."
#: lazarusidestrconsts.lissaveandexitdialog
#, fuzzy
#| msgid "Save and exit dialog"
msgid "Only Save"
msgstr "Salva e esci dalla finestra"
#: lazarusidestrconsts.lissaveandrebuildide
#, fuzzy
#| msgid "Save and rebuild IDE"
msgid "Rebuild IDE"
msgstr "Salva e ricostruisci l'IDE"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Salvare i file modificati?"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Salvare i cambiamenti?"
#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Salva i cambiamenti al progetto %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Salva file dell'editor corrente"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Salvato con le impostazioni dell'IDE"
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Salvato con la sessione del progetto"
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Salvare il file \"%s\"%sprima di chiudere la form \"%s\"?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Salva la macro con nome"
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Salva i messaggi"
#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr "Salva il progetto %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr "Salva le modifiche di questa sessione nel progetto %s?"
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Salva informazioni di fold"
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "L'editor supporta il \"folding\" (nascondere temporaneamente) blocchi di codice."
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Salva storico salti"
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Il Ctrl-Click su un identificatore nell'editor è salvato nello storico dei salti."
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Salva le impostazioni"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Salva i messaggi mostrati nel file ..."
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Salva "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr ""
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Fattore di scala:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Scansione dei file della cartella superiore"
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Ricerca dei file sorgenti nelle cartelle collegate (cartella superiore e suoi discendenti)"
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Scansione"
#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Scansione della cartella superiore"
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Percorsi di ricerca"
#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format, fuzzy, badformat
#| msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "cartella di configurazione secondaria, dove Lazarus cerca i modelli di file di configurazione. Predefinita è "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Percorso di configurazione secondario"
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Vedi messaggi."
#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sVedi progetto -> Analizzatore progetti"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Seleziona una voce di aiuto:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Seleziona un nodo"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Seleziona un altro \"widgetset\" LCL (macro LCLWidgetType)"
#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
#, fuzzy
#| msgid "Select Delphi form files (*.dfm)"
msgid "Select Delphi form files (*.dfm|*.fmx)"
msgstr "Seleziona file form Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Selezionato"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Aggiunta selezionata:"
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Selezionata e controlli figli"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(selezionato vicino sotto) "
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Mappatura del comando selezionato"
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "scelti per l'installazione"
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "scelti per la disinstallazione"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(selezionato vicino a sinistra) "
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Messaggio selezionato nella finestra messaggi:"
#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(selezionato vicino a destra) "
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(selezionato vicino sopra) "
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Scegli il file"
#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr ""
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Scegliere la cartella sorgente FPC"
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "La selezione è più lunga della costante stringa"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Strumento di selezione"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Selezionare la cartella dei sorgenti di Lazarus"
#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr "Selezionare il percorso per %s"
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Selezionare la cartella di destinazione"
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Regola tutti i colori:"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Imposta predefinito"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Attiva questo per tradurre i messaggi del compilatore in un'altra lingua (cioè non inglese). Per esempio Italiano: $(FPCSrcDir)/compiler/msg/erroriu.msg."
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(imposta indentazione predefinita)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Breve:"
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr ""
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Breve, senza percorso"
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Mostra"
#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr "Mostra metodi astratti di \"%s\""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Mostra l'albero dei componenti"
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Mostra suggerimenti di dichiarazione"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Mostra differenze fra modi ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Mostra unit/pacchetti vuoti"
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Mostra Glifi per"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Mostra separatore"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Mostra aiuto"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Mostra suggerimenti nell'analizzatore oggetti"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Mostra gli identificatori"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Mostra box informazioni"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Mostra l'ID del tipo di messaggio"
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr ""
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Mostra solo modificati"
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
#, fuzzy
#| msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Mostra solo un pulsante nel vassoio di sistema per l'intera IDE, invece di un pulsante per finestra. Alcuni window manager di Linux, come Cinnamon non supportano questa funzione e mostrano sempre un pulsante per finestra."
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
#, fuzzy
#| msgid "Show overview Gutter"
msgid "Show overview gutter"
msgstr "Mostra gutter riassuntivo"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Mostra i pacchetti"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Mostra la posizione dell'editor sorgente"
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr ""
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Mostrare in testa gli identificatori usati recentemente"
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Mostra i percorsi relativi"
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Mostra tutti i controlli gerarchicamente ad albero."
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Un riquadro in basso mostra la descrizione della proprietà selezionata."
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
#, fuzzy
#| msgid "Show setup dialog for most important settings"
msgid "Show setup dialog for most important settings."
msgstr "Mostra dialogo di configurazione per le impostazioni più importanti"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Mostra caratteri speciali"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Mostra barra di stato"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Mostra le unit"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Mostra le unit con sezioni di initialization/finalization"
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Queste unit potrebbero inizializzare dati globali usati dal programma o applicazione. Attenzione prima di rimuoverle."
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Mostra le unit inutilizzate ..."
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Mostra i suggerimenti sui valori nel debugging"
#: lazarusidestrconsts.lisshowversionandexit
#, fuzzy
#| msgid "show version and exit"
msgid "Show version and exit."
msgstr "Mostra versione ed esci"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Riduci al più piccolo"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Fratello"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Programma semplice"
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Il più semplice programma Free Pascal a riga di comando."
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Sintassi semplice"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Salta gli errori"
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Salta file"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Salta il file e continua a caricare"
#: lazarusidestrconsts.lisskiploadinglastproject
#, fuzzy
#| msgid "Skip loading last project"
msgid "Skip loading last project."
msgstr "Non caricare l'ultimo progetto"
#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr ""
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Più lento ma più accurato."
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Più piccolo piuttosto che più veloce"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Corrispondenze"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Spiacente, questo tipo non è ancora implementato"
#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr ""
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr ""
#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr ""
#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Ascendente"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "Maiuscolo/Minuscolo"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Discendente"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Dominio"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignora gli spazi"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Righe"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opzioni"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragrafi"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Anteprima"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accetta"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Ordina selezione"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Parole"
#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "La cartella sorgente \"%s\" non esiste."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Window manager dell'editor sorgenti"
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Sorgente modificato"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Il sorgente della pagina \"%s\" è cambiato. Salvarlo?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "I sorgenti delle pagine sono cambiati. Salvare la pagina \"%s\"? (seguono altre %d)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Percorsi dei sorgenti"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Spazia equidistante"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Cerca SO"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Sto cercando"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Trova il testo"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Inizia la conversione"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Avviare l'IDE"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Inizia con un nuovo progetto"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "La barra di stato mostra il nome della proprietà e la classe in cui è pubblicata."
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Stop"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Fermare il debugging corrente e ricostruire il progetto?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Fermati per le eccezioni"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Conserva i separatori di percorso \\ e / come"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Errore di streaming"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub procedura"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub procedura sullo stesso livello"
#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr ""
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Successo"
#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Esportato con successo in \"%s\""
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "Esportati con successo %d BuildMode in \"%s\""
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Esportate con successo le opzioni compilatore in \"%s\""
#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Importato con successo da \"%s\""
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "Importati con successo %d BuildMode da \"%s\""
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Importate con successo le opzioni compilatore da \"%s\""
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Suggerire il nome predefinito del nuovo file in minuscolo"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Percorso di include sospetto"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Percorso delle unit sospetto"
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nome variabile non valido"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" non è un identificatore valido"
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Sovrascrivi variabile di sistema"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Commuta le impostazioni del filtro"
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Passa ai tab dei Preferiti dopo aver chiesto il nome del componente"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Modo sintassi"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu non trovato. Verificate il vostro fpc.cfg."
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Riordinare l'ordine di tabulazione di tutti i controlli figlio di \"%s\" secondo la loro posizione?"
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Sposta il controllo selezionato in giù nell'ordine di tabulazione"
#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "Ordine di tabulazione di %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr ""
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr ""
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Calcola l'ordine di tabulazione de controlli secondo la loro posizione X- e Y-"
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Sposta il controllo selezionato in su nell'ordine di tabulazione"
#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "Linguette per %s"
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Destinazione:"
#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", Destinazione: %s"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU di destinazione"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nome file destinazione: (-o, vuoto = usa cartella di output delle unit)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nome file di destinazione (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nome file di destinazione del progetto"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nome file di destinazione e parametri"
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "La destinazione è in modalità sola lettura."
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "SO di destinazione"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Cella editabile"
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format, fuzzy
#| msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Inserisci una Cella editabile. Si può navigare sulle celle con il TAB%0:sLa macro \"param\" accetta una lista di argomenti separati da virgola.%0:sIl primo argomento è il valore predefinito.%0:sIl secondo (opzionale) può essere usato per collegare la cella ad un'altra (syncro edit)%0:s%0:s mentre param(\"foo\") esegue param(foo);%0:sInserisce 2 celle indipendenti, entrambe con il testo predefinito \"foo\"%0:sLe virgolette sono opzionali%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 t%0:sInserisce 2 celle collegate, modificarne una cambia anche l'altra%0:sIl valore \"1\" si riferisce alla posizione dell'altro parametro \"param()\", quindi, se ci sono più parametri:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "File di modelli"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Cartella di test"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "URL di test"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr "Creato Application Bundle per \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "La classe \"%s\" è un TControl e può essere incollata solo su un controllo.%sImpossibile incollare."
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Il file del compilatore \"%s\" non sembra corretto:%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format, fuzzy
#| msgid "The component %s can not be deleted, because it is not owned by %s."
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "Non si può cancellare il componente %s, perché non è posseduto da %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "L'editor di componenti della classe \"%s\" ha creato l'errore:%s\"%s\""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "L'editor componente della classe \"%s\"%sinvocata con il verbo #%s \"%s\"%sha prodotto l'errore:%s\"%s\""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Il componente %s è ereditato da %s.%sDeve essere cancellato dall'interno del componente antenato."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Il componente %s è ereditato da %s.%sDeve essere rinominato dall'interno del componente antenato."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Il nome del componente deve essere unico in tutti i componenti del formo del datamodule. Il nome è trattato senza fare differenze tra maiuscole e minuscole come i normali identificatori pascal."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "La configurazione sarà retrocessa/convertita."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "%s contiene una cartella inesistente:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s contiene un carattere asterisco *.%sLazarus lo usa come un carattere normale e non lo espande come un carattere jolly."
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "FPC non ha un file di configurazione. Probabilmente non troverà alcune unit. Verificate la vostra installazione di fpc."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Il debugger \"%s\"%snon esiste o non è eseguibile.%sVedere Strumenti -> Opzioni -> Debugger"
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Il modo predefinito deve essere memorizzato nel progetto, non nella sessione."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format
msgid "The destination directory%s\"%s\" does not exist."
msgstr "La cartella di destinazione%s\"%s\" non esiste."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "La cartella \"%s\" non contiene più file inclusi dal progetto. Rimuovere questa cartella dai percorsi di ricerca degli include del progetto?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "La cartella \"%s\" non contiene più unit del progetto. Rimuovere questa cartella dai percorsi di ricerca delle unit del progetto?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "La cartella \"%s\" non è più usata nel percorso delle unit.%s La rimuovo?"
#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "Il file \"%s\""
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "L'indice del file serve per funzioni come 'trova dichiarazione' Durante la ricerca potete modificare e compilare i sorgenti, ma le funzioni come 'trova dichiarazione' mostreranno errori di 'unit non trovata'. Ci vorrà un minuto o due."
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Il file \"%s\" non è un progetto Lazarus.%sCreo un nuovo progetto per questo %s?"
#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr "La maschera \"%s\" non è valida."
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "La maschera \"%s\" non è una espressione regolare valida."
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Il file \"%s\" sembra essere un programma.%sChiudere il progetto corrente e creare un nuovo progetto Lazarus per questo programma?%s\"No\" caricherà il file come sorgente normale."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Il file %s sembra essere un programma o un progetto di Lazarus già esistente."
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Il file \"%s\" non è stato trovato.%sVolete cercarlo da soli?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Il file \"%s\" non è stato trovato.%sIgnora continuerà a caricare il progetto, %sAnnulla fermerà il caricamento."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "I seguenti metodi usati da %s non sono nel sorgente%s%s%s%s%sRimuovere i riferimenti erronei?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "La cartella dei sorgenti FPC \"%s\" non sembra corretta:%s%s"
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "L'eseguibile del compilatore Free Pascal ha tipicamente un nome come \"%s\". Potete anche usare il compilatore specifico per la destinazione come \"%s\". Fornire il percorso completo del file."
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "L'identificatore è una unit. Usate la funzione File -> Salva per rinominare una unit."
#: lazarusidestrconsts.listheidentifierisaunitproceedanyway
#, object-pascal-format
msgid "The identifier is a %s.%sNew file(s) will be created, old can be deleted.%sProceed anyway?"
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format, fuzzy
#| msgid "The key %sis already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "Il tasto %s%sè già assegnato a %s.%sSostituire la vecchia assegnazione con la nuova funzione%s%s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "L'Application Bundle %s%snecessario per l'esecuzione non esiste oppure non è eseguibile.%sNe volete creare uno?%sVedi Progetto -> Opzioni progetto -> Applicazione per le impostazioni necessarie."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "L'applicazione di partenza \"%s\"%snon esiste o non è eseguibile.%sVedere Esegui -> parametri di esecuzione -> Locale"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "La cartella Lazarus contiene i sorgenti dell'IDE, i pacchetti dell'LCL e molti altri pacchetti standard. Per esempio contiene il file \"ide%slazarus.lpi\". Anche i file di traduzione si trovano lì. "
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "La cartella Lazarus \"%s\" non sembra corretta:%s%s"
#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Il file (form Lazarus) LFM contiene proprietà non valide. Ciò significa per esempio che contiene proprietà/classi che non esistono nella LCL corrente. Il rimedio classico è di eliminare queste proprietà dall'LFM e aggiustare il codide pascal manualmente."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "La macro \"%s\" non comicia con \"%s\"."
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "L'eseguibile \"make\" ha tipicamente un nome \"%s\". È necessario per costruire l'IDE. Fornire il percorso completo del file."
#: lazarusidestrconsts.listhenamecontainsapascalkeyword
#, object-pascal-format
msgid "The name \"%s\" contains a Pascal keyword."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Il nuovo file include non è ancora nel percorso di ricerca degli include.%sAggiungo la cartella %s al percorso di ricerca?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "La nuova unit non è ancora nel percorso di ricerca delle unit.%sAggiungo la cartella %s al percorso di ricerca?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "La vecchia configurazione verrà aggiornata."
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Altri sorgenti\" contiene una cartella che è già in \"Altri file di unit\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "Manca la cartella di output \"%s\""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "La cartella di output di %s è elencata nel percorso di ricerca degli include di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "La cartella di output di %s è elencata nel percorso di ricerca degli include ereditato di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "La cartella di output di %s è elencata nel percorso di ricerca delle unit ereditato di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "La cartella di output di %s è elencata nel percorso di ricerca delle unit di %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "La cartella di output dovrebbe essere diversa da quella dei sorgenti, e non contenere nessun sorgente."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "La classe proprietaria ha questo nome"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Il proprietario ha questo nome"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Il pacchetto %s aggiunge il percorso \"%s\" q quello degli include dell'IDE.%sProbabilmente il pacchetto non è ben configurato."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Il pacchetto %s aggiunge il percorso \"%s\" a quello delle unit dell'IDE.%sProbabilmente il pacchetto non è ben configurato."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Il pacchetto contiene già una unit con questo nome"
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format, fuzzy
#| msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "Il pacchetto %s non può essere installato, perché richiede il pacchetto \"%s\", che è un pacchetto di sola esecuzione."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format, fuzzy
#| msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "Il pacchetto %s è necessario all'IDE e non può essere disinstallato."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format, fuzzy
#| msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Il pacchetto %s non ha nessuna procedura \"Register\". Questo significa in genere che noncontiene nessun addon per l'IDE stessa. Installarlo nell'IDE servirà solo ad aumentarne la dimensione in RAM e forse a renderla instabile.%sConsiglio: se volete solo usare il pacchetto nel vostro progetto, usate il comando da menu \"Aggiungi al progetto\"."
#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr "Il pacchetto %s è già nella lista"
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Il pacchetto %s non è un pacchetto di progettazione. Non può essere installato nell'IDE."
#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Il percorso di \"make\" non è corretto: \"%s\""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Il programma \"make\" non è stato trovato.%sQuesto strumento è necessario per il build di Lazarus."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Le opzioni per compilatore del progetto e le direttive nel sorgente principale sono diverse. Per le nuove unit sono usati questa stringa di opzioni e questo modo di costruzione:"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Il progretto non usa le unit di interfaccia LCL, ma sembra averne bisogno.%sSe non usate le interfacce LCL avrete strani errori dal linker in fase di costruzione del progetto."
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr ""
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Il progetto non ha un sorgente principale."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Il file informazioni di progetto \"%s\"%sè uguale al file sorgente principale del progetto!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Il file informazioni di progetto\"%s\"%sè stato modificato sul disco."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Il progetto deve essere salvato prima della costruzione%sSe si imposta la cartella di test nelle opzioni di ambiente,%ssi possono creare nuovi progetti e costruirli tutti insieme.%sSalvare il progetto? "
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Il progetto ha destinazioni OS=%s e CPU=%s.%sLa unit system.ppu per queste destinazioni non è stata trovata nelle cartelle binarie di FPC. %sAssicuratevi che FPC sia installato correttamente per queste destinazioni e che fpc.cfg contenga le cartelle giuste."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "Il progetto scrive i simboli di debug in un file esterno. Il \"%s\" supporta solo simboli contenuti nell'eseguibile."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr ""
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr "%sCi sono ulteriori note per questo messaggio in%s"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Ci sono altri file con lo stesso nome nella cartella,%sche differiscono solo per le maiuscole:%s%s%sVuoi cancellarli?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "C'è un file con lo stesso nome ed estensione simile su disco%sFile: %s%sFile ambiguo: %s%sCancellare il file ambiguo?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "C'è già un build mode con questo nome"
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr "C'è già una classe componente con nome %s."
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "C'è già un componente con questo nome"
#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr "C'è già un file %s%s%sin %s"
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "C'è già in file \"%s\" in %s%sVecchio: %s%sNuovo:%s%s%sContinuare?"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "C'è già una form con il nome \"%s\""
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr "C'è già una macro con il nome \"%s\""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr "C'è già una macro IDE con il nome \"%s\""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr "C'è già un pacchetto %s nella lista"
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "C'è già una unit \"%s\" in %s%sVecchio: %s%sNuovo:%s%sDovete assicurarvi che il percorso di ricerca delle unit ne contenga uno solo.%s%sContinuare?"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "C'è già una unit con il nome \"%s\". Gli identificativi Pascal devono essere unici."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "C'è già una unit con nome \"%s\" nel progetto.%sScegliere un altro nome."
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "Non c'è un fpc.exe nella cartella di %s. Normalmente l'eseguibile di make è installato insieme al compilatore FPC"
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Deve esistere almeno un modo di costruzione."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "La classe di risorse \"%s\" discende da \"%s\". Forse è solo un errore di battitura per TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "C'è stato un errore nella scrittura del componente selezionato %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "C'è stato un errore nella conversione dello stream binario del componente selezionato %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "C'è stato un errore nella copia dello stream del componente sugli appunti:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Il componente radice non può essere cancellato."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Questi file saranno cancellati"
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Queste impostazioni sono salvate con il progetto."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Queste unit non sono state trovate:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "I sorgenti di Free Pascal sono necessari per navigare nel codice e per il completamento automatico. Per esempio contengono il file \"%s\""
#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr ""
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr ""
#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr "La destinazione %s non è scrivibile."
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "La cartella di test non è stata trovata:%s\"%s\"%s(vedere opzioni IDE)"
#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr "La unit \"%s\" esiste già"
#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr "La unit appartiene al pacchetto %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "La unit %s esiste due volte nel percorso delle unit di %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "La unit ha questo nome"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Il nome di file della unit \"%s\" non è in minuscolo.%sIl compilatore Freepascal cerca solo nomi in minuscolo. Si consiglia di usare un nome in minuscolo.%sRinomino il file in minuscolo?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format, fuzzy
#| msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "La unit %s fa parte dei sorgenti FPC, ma il corrispondente file xml fpdoc non è stato trovato.%sO non avete ancora aggiunto la cartella fpcdocs ai percorsi di ricerca oppure la unit non è ancora documentata.%sI file fpdoc per i sorgenti FPC si possono scaricare da: %s%sAggiungere la cartella nelle opzioni dell'editor di fpdoc.%sPer poter creare un nuovo file, la cartella deve essere scrivibile."
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "La unit %s è usata da altri file.%sAggiorno automaticamente i riferimenti?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "La unit stessa ha già il nome \"%s\". Gli identificatori Pascal devono essere unici."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Il percorso di ricerca unit di \"%s\" contiene la cartella dei sorgenti \"%s\" del pacchetto %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "La cartella di lavoro \"%s\" non esiste.%sControllate la cartella di lavoro in Menu -> Esegui -> Comandi di esecuzione."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr "Questo componente contiene già una classe con nome %s."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Per questa funzione serve un file .LFM aperto nell'editor sorgente."
#: lazarusidestrconsts.listhishelpmessage
#, fuzzy
#| msgid "this help message"
msgid "This help message."
msgstr "questo messaggio di aiuto"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Questo è un progetto di test per un pacchetto di progettazione, per il test fuori dall'IDE."
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format, fuzzy
#| msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Questo sembra un file pascal. %sSi raccomanda di utilizzare nomi di file in minuscolo per evitare problemi in altri filesystem e compilatori. %sRinominare in minuscolo?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Questo progetto non ha un sorgente principale."
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Questo progetto ha solo il build mode predefinito."
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Questo gruppo di opzioni per costruire Lazarus non è supportato da questa installazione.%sLa cartella \"%s\" non è scrivibile.%sVedi il sito web di Lazarus per informazioni su altri modi di installarlo."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Questo comando non può essere estratto.%sSelezionare del codice per estrarre una nuova procedura/metodo."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Questo creerà una dipendenza circolare."
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Questo trasferirà moltissimo testo (%s) negli appunti.%sProseguire?"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "Titolo"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
#, fuzzy
#| msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr "Il titolo nella taskbar mostra per esempio: progetto1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titolo (lasciare vuoto per usare il predefinito)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Percorso:"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""
#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr "lo strumento \"%s\" non ha un eseguibile"
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Intestazione strumento: Fallita"
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Intestazione strumento: In esecuzione"
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Intestazione strumento: Scorrimento in su"
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Intestazione strumento: Successo"
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "lo strumento ha terminato con codice di uscita %s. Usare il menu contestuale per maggiori informazioni."
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listop
#, fuzzy
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Cima"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancoraggio superiore"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Spazio del bordo superiore. Questo valore viene aggiunto allo spazio bordo base, ed è usato per lo spazio sopra il controllo."
#: lazarusidestrconsts.listopinfoview
#, fuzzy
#| msgid "Show Class/Proc Hint"
msgid "Show Class/Procedure hint"
msgstr "Mostra Suggerimenti della Classe/Proc"
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Cime"
#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Questo è il controllo compagno a cui il bordo superiore è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Spazia in cima equidistante"
#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr ""
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Tradurre i messaggi dall'inglese"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "L'albero necessita di refresh"
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Due file spostati hanno lo stesso nome:%s%s%s%s%sin %s"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Tipi (non rimossi se non sostituibili)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Cartelle aggiuntive:"
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Tutte le unit del pacchetto"
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Tutte le unit dell'editor"
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Tutte le unit"
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Per difetto la ricerca è effettuata soltanto nelle unit del progetto e nelle unit aperte nell'editor. Aggiungere qui una lista separata da punti e virgola di cartelle in cui estendere la ricerca."
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Collassa tutti i nodi"
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Espandi tutti i nodi"
#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "File: %s"
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr "L' implementazione usa: %s"
#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr "l' implementazione usa: %s"
#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr "l'interfaccia usa: %s"
#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr "L'interfaccia usa: %s"
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Progetti e pacchetti"
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Scansione in corso..."
#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Scansione: %s unit ..."
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Ricerca)"
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Trova l'occorrenza successiva di questa frase"
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Trova la prossima unit con questa frase"
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Trova l'occorrenza precedente di questa frase"
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Trova la precedente unit con questa frase"
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Unit selezionate"
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Mostra i nodi per le cartelle"
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Mostra i nodi per progetti e pacchetti"
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unit"
#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Unit: %s"
#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr "Usato da implementazione: %s"
#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr "usato da implementazione: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr "Usato da Interfaces: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr "usato da Interfaces: %s"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Non mostrare più questo messaggio"
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Errore nell'espressione regolare"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Carattere senza UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Vai alla riga:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Non trovato"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Sostituisci questa occorrenza di \"%s\"%s con \"%s\"?"
#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "In cerca di: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Continuare la ricerca dall'inizio?"
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Continuare la ricerca dalla fine?"
#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "La stringa '%s' non è stata trovata!"
#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Il vostro sistema sembra usare UTF-8, ma l'attuale font dell'editor non lo supporta.%sE' possibile che i caratteri non ASCII vengano visualizzati male.%sDovreste scegliere un font diverso nelle opzioni dell'editor."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Pulisci la cache degli include"
#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s byte"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Incluso da:"
#: lazarusidestrconsts.lisuidinproject
#, fuzzy
#| msgid "in Project:"
msgid "In project:"
msgstr "In progetto:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Righe:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "no"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Dimensione:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipo"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "sì"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Mostra valori CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Impossibile convertire lo stream binario in testo"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Impossibile copiare i componenti negli appunti"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Impossibile aggiungere una intestazione di commento al file risorse %s\"%s\".%sE' probabilmente un errore di sintassi."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Impossibile aggiungere la risorsa T%s:FORMDATA al file risorse %s\"%s\".%sE' probabilmente un errore di sintassi."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format, fuzzy
#| msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Impossibile aggiungere la dipendenza %s, perché il pacchetto %s ha già una dipendenza %s"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format, fuzzy
#| msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Impossibile aggiungere la dipendenza %s, perché creerebbe una dipendenza circolare. Dipendenza %s"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format, fuzzy
#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Impossibile aggiungere %s al progetto: contiene già una unit con lo stesso nome."
#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Backup del file \"%s\" in \"%s\" impossibile!"
#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sImpossibile cambiare classe da %s a %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr "Unable to change project title in source.%s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Impossibile pulire la cartella di destinazione"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Impossibile pulire \"%s\".%sControllare i permessi."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Impossibile convertire il testo del componente in formato binario:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Impossibile convertire il file \"%s\"%sErrore: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Impossibile convertire dati di form testo del file %s\"%s\"%sin formato di stream binario. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
#, fuzzy
#| msgid "Unable to create new file, because there is already a directory with this name."
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Impossibile creare il nuovo file, perché c'è già una cartella con lo stesso nome."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Impossibile creare un buffer temporaneo lfm."
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Impossibile cancellare il file ambiguo \"%s\""
#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr "impossibile eseguire: %s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Impossibile trovare una sezione ResourceString in questa o in altre unit usate."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format
msgid "Unable to find a valid classname in \"%s\""
msgstr "Impossibile trovare un nome classe valido in \"%s\""
#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "Impossibile trovare il file \"%s\"."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Impossibile trovare il file \"%s\".%sSe esso appartiene al vostro progetto, controllate il percorso di ricerca in%sProgetto -> Opzioni del compilatore -> Cammini di ricerca ->Altri file unit. Se questo file appartiene a un pacchetto, controllate le opzioni del compilatore per i pacchetto. Se appartiene a Lazarus, accertatevi di compilare dopo aver pulito tutto. Se il file appartiene a FPC; controllate fpc.cfg. Se non siete sicuri, controllate Progetto -> Opzioni del compilatore ... -> Test"
#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "Impossibile trovare %s nello stream LFM."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Impossibile trovare il metodo."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Impossibile trovare una unit pascal (.pas, .pp) per il file .lfm%s\"%s\""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Impossibile trovare la classe componente \"%s\".%sNon è registrato tramite RegisterClass e nessun lfm trovato.%sÈ richiesto dalla unit:%s%s"
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Impossibile raccogliere i cambiamenti dell'editor."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Impossibile ottenere il sorgente per il designer."
#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr "Impossibile caricare il file %s: %s"
#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr "Impossibile caricare il pacchetto \"%s\""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format, fuzzy
#| msgid "Unable to load the component class \"%s\", because it depends on itself."
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Non posso caricare la classe componente \"%s\", perché dipende da se stessa."
#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr "Impossibile aprire \"%s\""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Non posso aprire il componente antenato."
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Impossibile aprire il form designer.%sLa classe %s non discende da una classe editabile dal designer come TForm o TDataModule."
#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "Impossibile leggere %s"
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "impossibile leggere ExitStatus del processo"
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Impossibile rimuovere il vecchio file di backup \"%s\"!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr "Impossibile rimuovere il titolo del progetto dal sorgente.%s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Impossibile rinominare il file ambiguo \"%s\"%s in \"%s\""
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Impossibile rinominare form nel sorgente."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Impossibile rinominare il metodo. Correggere l'errore mostrato nella finestra messaggi."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Impossibile rinominare variabile nel sorgente."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Impossibile eseguire"
#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Impossibile impostare il controllo AnchorSide"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Impossibile mostrare il metodo."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Impossibile fare uno stream dei componenti selezionati"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Impossibile fare uno stream dei componenti selezionati."
#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "Impossibile fare lo streaming %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Impossibile trasformare lo stream componente binario di %s:T%s in testo."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Impossibile aggiornare il comando CreateForm nel sorgente del progetto"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Deseleziona tutto"
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Annulla"
#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "Disinstalla %s"
#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "disinstallazione impossibile"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Disinstalla la selezione"
#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr ""
#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr "L'Unit \"%s\" è cambiata. Salvare?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Esiste l'identificatore della unit"
#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s unit %s nel pacchetto %s"
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nome unit già nel progetto"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Il nome della Unit inizia con ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Il nome della Unit contiene ..."
#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr "unit %s non trovata"
#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr "unit %s non trovata alla nuova posizione \"%s\""
#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Cartella risultati unit"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "percorso unit"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Path di ricerca delle Unit"
#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr "la unit %s richiede il pacchetto %s"
#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "Unit inutilizzate di %s"
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Nome del file compilatore inconsueto. Normalmente comincia con fpc, ppc o ppcross."
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Su"
#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Aggiornare informazioni"
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Aggiornare le firme dell'altra procedura quando è cambiato solo maiuscolo/minuscolo"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Aggiorno i riferimenti?"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Aggiorna"
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Aggiorna la configurazione"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "stringa maiuscola"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
#, fuzzy
#| msgid "Uppercase string given as parameter"
msgid "Uppercase string given as parameter."
msgstr "Stringa in maiuscolo passata come parametro"
#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr "URL sul wiki (l'urls di base è %s)"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Messaggio di aiuto (opzione -h)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Usa Ansistring"
#: lazarusidestrconsts.lisuseanyway
#, object-pascal-format
msgid "Use \"%s\" anyway"
msgstr ""
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Usare CheckBox per valori booleani"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Usa i commenti nelle opzioni personalizzate"
#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr " usato da %s"
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Usare pacchetti da progetto"
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Usato per form auto-create."
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr ""
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Usa identificatore"
#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "Usa identificatore %s in %s a %s"
#: lazarusidestrconsts.lisuseinstead
#, object-pascal-format
msgid "Use \"%s\" instead"
msgstr ""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Sto lanciando l'applicazione"
#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "Usa il pacchetto %s nel pacchetto %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Usa pacchetto nel pacchetto"
#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "Usa il pacchetto %s nel progetto"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Usa il pacchetto nel progetto"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Aggiungi alla lista \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Markup testuale definito dall'utente"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Elimina dalla lista \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr "Commuta sulla lista \"%s\""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Cartella home dell'utente"
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Aggiungi la unit alla sezione Uses"
#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "Usa la unit %s nella unit %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 con BOM"
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valore"
#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Valore(%s)"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Valore: "
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valori"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "I valori cambiati rispetto ai predefiniti sono conservati nel file .lfm, e sono evidenziati nell'analizzatore oggetti."
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variabile"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Prolisso"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Verifica chiamate a metodi"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versione"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Versione non corrispondente"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Verticale"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copiare le info di versione nella clipboard"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Molto prolisso"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Mostra il sorgente (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Avviso:"
#: lazarusidestrconsts.liswarnings
#, object-pascal-format <